NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F031310

Metagenome / Metatranscriptome Family F031310

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031310
Family Type Metagenome / Metatranscriptome
Number of Sequences 183
Average Sequence Length 42 residues
Representative Sequence MITLIVIIVVVWTLIRIVQFVTRLWRRADAAGSPRIGVVAAA
Number of Associated Samples 111
Number of Associated Scaffolds 183

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 65.38 %
% of genes near scaffold ends (potentially truncated) 47.54 %
% of genes from short scaffolds (< 2000 bps) 88.52 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.617 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(52.459 % of family members)
Environment Ontology (ENVO) Unclassified
(61.202 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(51.913 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.29%    β-sheet: 0.00%    Coil/Unstructured: 45.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 183 Family Scaffolds
PF00702Hydrolase 19.67
PF00122E1-E2_ATPase 4.37
PF12974Phosphonate-bd 2.19
PF01927Mut7-C 0.55
PF00481PP2C 0.55
PF02705K_trans 0.55
PF14759Reductase_C 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 183 Family Scaffolds
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 4.37
COG2216K+ transport ATPase, ATPase subunit KdpBInorganic ion transport and metabolism [P] 4.37
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 4.37
COG0631Serine/threonine protein phosphatase PrpCSignal transduction mechanisms [T] 0.55
COG1656Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domainGeneral function prediction only [R] 0.55
COG3158K+ uptake protein KupInorganic ion transport and metabolism [P] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.62 %
UnclassifiedrootN/A10.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573004|GZGWRS402G5S9EAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300003219|JGI26341J46601_10011179All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylococcus → Methylococcus capsulatus2937Open in IMG/M
3300004092|Ga0062389_102902706Not Available641Open in IMG/M
3300004635|Ga0062388_102453664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M
3300005332|Ga0066388_100683271All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1636Open in IMG/M
3300005332|Ga0066388_100716633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1605Open in IMG/M
3300005332|Ga0066388_100921947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1449Open in IMG/M
3300005332|Ga0066388_100994681All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1404Open in IMG/M
3300005332|Ga0066388_107821628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300005764|Ga0066903_100574776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1943Open in IMG/M
3300005764|Ga0066903_102301589All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylococcus → Methylococcus capsulatus1041Open in IMG/M
3300005764|Ga0066903_107563036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300005764|Ga0066903_107918322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M
3300010043|Ga0126380_10653791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium837Open in IMG/M
3300010048|Ga0126373_10820596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium992Open in IMG/M
3300010343|Ga0074044_11045316Not Available535Open in IMG/M
3300010358|Ga0126370_10096267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2034Open in IMG/M
3300010359|Ga0126376_12338017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300010361|Ga0126378_10077525All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae3208Open in IMG/M
3300010361|Ga0126378_11334858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300010362|Ga0126377_12733466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300010376|Ga0126381_100328544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2106Open in IMG/M
3300010376|Ga0126381_100747529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1401Open in IMG/M
3300010376|Ga0126381_101019783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1194Open in IMG/M
3300010376|Ga0126381_101477189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium982Open in IMG/M
3300010376|Ga0126381_104028792Not Available571Open in IMG/M
