


| Basic Information | |
|---|---|
| Family ID | F031070 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 47 residues |
| Representative Sequence | FRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 22.10 % |
| % of genes near scaffold ends (potentially truncated) | 55.19 % |
| % of genes from short scaffolds (< 2000 bps) | 78.14 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.984 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (18.579 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.158 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (54.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF04965 | GPW_gp25 | 6.56 |
| PF13392 | HNH_3 | 1.64 |
| PF01541 | GIY-YIG | 1.09 |
| PF11649 | T4_neck-protein | 1.09 |
| PF07460 | NUMOD3 | 0.55 |
| PF14240 | YHYH | 0.55 |
| PF02086 | MethyltransfD12 | 0.55 |
| PF03420 | Peptidase_S77 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.55 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.02 % |
| Unclassified | root | N/A | 40.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10019193 | All Organisms → Viruses → Predicted Viral | 2534 | Open in IMG/M |
| 3300000756|JGI12421J11937_10079236 | All Organisms → Viruses | 956 | Open in IMG/M |
| 3300002133|S2T7BSa_1018061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6037 | Open in IMG/M |
| 3300002835|B570J40625_100025639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 9605 | Open in IMG/M |
| 3300002835|B570J40625_100745658 | Not Available | 869 | Open in IMG/M |
| 3300003277|JGI25908J49247_10092447 | Not Available | 735 | Open in IMG/M |
| 3300003393|JGI25909J50240_1021999 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
| 3300003491|JGI25924J51412_1013360 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300005427|Ga0066851_10102155 | Not Available | 931 | Open in IMG/M |
| 3300005428|Ga0066863_10357735 | Not Available | 502 | Open in IMG/M |
| 3300005521|Ga0066862_10166897 | Not Available | 735 | Open in IMG/M |
| 3300005582|Ga0049080_10038112 | All Organisms → Viruses → Predicted Viral | 1671 | Open in IMG/M |
| 3300005584|Ga0049082_10248870 | Not Available | 600 | Open in IMG/M |
| 3300005584|Ga0049082_10269550 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 572 | Open in IMG/M |
| 3300005739|Ga0076948_1079228 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300005955|Ga0073922_1008714 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
| 3300006030|Ga0075470_10091349 | Not Available | 915 | Open in IMG/M |
| 3300006040|Ga0073914_10104139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 560 | Open in IMG/M |
| 3300006641|Ga0075471_10605140 | Not Available | 538 | Open in IMG/M |
| 3300006810|Ga0070754_10121492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1272 | Open in IMG/M |
| 3300006874|Ga0075475_10378885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 572 | Open in IMG/M |
| 3300006916|Ga0070750_10139388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1103 | Open in IMG/M |
| 3300007214|Ga0103959_1166331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 2641 | Open in IMG/M |
| 3300007344|Ga0070745_1030778 | Not Available | 2307 | Open in IMG/M |
| 3300007344|Ga0070745_1266446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 616 | Open in IMG/M |
| 3300007538|Ga0099851_1162152 | Not Available | 828 | Open in IMG/M |
| 3300007541|Ga0099848_1053101 | Not Available | 1628 | Open in IMG/M |
| 3300007541|Ga0099848_1067161 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300007544|Ga0102861_1085146 | Not Available | 837 | Open in IMG/M |
| 3300007708|Ga0102859_1041878 | All Organisms → Viruses → Predicted Viral | 1253 | Open in IMG/M |
| 3300007960|Ga0099850_1022185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 2811 | Open in IMG/M |
| 3300007960|Ga0099850_1030941 | All Organisms → Viruses → Predicted Viral | 2337 | Open in IMG/M |
| 3300007960|Ga0099850_1074618 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300007960|Ga0099850_1155043 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 920 | Open in IMG/M |
| 3300007960|Ga0099850_1298342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 612 | Open in IMG/M |
| 3300007960|Ga0099850_1391464 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 516 | Open in IMG/M |
| 3300008012|Ga0075480_10055221 | All Organisms → Viruses → Predicted Viral | 2315 | Open in IMG/M |
| 3300008262|Ga0114337_1002134 | All Organisms → Viruses | 19248 | Open in IMG/M |
| 3300008996|Ga0102831_1049427 | All Organisms → Viruses → Predicted Viral | 1411 | Open in IMG/M |
| 3300008999|Ga0102816_1283576 | Not Available | 525 | Open in IMG/M |
| 3300009000|Ga0102960_1087817 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300009001|Ga0102963_1342800 | Not Available | 587 | Open in IMG/M |
| 3300009009|Ga0105105_10815784 | Not Available | 565 | Open in IMG/M |
| 3300009039|Ga0105152_10173884 | Not Available | 884 | Open in IMG/M |
