Basic Information | |
---|---|
Family ID | F030858 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 184 |
Average Sequence Length | 42 residues |
Representative Sequence | MPNESISRRDILRTLAVGAVGGSVLQVIPAEAAEYVHQMV |
Number of Associated Samples | 146 |
Number of Associated Scaffolds | 184 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.80 % |
% of genes near scaffold ends (potentially truncated) | 96.74 % |
% of genes from short scaffolds (< 2000 bps) | 92.39 % |
Associated GOLD sequencing projects | 139 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.304 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.804 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.804 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.022 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 184 Family Scaffolds |
---|---|---|
PF05199 | GMC_oxred_C | 96.20 |
PF10518 | TAT_signal | 1.09 |
PF00873 | ACR_tran | 0.54 |
PF13618 | Gluconate_2-dh3 | 0.54 |
PF02738 | MoCoBD_1 | 0.54 |
COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
---|---|---|---|
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 96.20 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.30 % |
Unclassified | root | N/A | 8.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_104126684 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300001545|JGI12630J15595_10045068 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300001593|JGI12635J15846_10781207 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300001593|JGI12635J15846_10878993 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100093967 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101151104 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10262213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 702 | Open in IMG/M |
3300004152|Ga0062386_100069940 | All Organisms → cellular organisms → Bacteria | 2666 | Open in IMG/M |
3300004152|Ga0062386_101516228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 559 | Open in IMG/M |
3300005166|Ga0066674_10141850 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300005171|Ga0066677_10721219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 556 | Open in IMG/M |
3300005174|Ga0066680_10712001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 615 | Open in IMG/M |
3300005406|Ga0070703_10615893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 502 | Open in IMG/M |
3300005439|Ga0070711_100794987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 802 | Open in IMG/M |
3300005547|Ga0070693_101338292 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005554|Ga0066661_10124183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1563 | Open in IMG/M |
3300005568|Ga0066703_10673506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 597 | Open in IMG/M |
3300005618|Ga0068864_101796238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 618 | Open in IMG/M |
3300005764|Ga0066903_102641773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 973 | Open in IMG/M |
3300006031|Ga0066651_10536770 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300006059|Ga0075017_101213802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 591 | Open in IMG/M |
3300006162|Ga0075030_101652957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300006172|Ga0075018_10512588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 627 | Open in IMG/M |
3300006172|Ga0075018_10781495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
3300006173|Ga0070716_100549894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 860 | Open in IMG/M |
3300006176|Ga0070765_101928410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 553 | Open in IMG/M |
3300006354|Ga0075021_10724108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
3300006755|Ga0079222_10502185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 889 | Open in IMG/M |
3300006755|Ga0079222_10507335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 886 | Open in IMG/M |
3300006794|Ga0066658_10497183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 663 | Open in IMG/M |
3300006796|Ga0066665_10867278 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300006893|Ga0073928_10871040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 619 | Open in IMG/M |
3300007255|Ga0099791_10646167 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300007258|Ga0099793_10313101 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300007265|Ga0099794_10157743 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300009038|Ga0099829_10477114 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300009038|Ga0099829_11452786 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300009038|Ga0099829_11609425 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300009088|Ga0099830_11070378 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300009090|Ga0099827_10331636 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300009090|Ga0099827_10624534 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300009143|Ga0099792_11072434 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300009524|Ga0116225_1423585 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300010358|Ga0126370_10885047 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300010359|Ga0126376_10902811 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300010361|Ga0126378_11162055 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300010362|Ga0126377_13222566 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010366|Ga0126379_10833543 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300010366|Ga0126379_11440198 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300010379|Ga0136449_104607837 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300010398|Ga0126383_10005161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8939 | Open in IMG/M |