3300010376|Ga0126381_104529699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300010398|Ga0126383_11287033All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium821Open in IMG/M
3300011120|Ga0150983_13390635All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1712Open in IMG/M
3300012361|Ga0137360_10568395All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae969Open in IMG/M
3300016270|Ga0182036_10293435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1234Open in IMG/M
3300016270|Ga0182036_11480974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300016319|Ga0182033_12159604Not Available508Open in IMG/M
3300016341|Ga0182035_10118561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1975Open in IMG/M
3300016341|Ga0182035_10669496All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae902Open in IMG/M
3300016341|Ga0182035_10779442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium838Open in IMG/M
3300016357|Ga0182032_11929410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300016371|Ga0182034_10008393All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae5673Open in IMG/M
3300016387|Ga0182040_10129458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1766Open in IMG/M
3300016387|Ga0182040_11374607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300016404|Ga0182037_10564227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300016404|Ga0182037_12082729Not Available510Open in IMG/M
3300017970|Ga0187783_10828893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium667Open in IMG/M
3300017970|Ga0187783_10834723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300020579|Ga0210407_10165870All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1707Open in IMG/M
3300020579|Ga0210407_10335992All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1181Open in IMG/M
3300020580|Ga0210403_10337112All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1234Open in IMG/M
3300021178|Ga0210408_10546453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium919Open in IMG/M
3300021406|Ga0210386_11223694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300021439|Ga0213879_10222122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300021444|Ga0213878_10267718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium729Open in IMG/M
3300021476|Ga0187846_10000079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria56992Open in IMG/M
3300021476|Ga0187846_10009874All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae4631Open in IMG/M
3300021476|Ga0187846_10033935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae2303Open in IMG/M
3300021479|Ga0210410_10290995All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1466Open in IMG/M
3300021559|Ga0210409_11216231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300021560|Ga0126371_10019948All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomagnum → Methylomagnum ishizawai6176Open in IMG/M
3300021560|Ga0126371_10483709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1385Open in IMG/M
3300021560|Ga0126371_10700082All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1161Open in IMG/M
3300021560|Ga0126371_10810383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1082Open in IMG/M
3300021560|Ga0126371_12853510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300021560|Ga0126371_13828762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300022726|Ga0242654_10029181All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1427Open in IMG/M
3300022726|Ga0242654_10187560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium712Open in IMG/M
3300022726|Ga0242654_10231113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300027783|Ga0209448_10041627All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1544Open in IMG/M
3300027824|Ga0209040_10070256All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae2050Open in IMG/M
3300027915|Ga0209069_10654044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300030740|Ga0265460_12023065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300030776|Ga0075396_1948975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300030844|Ga0075377_10809355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300030969|Ga0075394_12095032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300031057|Ga0170834_111818889All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae898Open in IMG/M