| 3300009124|Ga0118687_10107335 | Not Available | 972 | Open in IMG/M |
| 3300009149|Ga0114918_10610855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 576 | Open in IMG/M |
| 3300009161|Ga0114966_10030911 | All Organisms → Viruses → Predicted Viral | 3944 | Open in IMG/M |
| 3300009466|Ga0126448_1001349 | Not Available | 7113 | Open in IMG/M |
| 3300009470|Ga0126447_1013593 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300009470|Ga0126447_1038566 | Not Available | 1187 | Open in IMG/M |
| 3300009484|Ga0127411_1005579 | All Organisms → Viruses → Predicted Viral | 3836 | Open in IMG/M |
| 3300009492|Ga0127412_10041729 | Not Available | 554 | Open in IMG/M |
| 3300010149|Ga0098049_1019285 | Not Available | 2257 | Open in IMG/M |
| 3300010296|Ga0129348_1108614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 974 | Open in IMG/M |
| 3300010297|Ga0129345_1133718 | Not Available | 902 | Open in IMG/M |
| 3300010297|Ga0129345_1156750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 821 | Open in IMG/M |
| 3300010297|Ga0129345_1236955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 640 | Open in IMG/M |
| 3300010299|Ga0129342_1062885 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300010299|Ga0129342_1222678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 664 | Open in IMG/M |
| 3300010300|Ga0129351_1296645 | Not Available | 612 | Open in IMG/M |
| 3300010354|Ga0129333_10000179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 44060 | Open in IMG/M |
| 3300010354|Ga0129333_10064424 | All Organisms → Viruses | 3412 | Open in IMG/M |
| 3300010354|Ga0129333_10096515 | All Organisms → Viruses → Predicted Viral | 2732 | Open in IMG/M |
| 3300010354|Ga0129333_10270790 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
| 3300010354|Ga0129333_10523312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Sedonavirus → unclassified Sedonavirus → Synechococcus phage S-H9-1 | 1037 | Open in IMG/M |
| 3300010354|Ga0129333_10842232 | Not Available | 779 | Open in IMG/M |
| 3300010354|Ga0129333_11163922 | Not Available | 642 | Open in IMG/M |
| 3300010368|Ga0129324_10353148 | Not Available | 572 | Open in IMG/M |
| 3300010368|Ga0129324_10370400 | Not Available | 556 | Open in IMG/M |
| 3300011011|Ga0139556_1023497 | Not Available | 897 | Open in IMG/M |
| 3300012013|Ga0153805_1000157 | Not Available | 14995 | Open in IMG/M |
| 3300013086|Ga0163202_1032749 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300013089|Ga0163203_1146450 | Not Available | 713 | Open in IMG/M |
| 3300013372|Ga0177922_10288771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 585 | Open in IMG/M |
| 3300017722|Ga0181347_1142852 | Not Available | 657 | Open in IMG/M |
| 3300017722|Ga0181347_1142910 | Not Available | 657 | Open in IMG/M |
| 3300017736|Ga0181365_1025994 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
| 3300017761|Ga0181356_1197807 | Not Available | 597 | Open in IMG/M |
| 3300017777|Ga0181357_1139345 | Not Available | 900 | Open in IMG/M |
| 3300017778|Ga0181349_1136453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 892 | Open in IMG/M |
| 3300017785|Ga0181355_1246339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 687 | Open in IMG/M |
| 3300017952|Ga0181583_10435514 | Not Available | 811 | Open in IMG/M |
| 3300017952|Ga0181583_10447034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 797 | Open in IMG/M |
| 3300017967|Ga0181590_10198865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1507 | Open in IMG/M |
| 3300018416|Ga0181553_10118586 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300018420|Ga0181563_10465472 | Not Available | 714 | Open in IMG/M |
| 3300018421|Ga0181592_10314752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1128 | Open in IMG/M |
| 3300018423|Ga0181593_10227254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1457 | Open in IMG/M |
| 3300018775|Ga0188848_1020952 | Not Available | 698 | Open in IMG/M |
| 3300018775|Ga0188848_1028347 | Not Available | 591 | Open in IMG/M |
| 3300019784|Ga0181359_1022025 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
| 3300020074|Ga0194113_10563776 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 808 | Open in IMG/M |
| 3300020083|Ga0194111_10401783 | Not Available | 907 | Open in IMG/M |
| 3300020109|Ga0194112_10036994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 5111 | Open in IMG/M |
| 3300020196|Ga0194124_10057498 | All Organisms → Viruses → Predicted Viral | 2390 | Open in IMG/M |
| 3300020204|Ga0194116_10014383 | Not Available | 7211 | Open in IMG/M |
| 3300020214|Ga0194132_10332675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 795 | Open in IMG/M |
| 3300020222|Ga0194125_10695111 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 593 | Open in IMG/M |
| 3300020325|Ga0211507_1048900 | Not Available | 838 | Open in IMG/M |