3300012096|Ga0137389_10410605 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300012096|Ga0137389_11601621 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300012202|Ga0137363_11343375 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300012202|Ga0137363_11442453 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300012203|Ga0137399_10159884 | Not Available | 1806 | Open in IMG/M |
3300012203|Ga0137399_11052179 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300012205|Ga0137362_10262359 | Not Available | 1493 | Open in IMG/M |
3300012205|Ga0137362_10989234 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300012205|Ga0137362_11610546 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300012349|Ga0137387_10978123 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300012359|Ga0137385_10949566 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300012361|Ga0137360_10053690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2914 | Open in IMG/M |
3300012361|Ga0137360_10506332 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300012361|Ga0137360_10622306 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300012362|Ga0137361_11045303 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300012362|Ga0137361_11246905 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300012362|Ga0137361_11635509 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300012363|Ga0137390_10339169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1484 | Open in IMG/M |
3300012363|Ga0137390_10745350 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300012363|Ga0137390_10847815 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300012363|Ga0137390_11865313 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300012582|Ga0137358_10927579 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012922|Ga0137394_10908319 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300012924|Ga0137413_11648693 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300012925|Ga0137419_10377683 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300012925|Ga0137419_10867945 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300012925|Ga0137419_11206259 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300012927|Ga0137416_10040661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3186 | Open in IMG/M |
3300012948|Ga0126375_11622165 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012972|Ga0134077_10489428 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012989|Ga0164305_10653269 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300013832|Ga0120132_1144518 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300014154|Ga0134075_10398340 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300015241|Ga0137418_10795209 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300015242|Ga0137412_10487334 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300015245|Ga0137409_11039270 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300015264|Ga0137403_11129066 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300015356|Ga0134073_10061425 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300015358|Ga0134089_10085509 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300017822|Ga0187802_10208980 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300017955|Ga0187817_11120164 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300017974|Ga0187777_10278074 | Not Available | 1141 | Open in IMG/M |
3300018006|Ga0187804_10150443 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300018018|Ga0187886_1319260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 577 | Open in IMG/M |
3300018433|Ga0066667_10377558 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300020170|Ga0179594_10028547 | Not Available | 1761 | Open in IMG/M |
3300020170|Ga0179594_10156537 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300020199|Ga0179592_10016250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3271 | Open in IMG/M |