3300031057|Ga0170834_112819425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylococcus → Methylococcus capsulatus704Open in IMG/M
3300031128|Ga0170823_15400068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300031231|Ga0170824_103999977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300031446|Ga0170820_15586900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium755Open in IMG/M
3300031446|Ga0170820_16494122All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1739Open in IMG/M
3300031469|Ga0170819_16341309Not Available548Open in IMG/M
3300031474|Ga0170818_115424595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300031543|Ga0318516_10009091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae4733Open in IMG/M
3300031543|Ga0318516_10246296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1033Open in IMG/M
3300031544|Ga0318534_10650697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300031544|Ga0318534_10763819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300031545|Ga0318541_10041277All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae2335Open in IMG/M
3300031545|Ga0318541_10066328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1884Open in IMG/M
3300031545|Ga0318541_10196539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1116Open in IMG/M
3300031545|Ga0318541_10261089All Organisms → cellular organisms → Bacteria → Proteobacteria963Open in IMG/M
3300031545|Ga0318541_10277457All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300031545|Ga0318541_10332594All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300031545|Ga0318541_10357734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300031546|Ga0318538_10021371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2891Open in IMG/M
3300031546|Ga0318538_10102138All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloterricola → Methyloterricola oryzae1481Open in IMG/M
3300031546|Ga0318538_10259662Not Available933Open in IMG/M
3300031546|Ga0318538_10322044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi834Open in IMG/M
3300031546|Ga0318538_10708749Not Available546Open in IMG/M
3300031561|Ga0318528_10468960Not Available676Open in IMG/M
3300031573|Ga0310915_10313510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1109Open in IMG/M
3300031640|Ga0318555_10064773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1878Open in IMG/M
3300031640|Ga0318555_10215707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1035Open in IMG/M
3300031679|Ga0318561_10515133Not Available659Open in IMG/M
3300031682|Ga0318560_10266884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium921Open in IMG/M
3300031708|Ga0310686_101904348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1129Open in IMG/M
3300031708|Ga0310686_117606415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium654Open in IMG/M
3300031719|Ga0306917_10476147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium979Open in IMG/M
3300031719|Ga0306917_10958975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium668Open in IMG/M
3300031719|Ga0306917_11293596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300031723|Ga0318493_10111236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1385Open in IMG/M
3300031724|Ga0318500_10109286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1266Open in IMG/M
3300031736|Ga0318501_10125914All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300031744|Ga0306918_10411106All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300031747|Ga0318502_10166576All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1263Open in IMG/M
3300031751|Ga0318494_10006653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae5263Open in IMG/M
3300031751|Ga0318494_10299636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium927Open in IMG/M
3300031753|Ga0307477_10025880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4008Open in IMG/M
3300031764|Ga0318535_10264051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium771Open in IMG/M
3300031765|Ga0318554_10042905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2461Open in IMG/M
3300031768|Ga0318509_10011969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae3789Open in IMG/M