| 3300020414|Ga0211523_10043134 | All Organisms → Viruses → Predicted Viral | 1952 | Open in IMG/M |
| 3300020414|Ga0211523_10382440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 571 | Open in IMG/M |
| 3300021092|Ga0194122_10086216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1771 | Open in IMG/M |
| 3300021376|Ga0194130_10008667 | Not Available | 10738 | Open in IMG/M |
| 3300021425|Ga0213866_10005844 | All Organisms → Viruses | 7932 | Open in IMG/M |
| 3300021425|Ga0213866_10084261 | All Organisms → Viruses → Predicted Viral | 1751 | Open in IMG/M |
| 3300021425|Ga0213866_10372923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 701 | Open in IMG/M |
| 3300021960|Ga0222715_10028391 | All Organisms → Viruses → Predicted Viral | 4059 | Open in IMG/M |
| 3300021960|Ga0222715_10375508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 784 | Open in IMG/M |
| 3300021961|Ga0222714_10130516 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
| 3300021961|Ga0222714_10207555 | Not Available | 1126 | Open in IMG/M |
| 3300021961|Ga0222714_10627018 | Not Available | 533 | Open in IMG/M |
| 3300021962|Ga0222713_10175088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 1457 | Open in IMG/M |
| 3300021963|Ga0222712_10786356 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 526 | Open in IMG/M |
| 3300022187|Ga0196899_1012043 | All Organisms → Viruses → Predicted Viral | 3380 | Open in IMG/M |
| 3300022198|Ga0196905_1125129 | Not Available | 672 | Open in IMG/M |
| 3300022198|Ga0196905_1149562 | Not Available | 601 | Open in IMG/M |
| 3300022200|Ga0196901_1274574 | Not Available | 515 | Open in IMG/M |
| 3300022925|Ga0255773_10122141 | All Organisms → Viruses → Predicted Viral | 1321 | Open in IMG/M |
| 3300022937|Ga0255770_10369522 | Not Available | 635 | Open in IMG/M |
| 3300023172|Ga0255766_10202819 | All Organisms → Viruses | 1081 | Open in IMG/M |
| 3300023180|Ga0255768_10239928 | All Organisms → Viruses | 1059 | Open in IMG/M |
| 3300024239|Ga0247724_1006713 | Not Available | 1750 | Open in IMG/M |
| 3300024262|Ga0210003_1206874 | Not Available | 800 | Open in IMG/M |
| 3300024351|Ga0255141_1000022 | All Organisms → Viruses | 77080 | Open in IMG/M |
| 3300024561|Ga0255288_1000001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 44674 | Open in IMG/M |
| 3300025072|Ga0208920_1041853 | Not Available | 931 | Open in IMG/M |
| 3300025082|Ga0208156_1042247 | Not Available | 941 | Open in IMG/M |
| 3300025096|Ga0208011_1103141 | Not Available | 604 | Open in IMG/M |
| 3300025151|Ga0209645_1226831 | Not Available | 535 | Open in IMG/M |
| 3300025585|Ga0208546_1001429 | Not Available | 7452 | Open in IMG/M |
| 3300025646|Ga0208161_1000199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 34275 | Open in IMG/M |
| 3300025646|Ga0208161_1128960 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 658 | Open in IMG/M |
| 3300025671|Ga0208898_1107417 | Not Available | 834 | Open in IMG/M |
| 3300025671|Ga0208898_1124209 | All Organisms → Viruses | 739 | Open in IMG/M |
| 3300025687|Ga0208019_1000593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 19597 | Open in IMG/M |
| 3300025687|Ga0208019_1000960 | All Organisms → Viruses | 15724 | Open in IMG/M |
| 3300025687|Ga0208019_1100743 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 887 | Open in IMG/M |
| 3300025732|Ga0208784_1000032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 60754 | Open in IMG/M |
| 3300025769|Ga0208767_1279453 | Not Available | 503 | Open in IMG/M |
| 3300025840|Ga0208917_1296155 | Not Available | 503 | Open in IMG/M |
| 3300025843|Ga0209182_10183660 | Not Available | 586 | Open in IMG/M |
| 3300026182|Ga0208275_1072501 | Not Available | 669 | Open in IMG/M |
| 3300026187|Ga0209929_1112661 | Not Available | 695 | Open in IMG/M |
| 3300026209|Ga0207989_1046447 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
| 3300026270|Ga0207993_1058450 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300027320|Ga0208923_1018652 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300027393|Ga0209867_1079657 | Not Available | 507 | Open in IMG/M |
| 3300027581|Ga0209651_1138094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 667 | Open in IMG/M |
| 3300027656|Ga0209357_1035071 | All Organisms → Viruses → Predicted Viral | 1656 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1081346 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
| 3300027756|Ga0209444_10055928 | All Organisms → Viruses → Predicted Viral | 1758 | Open in IMG/M |
| 3300027772|Ga0209768_10208492 | Not Available | 873 | Open in IMG/M |
| 3300027772|Ga0209768_10368624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 581 | Open in IMG/M |
| 3300027917|Ga0209536_103361082 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 505 | Open in IMG/M |
| 3300028156|Ga0268281_1058465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 940 | Open in IMG/M |