3300021088|Ga0210404_10572328 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300021168|Ga0210406_10279490 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300021180|Ga0210396_11037192 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300021181|Ga0210388_11320271 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300021401|Ga0210393_10265319 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300021405|Ga0210387_11430240 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300021406|Ga0210386_11434810 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300021407|Ga0210383_10407460 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300021420|Ga0210394_10706151 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300021433|Ga0210391_11557853 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300021474|Ga0210390_10785686 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300021474|Ga0210390_11394534 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300021478|Ga0210402_10828474 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300021479|Ga0210410_10720035 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300021479|Ga0210410_11505432 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300024182|Ga0247669_1028136 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300024225|Ga0224572_1074233 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300024245|Ga0247677_1032487 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300024286|Ga0247687_1007876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1391 | Open in IMG/M |
3300024288|Ga0179589_10599123 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300024290|Ga0247667_1005379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2731 | Open in IMG/M |
3300024330|Ga0137417_1249299 | Not Available | 1494 | Open in IMG/M |
3300024331|Ga0247668_1074575 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300025464|Ga0208076_1078573 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300025625|Ga0208219_1046947 | Not Available | 1091 | Open in IMG/M |
3300025906|Ga0207699_10736781 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300025916|Ga0207663_11534537 | Not Available | 536 | Open in IMG/M |
3300026294|Ga0209839_10045771 | Not Available | 1602 | Open in IMG/M |
3300026343|Ga0209159_1144370 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300026537|Ga0209157_1037288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2728 | Open in IMG/M |
3300026548|Ga0209161_10156361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
3300026551|Ga0209648_10018286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6122 | Open in IMG/M |
3300026552|Ga0209577_10194817 | Not Available | 1560 | Open in IMG/M |
3300027537|Ga0209419_1082272 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300027643|Ga0209076_1081734 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300027643|Ga0209076_1095628 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300027643|Ga0209076_1105878 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300027667|Ga0209009_1011413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2121 | Open in IMG/M |
3300027667|Ga0209009_1156793 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300027706|Ga0209581_1086498 | Not Available | 1100 | Open in IMG/M |
3300027725|Ga0209178_1063407 | Not Available | 1197 | Open in IMG/M |
3300027829|Ga0209773_10318383 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300027846|Ga0209180_10014489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4118 | Open in IMG/M |
3300027857|Ga0209166_10030728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3267 | Open in IMG/M |
3300027862|Ga0209701_10302068 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300027862|Ga0209701_10605708 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300027910|Ga0209583_10206866 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300028138|Ga0247684_1030099 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300030042|Ga0302300_1155333 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300030339|Ga0311360_10701916 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300030503|Ga0311370_12391133 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300030764|Ga0265720_1027656 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031446|Ga0170820_11118665 | Not Available | 1168 | Open in IMG/M |
3300031446|Ga0170820_13050562 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300031525|Ga0302326_13441579 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300031715|Ga0307476_10492398 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300031718|Ga0307474_11052645 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300031718|Ga0307474_11664098 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031719|Ga0306917_10999083 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300031720|Ga0307469_10480072 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300031720|Ga0307469_10674876 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300031740|Ga0307468_100861623 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300031740|Ga0307468_101572926 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300031753|Ga0307477_10991886 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300031754|Ga0307475_10813488 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300031820|Ga0307473_10153282 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300031879|Ga0306919_10398983 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300031893|Ga0318536_10674412 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300031946|Ga0310910_11387116 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300032042|Ga0318545_10173371 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300032076|Ga0306924_10494483 | Not Available | 1394 | Open in IMG/M |