3300031768|Ga0318509_10787701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300031769|Ga0318526_10106378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1124Open in IMG/M
3300031770|Ga0318521_10196669All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1163Open in IMG/M
3300031770|Ga0318521_10269195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium998Open in IMG/M
3300031771|Ga0318546_10505358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium848Open in IMG/M
3300031771|Ga0318546_10583887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium786Open in IMG/M
3300031771|Ga0318546_10839748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300031771|Ga0318546_11012287Not Available584Open in IMG/M
3300031777|Ga0318543_10026136All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae2230Open in IMG/M
3300031777|Ga0318543_10186836All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae918Open in IMG/M
3300031778|Ga0318498_10186541All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae942Open in IMG/M
3300031778|Ga0318498_10224781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium849Open in IMG/M
3300031779|Ga0318566_10261727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium857Open in IMG/M
3300031780|Ga0318508_1152895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300031781|Ga0318547_11035697Not Available513Open in IMG/M
3300031782|Ga0318552_10168358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1104Open in IMG/M
3300031792|Ga0318529_10128036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1160Open in IMG/M
3300031793|Ga0318548_10061703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1738Open in IMG/M
3300031796|Ga0318576_10388818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300031796|Ga0318576_10416721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi635Open in IMG/M
3300031797|Ga0318550_10089360All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1441Open in IMG/M
3300031797|Ga0318550_10470096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium607Open in IMG/M
3300031798|Ga0318523_10437279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300031799|Ga0318565_10165178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1075Open in IMG/M
3300031805|Ga0318497_10138717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1326Open in IMG/M
3300031805|Ga0318497_10608957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300031821|Ga0318567_10330888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylococcus → Methylococcus capsulatus860Open in IMG/M
3300031832|Ga0318499_10052153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1532Open in IMG/M
3300031832|Ga0318499_10375395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300031846|Ga0318512_10353260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300031860|Ga0318495_10388876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300031879|Ga0306919_11171421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300031879|Ga0306919_11523647Not Available503Open in IMG/M
3300031893|Ga0318536_10479272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium626Open in IMG/M
3300031896|Ga0318551_10181077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1160Open in IMG/M
3300031896|Ga0318551_10532503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300031910|Ga0306923_10670564All Organisms → cellular organisms → Bacteria → Proteobacteria1157Open in IMG/M
3300031910|Ga0306923_11875861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300031912|Ga0306921_10266462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2006Open in IMG/M
3300031946|Ga0310910_10139237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1846Open in IMG/M
3300031946|Ga0310910_10999041Not Available654Open in IMG/M
3300031954|Ga0306926_12213321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300031959|Ga0318530_10371963Not Available592Open in IMG/M
3300032001|Ga0306922_10092289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae3192Open in IMG/M
3300032001|Ga0306922_10373148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1529Open in IMG/M
3300032010|Ga0318569_10333119Not Available707Open in IMG/M
3300032035|Ga0310911_10283017All Organisms → cellular organisms → Bacteria → Proteobacteria953Open in IMG/M
3300032039|Ga0318559_10141274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1089Open in IMG/M