| 3300028169|Ga0268279_1068748 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300028191|Ga0265595_1129611 | Not Available | 794 | Open in IMG/M |
| 3300028191|Ga0265595_1147664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 727 | Open in IMG/M |
| 3300028298|Ga0268280_1066815 | Not Available | 1009 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1019306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5660 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1020254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 5420 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1099149 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1109122 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
| 3300029318|Ga0185543_1093237 | Not Available | 589 | Open in IMG/M |
| 3300029933|Ga0119945_1020799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 784 | Open in IMG/M |
| 3300031539|Ga0307380_10455776 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300031539|Ga0307380_11450027 | Not Available | 514 | Open in IMG/M |
| 3300031565|Ga0307379_11207596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 626 | Open in IMG/M |
| 3300031566|Ga0307378_10930082 | Not Available | 716 | Open in IMG/M |
| 3300031746|Ga0315293_11275132 | Not Available | 506 | Open in IMG/M |
| 3300031952|Ga0315294_11134617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 640 | Open in IMG/M |
| 3300031997|Ga0315278_10707542 | Not Available | 1024 | Open in IMG/M |
| 3300032053|Ga0315284_10720207 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300032136|Ga0316201_10137982 | Not Available | 2125 | Open in IMG/M |
| 3300032143|Ga0315292_10427378 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300033994|Ga0334996_0048780 | All Organisms → Viruses → Predicted Viral | 2637 | Open in IMG/M |
| 3300034061|Ga0334987_0770042 | Not Available | 541 | Open in IMG/M |
| 3300034064|Ga0335001_0457014 | All Organisms → Viruses | 681 | Open in IMG/M |
| 3300034071|Ga0335028_0335682 | Not Available | 884 | Open in IMG/M |
| 3300034103|Ga0335030_0032187 | All Organisms → Viruses → Predicted Viral | 3996 | Open in IMG/M |
| 3300034418|Ga0348337_091862 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.84% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 8.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.56% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.01% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.46% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.37% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.73% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.73% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.19% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.64% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.64% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.64% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.64% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.09% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.09% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.09% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.09% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.55% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.55% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.55% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.55% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.55% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.55% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.55% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.55% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.55% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.55% |
| Methane Seep | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep | 0.55% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.55% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002133 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - S2T7BSa (116f) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005428 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006040 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_30-Apr-14 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009484 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 12m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009492 | Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsf | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013086 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m | Environmental | Open in IMG/M |
| 3300013089 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020325 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX556073-ERR598966) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026182 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026209 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028156 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_50m | Environmental | Open in IMG/M |