3300032039|Ga0318559_10228445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium858Open in IMG/M
3300032044|Ga0318558_10328559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300032060|Ga0318505_10105375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1280Open in IMG/M
3300032063|Ga0318504_10042426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1873Open in IMG/M
3300032063|Ga0318504_10213526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium903Open in IMG/M
3300032064|Ga0318510_10114428All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1039Open in IMG/M
3300032064|Ga0318510_10242109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria739Open in IMG/M
3300032066|Ga0318514_10199514All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1048Open in IMG/M
3300032076|Ga0306924_10358870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1671Open in IMG/M
3300032076|Ga0306924_12306980Not Available545Open in IMG/M
3300032076|Ga0306924_12435075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300032261|Ga0306920_100816289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1368Open in IMG/M
3300032261|Ga0306920_102185500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium770Open in IMG/M
3300032261|Ga0306920_104177594Not Available521Open in IMG/M
3300033289|Ga0310914_11509235All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300033290|Ga0318519_10172277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1222Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil52.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.73%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.09%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.09%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.09%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.55%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.55%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.55%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030776Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030844Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FG2_084704702189573004Grass SoilMITLIVAIVVVWTLIRIVQFVTGLWRSADAAGSPRIGVVAAA
JGI26341J46601_1001117943300003219Bog Forest SoilMITLIVIIVVVWTLIRIVQYGSYLWRLANAAGSSRIAAPS*
Ga0062389_10290270613300004092Bog Forest SoilMITLFVIIVVVWTLIRIVQFVSRLWRPVDAAGPPRIGVVAAA*
Ga0062388_10245366413300004635Bog Forest SoilMITLIVVIVVVWTLIRIVQFVSQLWTLANAAGSPRIGVVAAA*
Ga0066388_10068327123300005332Tropical Forest SoilMITSIVTSVVIWTLIRIVQFVSQLWRLTNAARTPRISAIATA*
Ga0066388_10071663333300005332Tropical Forest SoilLITLIVIIVFVWTLIRVVQFVTRLWRNTDATGSAQIGVAAAA*
Ga0066388_10092194713300005332Tropical Forest SoilMITSIVTTVVVWTLIRIVQFVTLLQFVTLLWRIADAAGSPRTRLVAAF*
Ga0066388_10099468133300005332Tropical Forest SoilMITSIVTSVVVWTLIRIVQFLTRLWRIADAEIFPRAGVASAA*
Ga0066388_10782162823300005332Tropical Forest SoilMIKLIVIVAVVWTIVRIVQFVSYLWRLADAAVSWQAAVAA*
Ga0066903_10057477623300005764Tropical Forest SoilMTTLLVIIVVVWTVVRIAQFASYLWRLVNATGSARAGVAAAA*
Ga0066903_10230158923300005764Tropical Forest SoilMITLLVIVVVVWTIIRIVQFGYLWRVANATGAPGIADVATLD*
Ga0066903_10756303623300005764Tropical Forest SoilSRRMITLVVIIVMIWTVVRIVQFVTRLWRGADAASPARIGVDAAA*
Ga0066903_10791832223300005764Tropical Forest SoilMITSIVTTVVVWTLIRIVQFVALLWRIADAEISPRVRAATAA*
Ga0126380_1065379123300010043Tropical Forest SoilMITSIVTSVVIWTLIRIVQFVSQLWTLANAARSPGISAIASA*
Ga0126373_1082059623300010048Tropical Forest SoilMITLIVTIVVIWTLVRIVQFVTGLWRSADAAGSPRIGVAQAA*
Ga0074044_1104531613300010343Bog Forest SoilFIVWTVIRIVQFVRRLWRPVDDAGSPRIGVFAAAQD*
Ga0126370_1009626713300010358Tropical Forest SoilMITSIVTSVVIWTLIRIVQFVSQLWRLANAARTPRISAIATA*
Ga0126376_1233801713300010359Tropical Forest SoilMITLVVIIVVVWTLVRIVQFVTRLWRGADAAGSARIGVVEAA*
Ga0126378_1007752523300010361Tropical Forest SoilMTTLIVTMFVVWTVVRIVQFVTRLWRAADAAGAARIGVAAAT*
Ga0126378_1133485823300010361Tropical Forest SoilMITLIVITVVVWTVIRIVQFVNRLWGPADGEISDRIARVAAA*
Ga0126377_1273346613300010362Tropical Forest SoilLNGSRRRRMITLIVIVVVVWTLVRIAQFVNRLWRGADAAGLARIGIDGAAEG*
Ga0126381_10032854423300010376Tropical Forest SoilMITLIVTIVVIWTLVRIVQFVTGLWRSADAAGSPRIGVAPAA*
Ga0126381_10074752923300010376Tropical Forest SoilMITSIVTTVVVWTLIRIVQFITLLWRIADAEISPRIRAVTAP*
Ga0126381_10101978323300010376Tropical Forest SoilMITLIVTIVVVWTVIRIVQFVARLWSSADAAGSPRIGGVAAA*