| 3300028169 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m | Environmental | Open in IMG/M |
| 3300028191 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_50m | Environmental | Open in IMG/M |
| 3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100191931 | 3300000756 | Freshwater And Sediment | WNFWRVILAGWIIKYPKIVWIPIVFSVILIYNAIVK* |
| JGI12421J11937_100792362 | 3300000756 | Freshwater And Sediment | MISPRNPRRYNRRRPYWNFYRVVLAGWVIRYPKIVWVPIGFLIVLIYNAVVN* |
| S2T7BSa_10180614 | 3300002133 | Marine | MRIHKTPFRTRRAPYWNFWRVVLAGWIIRYPKIVWVPIGFLIVLIYNAVVN* |
| B570J40625_1000256399 | 3300002835 | Freshwater | PSRVPYWNFWRAVLAGWLIRYPKTMGRIVLVPLGFLIVLIYNAVVN* |
| B570J40625_1007456582 | 3300002835 | Freshwater | MIALRNRRRTPYWNFWRVVLAGWTIRYPKTMGKIVLLPLGFLIVLIYNAIVR* |
| JGI25908J49247_100924473 | 3300003277 | Freshwater Lake | PYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK* |
| JGI25909J50240_10219993 | 3300003393 | Freshwater Lake | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK* |
| JGI25924J51412_10133601 | 3300003491 | Freshwater Lake | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYN |
| Ga0066851_101021552 | 3300005427 | Marine | MKKRPYWNFWKVVLAGWLIRYPKTMGKIVLIPLGICIVLIYNACVS* |
| Ga0066863_103577351 | 3300005428 | Marine | NFWKVVLAGWLIRYPKTMGKIVLIPLGICIVLIYNAWAS* |
| Ga0066862_101668971 | 3300005521 | Marine | MKKRPYWNFWKVVLAGWLIRYPKTMGKIVLIPLGICIVLIYNAWAS* |
| Ga0049080_100381124 | 3300005582 | Freshwater Lentic | MIHRRSIYWNFWRVVLAGWTIRYPKTMAKVVLIPLSFLIVLIYNVVVN* |
| Ga0049082_102488702 | 3300005584 | Freshwater Lentic | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTFFVPLGFLLVLIYNAVVK* |
| Ga0049082_102695502 | 3300005584 | Freshwater Lentic | MRTYKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK* |
| Ga0076948_10792284 | 3300005739 | Lake Water | WKVILAGWIIRYPKTMFRVIGVPLGILIVFIYNALTK* |
| Ga0073922_10087142 | 3300005955 | Sand | MRTHKTNFRIRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK* |
| Ga0075470_100913493 | 3300006030 | Aqueous | MKESKRRRREPYWNFWKVILAGWIIRYPKQMGRIIFIPLGFLIILIYNAIVK* |
| Ga0073914_101041391 | 3300006040 | Sand | RSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK* |
| Ga0075471_106051401 | 3300006641 | Aqueous | MRPTKGRRTPYWNFYRAVLAGWLIRYPKQTFRFIGVPLGILIVLIYNAVTK* |
| Ga0070754_101214923 | 3300006810 | Aqueous | MKNRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFFIVLIYNAIMN* |
| Ga0075475_103788851 | 3300006874 | Aqueous | SPYWNFWRVVFAGWMIRYPRTMAKVVFLPLGILIVLIYNAVTN* |
| Ga0070750_101393883 | 3300006916 | Aqueous | MRKSPYWNFWRVVFAGWMIRYPRTMAKVVFLPLGILIVVIYNAVTN* |
| Ga0103959_11663313 | 3300007214 | Freshwater Lake | MPKSPYWNFWKVILAGWIIRYPKTMFRVIGVPLGILIAFIYNALTK* |
| Ga0070745_10307781 | 3300007344 | Aqueous | MKNRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFFIVL |
| Ga0070745_12664461 | 3300007344 | Aqueous | PDMKNRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFFIVLIYNAIMN* |
| Ga0099851_11621521 | 3300007538 | Aqueous | MTALKNRHHRNPYWNFWRVILAGWIIRYPKTMGRIILFPLGFL |
| Ga0099848_10531015 | 3300007541 | Aqueous | MKKSVPYWNFWRVILAGWIIRYPKTMGRIAFAALGFLICLIYNARVN* |
| Ga0099848_10671613 | 3300007541 | Aqueous | MRAIKNPHRRPYWNFWKVVLAGWAIRYPKTLGRIIFLPLGLLIAMIYNAIVS* |
| Ga0102861_10851461 | 3300007544 | Estuarine | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPRGPPWGWT |
| Ga0102859_10418783 | 3300007708 | Estuarine | MRTHKTNFRRRSPYWNFFRVVLAGWIIRYPKQTFFIPLGFLLVLIYNAVVK* |
| Ga0099850_10221858 | 3300007960 | Aqueous | FWRVILAGWIIRYPKTMSRVVLIPLGFLIILIYNAIVN* |
| Ga0099850_10309411 | 3300007960 | Aqueous | RGPYWNFWKVILAGWIIRYPKTMSRVILLPLGFLIVLIYNACKN* |
| Ga0099850_10746181 | 3300007960 | Aqueous | MMMYRNPRRRHYWNFYRVILAGWIIRYPKTMGKIILLP |
| Ga0099850_11550432 | 3300007960 | Aqueous | MRAIKNPHRRPYWNFWKVVLAGWAIRYPKTMGRIIFLPLGLLIAMIYNAIVS* |
| Ga0099850_12983423 | 3300007960 | Aqueous | YWNFYRVILAGWIIRYPKTMGRIILIPLGFLIVLIYNAIVN* |
| Ga0099850_13914641 | 3300007960 | Aqueous | QNFSGSMISLKTPRRGPYWNFWRVVLAGWAIRYPKTMGRIVLIPLGFLIVLIYNAVVN* |
| Ga0075480_100552215 | 3300008012 | Aqueous | MKKMPVRSPYWNFWRVVFAGWLIKYPKTMGKIALTTLGILIVLIYNACSR* |
| Ga0114337_100213412 | 3300008262 | Freshwater, Plankton | MKKSPYWNFWKVVLAGWLIRYPKVVLLPLGFILVLIYKAVVN* |
| Ga0102831_10494273 | 3300008996 | Estuarine | MYHSHIKILPEMRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVN* |
| Ga0102816_12835761 | 3300008999 | Estuarine | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTFFGPLGFLLVLIYNAVVK* |
| Ga0102960_10878172 | 3300009000 | Pond Water | APYWNFWKVILAGWIIRYPKTMSRVVLIPLGFLIVLIYNAVVN* |
| Ga0102963_13428002 | 3300009001 | Pond Water | MITLRNRRRGPYWNFWRVILAGWIIRYPKSMSRVILIPLGILISLIY |
| Ga0105105_108157841 | 3300009009 | Freshwater Sediment | FWRVVLAGWVIRYPKVVFLPIGFLLAMLYNVVSSR* |
| Ga0105152_101738843 | 3300009039 | Lake Sediment | MRSHKTPFRKKTPYWNFYRVVLAGWVIRYPKIVWGPIVFLVILLYNAIVR |
| Ga0118687_101073351 | 3300009124 | Sediment | MRKSPYWNFWRVVFAGWLIRYPKTMGKVVLIPLGILIVVIY |
| Ga0114918_106108551 | 3300009149 | Deep Subsurface | PFRKRRSPYWNFWRVVIAGWVIRYPKIVWVPIVLLVILIYNAIVR* |
| Ga0114966_100309114 | 3300009161 | Freshwater Lake | MRTHKTNFRRRSPYWNFFRVVVAGWMIRYPKQTVFIPLGFLLVLIYNAVVK* |
| Ga0126448_10013499 | 3300009466 | Meromictic Pond | MKKSAPYWNFWRVILAGWIIKYPKTVSKIIFIPLGILISLIYNAIVK* |
| Ga0126447_10135931 | 3300009470 | Meromictic Pond | MISPRYPRRYNRKRPYWNFYRVVLAGWIIRYPKVVFLPIGFLIVLI |
| Ga0126447_10385663 | 3300009470 | Meromictic Pond | MKKSAPYWNFWRVILAGWIIKYPKTVSKIIFIPLGILISL |
| Ga0127411_10055793 | 3300009484 | Meromictic Pond | MISPRYPRRYNRKRPYWNFYRVVLAGWIIRYPKVVFLPIGFLIVLIYNAIVN* |
| Ga0127412_100417291 | 3300009492 | Methane Seep | MTALKNRHHRNPYWNFWRVILAGWIIRYPKTMGRIILFPLGFLIVLIY |
| Ga0098049_10192857 | 3300010149 | Marine | KVVLAGWLIRYPKTMGKIVLIPLGICIVLIYNAWVS* |
| Ga0129348_11086141 | 3300010296 | Freshwater To Marine Saline Gradient | GSMMTYRNPRRRPYWNFYRVILAGWIIRYPKTMGKIILLPLGFLIVLIYNAMTN* |
| Ga0129345_11337182 | 3300010297 | Freshwater To Marine Saline Gradient | MMTYRNPRRRPYWNFYRVILAGWIIRYPKTMGKIILLPLGFLIVLIYNAM |
| Ga0129345_11567501 | 3300010297 | Freshwater To Marine Saline Gradient | RVPYWNFWRAVLAGWLIRYPKTMGRIVLVPLGFLIAMIYNAVVN* |
| Ga0129345_12369551 | 3300010297 | Freshwater To Marine Saline Gradient | KEEKMRRSAPYWNFWRVILAGWIIRYPKTMSRVVLVPLGFLIILIYNASKN* |
| Ga0129342_10628851 | 3300010299 | Freshwater To Marine Saline Gradient | MMMYRNPRRRHYWNFYRVILAGWIIRYPKTMGKIILLPLGVLIVL |
| Ga0129342_12226781 | 3300010299 | Freshwater To Marine Saline Gradient | KSTSKYHNQKNFSGTMRAIKNPHRRPYWNFWKVVLAGWAIRYPKTLGRIIFLPLGLLIAMIYNAIVS* |
| Ga0129351_12966451 | 3300010300 | Freshwater To Marine Saline Gradient | MISLKNPRRGPYWNFWRVVLAGWSIRYPKTMGRIVLIPLGF |
| Ga0129333_100001796 | 3300010354 | Freshwater To Marine Saline Gradient | MKASNKRRRKPYWNFWRVILAGWIIRYPKQMGRIVFIPLGFLIILIYNAIVK* |
| Ga0129333_100644242 | 3300010354 | Freshwater To Marine Saline Gradient | MSPRRPRRRTPYWNFWRVVLAGWWIRYPKTMFMAVFTPIGLLAALIYNAVAN* |
| Ga0129333_100965154 | 3300010354 | Freshwater To Marine Saline Gradient | MRYKNSKSPYWNFWRVILAGWIIRYPKTMGRVVLLPLGFLIVLIYNAATK* |
| Ga0129333_102707903 | 3300010354 | Freshwater To Marine Saline Gradient | MISLKNPRRTPYWNFWRVVLAGWAIRYPKTMGRIVFVPLGFLIVMIYNAVTR* |
| Ga0129333_105233121 | 3300010354 | Freshwater To Marine Saline Gradient | MRAHQNPRQKPYWNFWKVILAGWIIRYPKSMGRIVLIPLGFLIVLIYN |
| Ga0129333_108422321 | 3300010354 | Freshwater To Marine Saline Gradient | KSAPYWNFWRVILAGWIIRYPKTMGRIAFTTLGILIALIYNAIVK* |
| Ga0129333_111639221 | 3300010354 | Freshwater To Marine Saline Gradient | LRRSPYWNFWRVILAGWIIRYPKSMGRIILIPLGFLIVLIYNAV |
| Ga0129324_103531482 | 3300010368 | Freshwater To Marine Saline Gradient | MRKSAPYWNFWRVILAGWIIRYPKTMSRVVLIPLGFLIILIYNAIVN* |
| Ga0129324_103704002 | 3300010368 | Freshwater To Marine Saline Gradient | MRAIKNRHQRGPYWNFWRVILAGWIIRYPKTMSRVVLIPLGFLIILIYNAIV |
| Ga0139556_10234972 | 3300011011 | Freshwater | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTFFIPLGFLLVLIYNAVVK* |
| Ga0153805_10001579 | 3300012013 | Surface Ice | MRSHKTPFRKRIPYWNFWRVILAGWIIKYPKIVWIPIVFSVILIYNAIVK* |
| Ga0163202_10327493 | 3300013086 | Freshwater | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVV |
| Ga0163203_11464503 | 3300013089 | Freshwater | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFI |
| Ga0177922_102887713 | 3300013372 | Freshwater | FFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK* |
| Ga0181347_11428522 | 3300017722 | Freshwater Lake | MRTHKTNFIKRLPYWNFFRVVLAGWIIRYPKQTFFIPLGFLLVLIYNAVVK |
| Ga0181347_11429102 | 3300017722 | Freshwater Lake | MTTHNTNSRRRSPHWNFFRVVLAGWMIRYPKQTFFIPVG |
| Ga0181365_10259945 | 3300017736 | Freshwater Lake | NFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFCIVLIYNAVTR |
| Ga0181356_11978071 | 3300017761 | Freshwater Lake | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGF |
| Ga0181357_11393451 | 3300017777 | Freshwater Lake | MRTHKTNFRRRSPYWNFFRVVLAGWIIRYPKQTFFIPLGF |
| Ga0181349_11364532 | 3300017778 | Freshwater Lake | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTFFIPLGFLLVLIYNAVVK |
| Ga0181355_12463393 | 3300017785 | Freshwater Lake | FRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| Ga0181583_104355143 | 3300017952 | Salt Marsh | MKKRPYWNFWKVVLAGWCIRYPKTMSKVVLVPLGFF |
| Ga0181583_104470341 | 3300017952 | Salt Marsh | KKFPDMKKRPYWNFWKVVLAGWMIRYPKTMSKVVLVPLGFFIVLIYNAIMN |
| Ga0181590_101988652 | 3300017967 | Salt Marsh | MKKRPYWNFWKVVLAGWMIRYPKTMSKVVLVPLGFFIVLIYNAIMN |
| Ga0181553_101185863 | 3300018416 | Salt Marsh | MKKRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFFIVLIYNALT |
| Ga0181563_104654721 | 3300018420 | Salt Marsh | MKKVSVRRTPYWNFWKVVFAGWLIRYPKTMSKVVLIPLGFFIVLVYNALVN |
| Ga0181592_103147522 | 3300018421 | Salt Marsh | MKNRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFFIVLIYNAIMN |
| Ga0181593_102272543 | 3300018423 | Salt Marsh | MKKRPYWNFWKVVLAGWCIRYPKTMSKVVLVPLGFFIVLIYNAIMN |
| Ga0188848_10209521 | 3300018775 | Freshwater Lake | MRSHKTPFRKRTPYWNFWRVVLAGWIIRYPKIVWVPIGFLIVLIYNAVVN |
| Ga0188848_10283471 | 3300018775 | Freshwater Lake | MRSHKTPFKKRRSPYWNFYRVVLAGWVIRYPKIVWVPIVFLVILIYN |
| Ga0181359_10220251 | 3300019784 | Freshwater Lake | MYLSYIKILPEMRTHKTYFRKRSPYWNFFRVVLAGWMIRYPKQTFFIPLGFLLVLIYNAVVK |
| Ga0194113_105637762 | 3300020074 | Freshwater Lake | MSTLKNRHRTPYWNFWRVVLAGWAIKYPKTMGGIILLPLGILIVLIYNAIIH |
| Ga0194111_104017833 | 3300020083 | Freshwater Lake | MSILKNRHRTPYWNFWRVVLAGWAIKYPKTMGGIILLPLGILIVLIYNAIIH |
| Ga0194112_100369949 | 3300020109 | Freshwater Lake | ISISKNFSGSMSTLRNRRQTPYWNFWRVVLAGWTIRYPKTMGKIILMPLGFLIVLIYNAIVR |
| Ga0194124_100574983 | 3300020196 | Freshwater Lake | MISLKNPHRRDPYWNFWKVVFAGWLIRYPKTMGRIILVPLGFLIVLIYNAVVN |
| Ga0194116_1001438315 | 3300020204 | Freshwater Lake | MSTYKVRKRTSYWNFWKVVLAGWMIRYPRPFFVAFGFLIVLIYNAVVN |
| Ga0194132_103326753 | 3300020214 | Freshwater Lake | RTPYWNFWRVVLAGWAIKYPKTMGGIILLPLGILIVLIYNAIIH |
| Ga0194125_106951113 | 3300020222 | Freshwater Lake | RRDPYWNFWKVVFAGWLIRYPKTMGRIILVPLGFLIVLIYNAVVN |
| Ga0211507_10489002 | 3300020325 | Marine | MKRTPYWNFWKVVLAGWFIRYPKTMSKVVLIPLGFFIV |
| Ga0211523_100431344 | 3300020414 | Marine | MKRTPYWNFWKVVLAGWFIRYPKTMSKVVLIPLGFFIVLVYNALT |
| Ga0211523_103824401 | 3300020414 | Marine | FWKVVLAGWFIRYPKTMSKVVLIPLGFFIVLIYNALTS |
| Ga0194122_100862165 | 3300021092 | Freshwater Lake | TFISILKNFSGSMSILKNRHRTPYWNFWRVVLAGWAIKYPKTMGGIILLPLGILIVLIYNAIIH |
| Ga0194130_1000866728 | 3300021376 | Freshwater Lake | MRKTQPYWNFWRVIFAGWMIRYPKQMGRILLFPLGILIVVIYNALVK |
| Ga0213866_100058445 | 3300021425 | Seawater | MKKSVPYWNFWRVILAGWIIRYPKTMGRIAFAALGFLICLIYNAIVN |
| Ga0213866_100842611 | 3300021425 | Seawater | MISPRYPRRYNRKRPYWNFYRVVLAGWIIRYPKVVFLPIGFLIVLIYNAIVN |
| Ga0213866_103729231 | 3300021425 | Seawater | HKNFPEVMMSKKTRRRDPYWNFWKVVFAGWLIRYPKTMGKIIFIPLGFLLVLIYNAVTN |
| Ga0222715_100283911 | 3300021960 | Estuarine Water | MNMKNRRRTPYWNFWKVVFAGWLIRYPKTMGKIIFLPLGFLLVLIYNAVVN |
| Ga0222715_103755083 | 3300021960 | Estuarine Water | MKAHRNPHRGPYWNFWRVVLAGWFIRYPKTMSRVILLPLGFLIALIYNALVN |
| Ga0222714_101305164 | 3300021961 | Estuarine Water | GPYWNFWRVILAGWIIRYPKILYIPLGFLVVSVYHAIVN |
| Ga0222714_102075552 | 3300021961 | Estuarine Water | MMSMKNRRRTPYWNFWKVVFAGWLIRYPKTMGKIIFLPLG |
| Ga0222714_106270181 | 3300021961 | Estuarine Water | MKAHRNPHRGPYWNFWRVILAGWIIRYPKTMGRMVLVPLGFLI |
| Ga0222713_101750883 | 3300021962 | Estuarine Water | WNFWKVVFAGWLIRYPKIVFVPLGVLFAFIYNALVK |
| Ga0222712_107010231 | 3300021963 | Estuarine Water | SPYWNFWRVVLAGWVIRNPRPIFVGLGFLIVLIYNAVTK |
| Ga0222712_107863563 | 3300021963 | Estuarine Water | FWRVILTGWIIRYPKTMSRVILLPLGFLIALIYNALVN |
| Ga0196899_10120439 | 3300022187 | Aqueous | MMTYRNPHRRPYWNFYRVILAGWIIRYPKTMGKIILLPLGFLIVLIYNAMTN |
| Ga0196905_11251292 | 3300022198 | Aqueous | MRRSTPYWNFWRVILAGWIIRYPKTMSRVVLIPLGFLIILIYNAI |
| Ga0196905_11495621 | 3300022198 | Aqueous | MTALRNRRRGPYWNFWKVILAGWIIRYPKTMSRVILLPLGFLIVLIYN |
| Ga0196901_12745742 | 3300022200 | Aqueous | MRAIKNPHRRPYWNFWKVVLAGWAIRYPKTMGRIIFLPLGLLIAMIYNAIVS |
| Ga0255773_101221411 | 3300022925 | Salt Marsh | MKKRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFFIVLVYNALT |
| Ga0255770_103695222 | 3300022937 | Salt Marsh | MMMYRNPRRRPYWNFYRVILAGWIIRYPKTMGKIILLPLGFL |
| Ga0255766_102028191 | 3300023172 | Salt Marsh | MKKRPYWNFWKVVLAGWMIRYPKTMSKVVLIPLGFFIVLIYNAIMN |
| Ga0255768_102399283 | 3300023180 | Salt Marsh | MKKRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFFIVLIYNAIMN |
| Ga0247724_10067132 | 3300024239 | Deep Subsurface Sediment | MKKSAPYWNFWRVILAGWIIKYPKTVSKIIFIPLGILISLIYNAIVK |
| Ga0210003_12068743 | 3300024262 | Deep Subsurface | YKDQKKFPPGMRIHKTPFRTRRSPYWNFWRVVLAGWIIRYPKIVWVPIGFLIVLIYNAVV |
| Ga0255141_100002240 | 3300024351 | Freshwater | MRRSTPYWNFWRVILAGWMIRYPKTMGKIVFLPVGFLIVLIYNAATN |
| Ga0255288_100000125 | 3300024561 | Freshwater | MRRRTPYWNFWRVILAGWIIRYPKTMGRIVLIPLGVFVVLIYNALVK |
| Ga0208920_10418533 | 3300025072 | Marine | WKVVLAGWLIRYPKTMGKIVLIPLGICIVLIYNACVS |
| Ga0208156_10422471 | 3300025082 | Marine | MKKRPYWNFWKVVLAGWLIRYPKTMGKIILIPLGICIVLIYNACVS |
| Ga0208011_11031412 | 3300025096 | Marine | MKKRPYWNFWKVVLAGWLIRYPKTMGKIVLIPLGICIVLIYNACVS |
| Ga0209645_12268312 | 3300025151 | Marine | MKRRPYWNFWKVVLAGWLIRYPKTISKVVLLPLGFLIVLVYNA |
| Ga0208546_10014295 | 3300025585 | Aqueous | MISLKTPRRGPYWNFWRVVLAGWIIRYPKTMGRMVLVPLGFLIVLIYNAVVN |
| Ga0208161_100019926 | 3300025646 | Aqueous | GPYWNFWKVILAGWIIRYPKTMSRVILLPLGFLIVLIYNACKN |
| Ga0208161_11289602 | 3300025646 | Aqueous | MKKSVPYWNFWRVILAGWIIRYPKTMGRIAFAALGFLICLIYNARVN |
| Ga0208898_11074173 | 3300025671 | Aqueous | MKNRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFFIVLI |
| Ga0208898_11242093 | 3300025671 | Aqueous | NFRSMRKSPYWNFWRVVFAGWMIRYPRTMAKVVFLPLGILIVLIYNAVTN |