Ga0126381_10147718923300010376Tropical Forest SoilMASNLLKALRRCGMITSIFTAVVVWTILRIVQFVTRLWRIADAEIFQRVGVASAA*
Ga0126381_10402879213300010376Tropical Forest SoilRLGLITLIVIIVVWTLIRLAQFVIRLWRGTDATGPARSELAAAA*
Ga0126381_10452969923300010376Tropical Forest SoilMITLLIIIVVVWTLVRIVQFVAQLWRGADGAHPARIGLDAAA*
Ga0126383_1128703323300010398Tropical Forest SoilMITSIVTTVVVWTLIRIVQFVSQLWTLVNAAGSARVGVIAAA*
Ga0150983_1339063543300011120Forest SoilMITSIVTIVVVWTLIRIVQFVTRLWTLANAAGSPRISAIAAA*
Ga0137360_1056839523300012361Vadose Zone SoilMITLIVIIVVVWTVIRIVQFVSRLWRPADGEISKSIGNVA*
Ga0182036_1029343543300016270SoilMITSIVTTVVVWTLIRIVQFVTRLWRIADVEIFPRVGVVSTA
Ga0182036_1148097413300016270SoilPSARRRRGMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPWIGGAAAA
Ga0182033_1215960413300016319SoilMITLIVITVVVWTIIRIVQFVSRLWRPANGKISTRIGVLAAAQG
Ga0182035_1011856113300016341SoilMITLIVIIVVAWTLIRIVQLVTRLWRGADAAGSARIGVVEAA
Ga0182035_1066949613300016341SoilMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGSPRIGG
Ga0182035_1077944223300016341SoilMITSIVTSVVVWTLIRIVQFVSHIWTLANAARSPRISAIAAA
Ga0182032_1192941013300016357SoilMITSIVTSVVVWTLIRIVQFVSQLWTLANAARSPRISAIAAA
Ga0182034_1000839343300016371SoilMITLIVTIVVIWTLVRIVQFVAGLWRSADAAGSPRIGVAQAA
Ga0182040_1012945823300016387SoilMIALFVIIVVVWTLIRIVQFVSRLWRPVDAAGPPRIGVVAAA
Ga0182040_1137460723300016387SoilMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVA
Ga0182037_1056422733300016404SoilVIIVVVWTLIRLVQFVTQLWRGTDAKGGARIAVAAAA
Ga0182037_1208272923300016404SoilMITSIVTSVVVWTLIRIVQFVSQLWTLANAARFPRISAISTA
Ga0187783_1082889323300017970Tropical PeatlandMITLVVIIVVVWTLFRIAQLVTQLWRGTDGAGPARIGVDAAA
Ga0187783_1083472323300017970Tropical PeatlandMITLIVIIAVVWTTIRIVQFLGYPWRLADATVSSQAAVAA
Ga0210407_1016587023300020579SoilMITSIVTTVVVWTLIRIVQFLSQLWTLANGAGSPRISAIAAA
Ga0210407_1033599223300020579SoilMITSIVTSVVVWTLIRIVQFVSQLWTLANAARPPRISAIATA
Ga0210403_1033711233300020580SoilMITSIVTIVVVCTLIRIVQFVTRLWTLANAADSPRISAVAAA
Ga0210408_1054645323300021178SoilMITSIVTIVVVWTLIRIVQFVTRLWTLANAADSPRISAVAAA
Ga0210386_1122369413300021406SoilITSIVTSVVVWTLIRIVQFVSQLWTLANAARSPRISAITTA
Ga0213879_1022212223300021439Bulk SoilMITLIVIIVVAWTLIRIVQFVSRLWRAADAASPASIGVDAAA
Ga0213878_1026771823300021444Bulk SoilMITAIVIIVVVWTLIRIVQLVGWLWRLADAPRIGVVSAAR
Ga0187846_10000079423300021476BiofilmMITLIVIIVVAWSLIRIVQFVTRLWRGADAADSPRIGVVAAA
Ga0187846_1000987433300021476BiofilmMTTLLVIIVVVWTVIRIVQFVSYLWRLASAPGSARIGVAAAA
Ga0187846_1003393543300021476BiofilmMITLIVIIVVVWTLIRIVQFVTRLWRRADAAGSPRIGVVAAA
Ga0210410_1029099523300021479SoilMITSIVTTVVVWTLIRIVQFLSQLWTLANAAGSPRISAIAAA
Ga0210409_1121623113300021559SoilSRRRGLITLIVIIVVAWALIRIVQFVSRLWRGADAAGAARIGVVEAA
Ga0126371_1001994823300021560Tropical Forest SoilMTTLIVTMFVVWTVVRIVQFVTRLWRAADAAGAARIGVAAAT
Ga0126371_1048370933300021560Tropical Forest SoilMITLLVIVVVVWTIIRIVQFGYLWRVANATGAPGIADVATLD
Ga0126371_1070008223300021560Tropical Forest SoilMITLIVTIVVVWTVIRIVQFVARLWSSADAAGSPRIGGVAAA
Ga0126371_1081038323300021560Tropical Forest SoilMITSIVTSVVIWTLIRIVQFVSQLWRLANAARTPRISAIATA
Ga0126371_1285351023300021560Tropical Forest SoilMIKLIVIVAVVWTIVRIVQFVSYLWRLADAAVSRQAAVAA
Ga0126371_1382876213300021560Tropical Forest SoilMITSIVTTVVVWTLIRIVQFVALLWRIADAEISPRVRAATAA
Ga0242654_1002918113300022726SoilSIVTTVVVWTLIRIVQFLSQLWTLADAAGSPRISAIAAA
Ga0242654_1018756023300022726SoilMITSIVTTVVVWTLIRIVQFLSQLWTLANVAGSPRISAIAAA
Ga0242654_1023111313300022726SoilIVTTVVVWTLIRIVQFVSQLWTLANAARSPRISAIATA
Ga0209448_1004162743300027783Bog Forest SoilMITLIVIIVVVWTVIRIVQFVSRLWRPADGEISKRIGNVAAA
Ga0209040_1007025643300027824Bog Forest SoilMITLIVVIVVVWTLIRIVQFVTRLWRPADAASSPRIGVVAAA
Ga0209069_1065404423300027915WatershedsMITLIVIIVVVWTVIRIVQFVSRLWRPADGEISKRIGAAAAA
Ga0265460_1202306513300030740SoilGRRGMITLIVIIVVVWTVIRIVQFVSRLWRPADGEISKRIGNVAAAQG
Ga0075396_194897523300030776SoilRRRSGVITSIFTAVVVWTLIRIVQFVTRLWRIADAEISPRVGVIAAA
Ga0075377_1080935523300030844SoilFVIIVVVWTLIRIVQFVTGLWRSADAAGSPRIGVVAAA
Ga0075394_1209503223300030969SoilIIVVVWTLIRIVQFVSQLWTFANAAGSPSIRFITAA
Ga0170834_11181888923300031057Forest SoilMITSIVIIVVVWTLIRIVQFVSQLWTFANAAGSPSIRFITAA
Ga0170834_11281942523300031057Forest SoilMITLIVAIVVVWTLIRIVQFVTGLWRSADAAGSSRIRVVSAA
Ga0170823_1540006823300031128Forest SoilMITLIVAIVVVWTLIRIVQFVTGLWRSADAAGSSRIRIVSAA
Ga0170824_10399997723300031231Forest SoilVIIVVVWTLVRIVQFVSRLWRPVDAAGSPRIGAVAAA
Ga0170820_1558690023300031446Forest SoilMITSIVIIVVVWTLIRIVQFVSQLWTLANAAGSPRIGVVAAAES