| Ga0208019_100059313 | 3300025687 | Aqueous | RVILAGWIIRYPKTMSRVVLIPLGFLIILIYNAIVN |
| Ga0208019_100096011 | 3300025687 | Aqueous | MTALRNRRRGPYWNFWKVILAGWIIRYPKTMSRVILLPLGFLIVLIYNACKN |
| Ga0208019_11007432 | 3300025687 | Aqueous | MRAIKNPHRRPYWNFWKVVLAGWAIRYPKTLGRIIFLPLGLLIAMIYNAIVS |
| Ga0208784_100003243 | 3300025732 | Aqueous | MKESKRRRREPYWNFWKVILAGWIIRYPKQMGRIIFIPLGFLIILIYNAIVK |
| Ga0208767_12794532 | 3300025769 | Aqueous | MKKRPYWNFWKVVLAGWCIRYPKTMSKVVLIPLGFF |
| Ga0208917_12961551 | 3300025840 | Aqueous | SPYWNFWRVVFAGWMIRYPRTMAKVVFLPLGILIVLIYNAVTN |
| Ga0209182_101836601 | 3300025843 | Lake Sediment | MRTHKTNFRKRSPYWNFFRVVLAGWMIRYPKQTVFVPLGFLLVLIYN |
| Ga0208644_13240332 | 3300025889 | Aqueous | MKESKRRRREPYWNFWKVILAGWIIRYPKQMGRIIFIPL |
| Ga0208275_10725013 | 3300026182 | Marine | MKKRPYWNFWKVVLAGWLIRYPKTMGKIVLIPLGICI |
| Ga0209929_11126611 | 3300026187 | Pond Water | MITLRNRRRGPYWNFWRVILAGWIIRYPKSMSRVILIPLGILISLIYN |
| Ga0207989_10464473 | 3300026209 | Marine | KRPYWNFWKVVLAGWLIRYPKTMGKIVLIPLGICIVLIYNAWAS |
| Ga0207993_10584503 | 3300026270 | Marine | MKKSPYWNFWKVVLAGWLIRYPKTMSKVLLLPLGFFIVLIYNALTN |
| Ga0208923_10186523 | 3300027320 | Estuarine | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTFFVPLGFLLVLIYNAVVK |
| Ga0209867_10796572 | 3300027393 | Sand | MRTYKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| Ga0209651_11380943 | 3300027581 | Freshwater Lake | FFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| Ga0209357_10350711 | 3300027656 | Freshwater Lake | MRSHKTPFRKRIPYWNFWRVILAGWIIKYPKIVWIPIVFSVILIYNAIVK |
| (restricted) Ga0247833_10813462 | 3300027730 | Freshwater | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFVPLGFLLVLIYNAVVK |
| Ga0209444_100559281 | 3300027756 | Freshwater Lake | MRSHKTPFRKRIPYWNFWRVILAGWIIKYPKIVWIPIVFSVI |
| Ga0209768_102084923 | 3300027772 | Freshwater Lake | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNA |
| Ga0209768_103686243 | 3300027772 | Freshwater Lake | NFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| Ga0209536_1033610821 | 3300027917 | Marine Sediment | MITLRNRRRGPYWNFWRVILAGWIIRYPKSMSRVILIPLGILISLIYNACKN |
| Ga0268281_10584653 | 3300028156 | Saline Water | ILPGMRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| Ga0268279_10687483 | 3300028169 | Saline Water | RSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| Ga0265595_11296111 | 3300028191 | Saline Water | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLI |
| Ga0265595_11476643 | 3300028191 | Saline Water | ILPEMRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| Ga0268280_10668152 | 3300028298 | Saline Water | MRTHKTNFRRRSPYWNFLRVVLAGWMIRYPKQTVFIPLGFLLVLIYNAVVK |
| (restricted) Ga0247843_10193067 | 3300028569 | Freshwater | MRTHKTNFRRRSPYWNFFRVVLAGWMIRYPKQTVFIPLGLLLVLIYNAVVK |
| (restricted) Ga0247843_10202549 | 3300028569 | Freshwater | MRTHKTNFRKRSPYWNFFRVVLAGWMIRYPKQTVFVPLGFLLVLIYNAVVK |
| (restricted) Ga0247843_10991492 | 3300028569 | Freshwater | MRTHKNNFRKRSPYWNFFRVVLAGWMIRYPKQTVFVP |
| (restricted) Ga0247844_11091222 | 3300028571 | Freshwater | MRTHKNNFRKRSPYWNFFRVVLAGWMIRYPKQTVFVPLGFLLVLIYNVVVK |
| Ga0185543_10932371 | 3300029318 | Marine | MKKRPYWNFWKVVLAGWLIRYPKTMSKVVLIPLGFFIVLVYN |
| Ga0119945_10207993 | 3300029933 | Aquatic | SMIALKTPRRYYQKSPYWNFWRVILAGWIIRYPKAMSRVILLPLGFLIVMIYNACKN |
| Ga0307380_104557763 | 3300031539 | Soil | MRSHKTPFRKRTPYWNFWRVILAGWVIRYPKIVWVPIGFLIVLIYNAVVN |
| Ga0307380_114500271 | 3300031539 | Soil | PGMRNHKTPFRKRTPYWNFWRVVLAGWMIRYPKIVWVPVVFLIILIYNAIVR |
| Ga0307379_112075961 | 3300031565 | Soil | RRAPYWNFWRVVLAGWIIRYPKIVWVPIGFLIVLIYNAVVN |
| Ga0307378_109300822 | 3300031566 | Soil | MRRPYWNFWKVVFAGWLIRYPKTMGKIVFIPLGFLLVLIYNAIVN |
| Ga0315293_112751322 | 3300031746 | Sediment | MRIHKTPFRTRRGPYWNFWRVVLAGWIIRYPKIVWVPIGFLIVLIYNAVVN |
| Ga0315294_111346173 | 3300031952 | Sediment | NFYRVVLAGWVIRYPKIVWVPIGFLIVLIYNAVVN |
| Ga0315278_107075424 | 3300031997 | Sediment | RKPYWNFYRVVLAGWVIRYPKIVWVPIGFLIVLIYNAVVN |
| Ga0315284_107202072 | 3300032053 | Sediment | MRSHKTPFRKRTPYWNFYRVVLAGWVIRYPKIVWVPIVFLVILI |
| Ga0316201_101379823 | 3300032136 | Worm Burrow | MKKMPVRSPYWNFWRVVFAGWLIKYPKTMGKIALTTLGILIVLIYNACSR |
| Ga0315292_104273782 | 3300032143 | Sediment | MISPRNPRRYNRRKPYWNFYRVVLAGWVIRYPKIVWVPIGFLIVLIYNAVVN |
| Ga0334996_0048780_2014_2172 | 3300033994 | Freshwater | MKALKNRRRGPYWNFWRVILAGWIIRYPKTMSRVILLPLGFLIILIYNAIVK |
| Ga0334987_0770042_399_539 | 3300034061 | Freshwater | MKKSAPYWNFWRVILAGWIIKYPKQMSRIALTSLGILISLIYNALVK |
| Ga0335001_0457014_13_162 | 3300034064 | Freshwater | VAKRNKPPYWNFWKVILAGWMIRYPKTMAKVVLIPLTFLIVLIYNAVTK |
| Ga0335028_0335682_1_123 | 3300034071 | Freshwater | WNFWRVVLAGWTIRYPKTMGKIVLLPLGFLIVLIYNAIVR |
| Ga0335030_0032187_1725_1883 | 3300034103 | Freshwater | MIALRNRRRTPYWNFWRVVLAGWTIRYPKTMGKIVLLPLGFLIVLIYNAIVR |
| Ga0348337_091862_160_318 | 3300034418 | Aqueous | MIAPRNPRRNLYWTFWKVVFAGWLIRYPKTMGKIVLLPLGFLVVLIYNAVKN |
| ⦗Top⦘ |