Ga0170820_1649412223300031446Forest SoilMITLIVAIVVVWTLIRIVQFVIGLWRSADAAGSPRIGVVAAA
Ga0170819_1634130923300031469Forest SoilMITSIVTTVVVWSLIRIVQFVSQLWTLANAAGSPRTGFIAAS
Ga0170818_11542459513300031474Forest SoilIQTHRRRGMITSIVTTVVVWTLIRIVQFVSQLWTLANAAGSPRTGFIAAS
Ga0318516_1000909123300031543SoilMITLIVTIVVIWTLVRIVQFVTGLWRSADAAGSPRIGVAQAA
Ga0318516_1024629623300031543SoilMITLIVITVVVWTIIRIVQFVNRLWGPADGEISKRIGSLAAA
Ga0318534_1065069723300031544SoilLITLIVIIVVAWALIRIVQFVTRLWRGADAAGSARIGV
Ga0318534_1076381913300031544SoilMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPRIGGAAAA
Ga0318541_1004127723300031545SoilMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGSPRIGVIAAA
Ga0318541_1006632823300031545SoilMITLIVTIVVVWTVIRIVQFVARLWSGADAAGSPRIGGVAAA
Ga0318541_1019653923300031545SoilMIALFVIIVVVWTPIRIVQFVSRLWRPVDAAGPPRIGVVAAA
Ga0318541_1026108923300031545SoilMITLIVITVVVWTIIRIVQFVSRLWRPANGKISTRSGVLAAAQG
Ga0318541_1027745723300031545SoilMIALFVIIVVVWTLIRIVQFVRRLWRPVDAAGPPRIGVVAAA
Ga0318541_1033259423300031545SoilMITLIVITVVVWTIIRIMQFASRLWRPANGKISTRIGVLAAAQG
Ga0318541_1035773423300031545SoilTLIVITVVVWTIIRIVQFVNRLWGPADGEISKRIGSLAAA
Ga0318538_1002137183300031546SoilIIVVAWALIRIVQFVTRLWRGADAAGSARIGVVEAA
Ga0318538_1010213823300031546SoilMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAAA
Ga0318538_1025966233300031546SoilLFVIIVVVWTPIRIVQFVSRLWRPVDAAGPPRIGVVAAA
Ga0318538_1032204423300031546SoilLFVIIVVVWTLIRIVQFVRRLWRPVDAAGPPRIGVVAAA
Ga0318538_1070874913300031546SoilMITLIVITVVVWTIIRIMQFASRLWRPANGKISTRSGVLAAAQG
Ga0318528_1046896013300031561SoilYKRRVMITLIVITVVVWTIIRIMQFASRLWRPANGKISTRIGVLAAAQG
Ga0310915_1031351043300031573SoilVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAAA
Ga0318555_1006477323300031640SoilMITLIVIIVVAWALIRIVQFVTRLWRGADAAGSARIGVVEAA
Ga0318555_1021570713300031640SoilLITLIVIIVVAWALIRIVQFVTRLWRGADAAGSARIG
Ga0318561_1051513313300031679SoilLITLIVIIVVVWTLIRLVQFVTQLWRGTDAKGGARIAVAAAA
Ga0318560_1026688413300031682SoilRRRRGMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGSPRIGGAAAA
Ga0310686_10190434813300031708SoilSLSARRRRGMITLIVIIVVVWTLVRIVQFVRRLWRPVDAAGSQRIGVVAAA
Ga0310686_11760641523300031708SoilMITLNVVIVVVWTLVRIVQFVSRLWRPVDAAGSPRIGVVAAA
Ga0306917_1047614713300031719SoilMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAA
Ga0306917_1095897513300031719SoilHLTKPIGRLGLITLIVIIVVVWTLIRLVQFVTQLWRGTDAKGGARIAVAAAA
Ga0306917_1129359623300031719SoilMITSIVTTVVVWTLIRIVQFVTRLWRIADAEIFPRVGVVSTA
Ga0318493_1011123613300031723SoilLITLIVIIVVAWALIRIVQFVTRLWRGADAAGSARI
Ga0318500_1010928643300031724SoilRGMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAAA
Ga0318501_1012591423300031736SoilMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPWIGGAAAA
Ga0306918_1041110613300031744SoilMITLIVIIVVAWTLIRIVQLVTRLWRGADAAGSARIEA
Ga0318502_1016657623300031747SoilMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPRIGVIAAA
Ga0318494_1000665353300031751SoilLITLIVILVVAWALIRIVQFVTRLWRGADAAGSARIGVVEAA
Ga0318494_1029963623300031751SoilMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPR
Ga0307477_1002588043300031753Hardwood Forest SoilMITLIVIIVVVWTVIRIVQFVSRLWRPADGEISKRIGDAAAAQG
Ga0318535_1026405113300031764SoilMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPRIGGVAAA
Ga0318554_1004290543300031765SoilTLIVTIVVIWTLVRIVQFVTGLWRSADAAGSPRIGVAQAA
Ga0318509_1001196953300031768SoilLITLIVIIVVAWALIRIVQFVTRLWRGADAAGSARIGVVEAA
Ga0318509_1078770113300031768SoilLGLITLIVIIVVVWTLIRLVQFVTQLWRGTDAKGGARIAVAAAA
Ga0318526_1010637823300031769SoilMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGSPRIGGAAAA
Ga0318521_1019666923300031770SoilMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGPPRIGVAAAA
Ga0318521_1026919513300031770SoilPIGRLGLITLIVIIVVVWTLIRLVQFVTQLWRGTDAKGGARIAVAAAA
Ga0318546_1050535813300031771SoilLITLIVIIVVAWALIRIVQFVSRLWRGADAAGSGRIG
Ga0318546_1058388723300031771SoilLIVTIVVVWTVIRIVQFVTRLWRAADAAGAARIGVAAAA
Ga0318546_1083974823300031771SoilMITLLVIVVVVWTVIRIVQFVTRLWRGADAAGSPRIGVVETA
Ga0318546_1101228723300031771SoilMITLIVITVVVWTIIRIVQFVSRLWRPANGKISTRS
Ga0318543_1002613643300031777SoilMITLIVIIVVAWTLIRIVQLVTRLWRGADDAGSARIEAVGAT
Ga0318543_1018683613300031777SoilMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGSPRIGVI
Ga0318498_1018654113300031778SoilRRGMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPRIGGAAAA
Ga0318498_1022478133300031778SoilLIVIIVFVWTLIRLVQFVTRLWRGTDATRSARIEVAAAA
Ga0318566_1026172713300031779SoilRRGMITLIVTIVVVWTVIRIVQFVARLWSGADAAGSPRIGGVAAA
Ga0318508_115289513300031780SoilLITLIVIIVVAWALIRIVQFVTRLWRGADAAGSARIGVVE
Ga0318547_1103569733300031781SoilMITLIVITVVVWTIIRIVQFVSRLWRPANGKISTR
Ga0318552_1016835843300031782SoilRRRLGMITLIVIIVVAWTLIRIVQLVTRLWRGADAAGSARIEAVGAT
Ga0318529_1012803643300031792SoilGMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAAA
Ga0318548_1006170313300031793SoilTWHLLSAARRRGMITLIVTIVVVWTVIRIVQFVTRLWRAADAAGAARIGVAAAA
Ga0318576_1038881813300031796SoilLFVIIVVVWTLIRVVQFVSRLWRPVDAAGPPRIGVVAAA
Ga0318576_1041672123300031796SoilTRRRYGMIALFVIIVVVWTLIRIVQFVRRLWRPVDAAGPPRIGVVAAA
Ga0318550_1008936043300031797SoilMITLIVTIVVVWTVIRIVQFVTRLWRAADAAGAARIGVAAAA
Ga0318550_1047009623300031797SoilLIVITVVVWTIIRIVQFVNRLWGPADGEISKRIGSLAAA
Ga0318523_1043727913300031798SoilHLLSAARRRGMITLIVTIVVVWTVIRIVQFVTRLWRAADAAGAARIGVAAAA
Ga0318565_1016517843300031799SoilWHLLSAGRRRGMITLIVTIVVVWTVIRIVQFVTRLWRAADAAGAARTGVAAAA
Ga0318497_1013871713300031805SoilMITLIVTIVVIWTLVRIVQFVTGLWRSADAAGSPRIGVA
Ga0318497_1060895713300031805SoilLIVIIVVAWALIRIVQFVSRLWRGADAAGSARIGVVEAA
Ga0318567_1033088823300031821SoilMITLIVTIVVVWTVIRIVQFVTRLWRAADAAGAARTGVAAAA
Ga0318499_1005215343300031832SoilRRRGMITLIVTIVVVWTVIRIVQFVTRLWRAADAAGAARIGVAAAA
Ga0318499_1037539523300031832SoilRGLITLIVIIVVAWALIRIVQFVSRLWRGADAAGSARIGVVEAA
Ga0318512_1035326013300031846SoilIVVAWALIRIVQFVTRLWRGADAAGSARIGVVEAA
Ga0318495_1038887613300031860SoilTLIVIIVVAWALIRIVQFVSRLWRGADAAGSARIGVVEAA
Ga0306919_1117142123300031879SoilMITLIVIIVVAWTLIRIVQLVTRLWRGADAAGSARIEAVGAT
Ga0306919_1152364723300031879SoilMITLVVIIVVVWTLVRIVQFLTRLWRGADAAGPARIGVDAAA
Ga0318536_1047927223300031893SoilLITLIVIIVVAWALIRIVQFVSRLWRGADAAGSARIGVVEAA
Ga0318551_1018107713300031896SoilVILVVAWALIRIVQFVTRLWRGADAAGSARIGVVEAA
Ga0318551_1053250313300031896SoilMITLIVIIVVAWTLIRIVQLVTRLWRGADAAGSARIE
Ga0306923_1067056413300031910SoilLIVIIVVVWTLMRLVRFVTQLWRDTDAKGGARIGVAAAACG
Ga0306923_1187586113300031910SoilMITLIVIIVVVWTLVRIVQFVTRLWRSADAASPASIGVDAAA
Ga0306921_1026646243300031912SoilIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAAA
Ga0310910_1013923713300031946SoilTTRRRYGMIALFVIIVVVWTLIRIVQFVRRLWRPVDAAGPPRIGVVAAA
Ga0310910_1099904113300031946SoilVVWTLMRLVRFVTQLWRDTDAKGGARIGVAAAACG
Ga0306926_1221332123300031954SoilMITSIVTSVVVWTLIRIVQFVSQLWTLANAARSPRISAIATA
Ga0318530_1037196323300031959SoilRGLITLIVIIVVVWTLMRLVRFVTQLWRDTDAKGGARIGVAAAACG
Ga0318530_1048913223300031959SoilCWTSHLLGANRRRWMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAAA
Ga0306922_1009228913300032001SoilIVIIVVAWALIRIVQFVTRLWRGADAAGSPRIGVVETA
Ga0306922_1037314813300032001SoilMITLIVTIVVVWTVIRIVQFVTRLWRAADAAGAARIG
Ga0318569_1033311923300032010SoilMITLIVITVVVWTIIRIMQFASRLWRPANGKISTRIGSLAAA
Ga0310911_1028301713300032035SoilITLIVIIVFVWTLIRLVQFVTQLWRGTDAKGGARIGVAAAACG
Ga0318559_1014127443300032039SoilSHLLGANRRRWMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAAA
Ga0318559_1022844523300032039SoilMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGSPRIG
Ga0318558_1032855913300032044SoilLITLIVIIVVAWALIRIVQFVSRLWRGADAAGSAR
Ga0318505_1010537523300032060SoilLITLIVIIVVAWALIRIVQFVSRLWRGADAAGSARIGV
Ga0318504_1004242613300032063SoilLIVTIVVIWTLVRIVQFVTGLWRSADAAGSPRIGVAQAA
Ga0318504_1021352613300032063SoilGRRRGMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPRIGGAAAA
Ga0318510_1011442813300032064SoilLGANRRRGMITLIVTIVVVWAVIRIVQFLTKLWSGADAAGSPRIGVVAAA
Ga0318510_1024210913300032064SoilMIALFVIIVVVWTLIRIVQFVRRLWRPVDAAGPPRIG
Ga0318514_1019951413300032066SoilMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGSPR
Ga0306924_1035887013300032076SoilMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPRIGGAAA
Ga0306924_1230698013300032076SoilMITLFVIIVVVWTLIRVVQFVSRLWRPVDAAGPPRIGVVAA
Ga0306924_1243507513300032076SoilRMITLLVIIDVVWTLVRIVQFLAQLWRGADGAHPARIGLDAAA
Ga0306920_10081628923300032261SoilMITLIVIIVVAWALIRIVQFVTRLWRGADAAGSPRIGVVETA
Ga0306920_10218550023300032261SoilMITLAVIIVVIWTLVRIVQFVTRLWRGTDAAGPARTGVDAAA
Ga0306920_10417759423300032261SoilMITLIVTIVVVWTVIRIVQFVTRLWSGADAAGAPRIGGVAAA
Ga0310914_1150923523300033289SoilDRLLKPHRRRGMITLIVITVVVWTIIRIVQFVSRLWRPANGKISTRSGVLAAAQG
Ga0318519_1017227713300033290SoilLSAGRRRGMITLIVTIVVVWIVIRMVQFVTRLWSGADAAGSPRIGGAAAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.