3300032094|Ga0318540_10278226 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300032094|Ga0318540_10297231 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300032174|Ga0307470_10305595 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300032180|Ga0307471_101961761 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300032180|Ga0307471_103287326 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300032180|Ga0307471_103867332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300032205|Ga0307472_102656083 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300032805|Ga0335078_11928773 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300032828|Ga0335080_10314150 | Not Available | 1698 | Open in IMG/M |
3300033004|Ga0335084_11491407 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300033004|Ga0335084_11851362 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300033290|Ga0318519_10072421 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.22% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.89% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.89% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.17% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.17% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.63% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.09% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.09% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.09% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.09% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.54% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.54% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.54% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.54% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.54% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.54% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.54% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030764 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1041266842 | 3300000955 | Soil | MTTEGITRRDVLKTLALGVAGGGVLQVIPLAAAELAHQAVHKEKATAP |
JGI12630J15595_100450682 | 3300001545 | Forest Soil | MSVEVSRRDILKTLALSAVGGSVLQVIPTQAAEYTHQAVRKD |
JGI12635J15846_107812072 | 3300001593 | Forest Soil | MANESISRRDILRTLAVGAVGGSVLQVIPAEAAEYVHQMVHKEKAAAPA |
JGI12635J15846_108789932 | 3300001593 | Forest Soil | MSSQSVTRRDILKTLAIGAVGGSVLQVIPAQAAEFA |
JGIcombinedJ26739_1000939673 | 3300002245 | Forest Soil | MSVEVSRRDILKTLALSAVGGSVLQVIPTQAAEYTHQAVRKDKA |
JGIcombinedJ26739_1011511041 | 3300002245 | Forest Soil | MGAGISRRDILKTLALSAVGGSVLQVIPAHAAEYAHQAVRK |
JGIcombinedJ51221_102622131 | 3300003505 | Forest Soil | MSRNSVSRRDVLRTLAMGAVGGSVLQLIPLQAAEQVHHMVKQEKAHS |
Ga0062386_1000699403 | 3300004152 | Bog Forest Soil | MRGISRRDVLKSLALGAAGGSVLQMIPAEAAALAHQMVHK |
Ga0062386_1015162282 | 3300004152 | Bog Forest Soil | MQGISRRDLLKNLAVGAAGGSVLQMIPAEAAALAHQMVHK |
Ga0066674_101418501 | 3300005166 | Soil | MVNEGITRRDILRTLAVGAVGGSVLQVIPAKAAEYIHQMVHKEKGAAP |
Ga0066677_107212192 | 3300005171 | Soil | MANESISRRDVLRTLALGAAGGSVLQVIPAEAAEYVHQMVHK |
Ga0066680_107120012 | 3300005174 | Soil | MANESISRRDILRTLAVTAAGGTVLQVIPTEAAAYVHQMVRKEK |
Ga0070703_106158932 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MATGISRRDVLKTLGITAAAGSVLQVIPAKAAAFAHEAIQK |
Ga0070711_1007949872 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQGISRRDVLRTLAMGMAGGSVLQVIPLEAAELAHQMVHKE |
Ga0070693_1013382921 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSHGVTRRDILRTLAMGAVGGSVLQVIPAKAAEFVHQAVRKEK |
Ga0066661_101241831 | 3300005554 | Soil | MPNESITRRDILRTLAFGAAAGSVLQVIPAEAAEYVHQMVHKEKAAV |
Ga0066703_106735061 | 3300005568 | Soil | MGNESISRRDILRTLALGAAGGSVLQVIPAEAAEYIHQMV |
Ga0068864_1017962382 | 3300005618 | Switchgrass Rhizosphere | MATGISRRDVLKTLGITAAAGSVLQVIPAKAAAFAHEAIQ |
Ga0066903_1026417732 | 3300005764 | Tropical Forest Soil | MPANPISRRDILKTLAMGAVGGSVLQVIPAEAAEHIHQ |
Ga0066651_105367702 | 3300006031 | Soil | MSGQGVSRRDVLRTLAAGAVSGTVLQVIPAKAAEYA |
Ga0075017_1012138022 | 3300006059 | Watersheds | MPSNPITRRDILRTLAIGGVGGSVLQVIPLEAAEQVHRMVKQEKTQA |
Ga0075030_1016529571 | 3300006162 | Watersheds | MPSNPITRRDILRTLAIGGVGGSVLQVIPLEAAEQ |
Ga0075018_105125882 | 3300006172 | Watersheds | MSNPVSRRDVLRTLAIGAVGGSVLQVIPLEAAEHVHQMIRTE |
Ga0075018_107814951 | 3300006172 | Watersheds | MPNDSISRRDILRTLAVTAAGGSVLQVIPAEAAEYIHQMVHKE |
Ga0070716_1005498942 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGQGVSRRDVLKTLAAGAVSGSVLRVIPAKAAEYAHQMVHNE |
Ga0070765_1019284101 | 3300006176 | Soil | MAGISRRDVLKNLAIGAAGGSVMQVIPVQAAALAHQMVH |
Ga0075021_107241082 | 3300006354 | Watersheds | MSNPVSRRDVLRTLAMGAVGGSVLQVIPLEAAEHVHQMIRAEKSQGTA |
Ga0079222_105021852 | 3300006755 | Agricultural Soil | MSENSVSRRDILKTLAVSAVGGSVLQVIPAKAAAY |
Ga0079222_105073352 | 3300006755 | Agricultural Soil | MPNESISRRDILRTLAVTAAGSVLQIIPAEAAEYVHQMVHKEKAAAPAG |
Ga0066658_104971832 | 3300006794 | Soil | MANESISRRDILRTLALGAAGGSVLQVIPAEAAEYIHQMVRKEKA |
Ga0066665_108672781 | 3300006796 | Soil | MSGQGVSRRDVLRTLAAGAVSGTVLQVIPAKAAEYAH |
Ga0073928_108710401 | 3300006893 | Iron-Sulfur Acid Spring | MATQGVTRRDVLRTLAVGAVGGSVLQLIPAQAAEYAHQVVQKEKASAAG* |
Ga0099791_106461671 | 3300007255 | Vadose Zone Soil | MSGQGVTRRDILRTLAAGAVGGSVLRVIPAKAAEYAHQIVHKEKAAAL |
Ga0099793_103131011 | 3300007258 | Vadose Zone Soil | MNMPNDSISRRDILRTLAVTAAGSVLQIIPAEAAEYVHQMVYKEKA |
Ga0099794_101577432 | 3300007265 | Vadose Zone Soil | MPNESISRRDILRTLAVGAVGGSVLQVIPAEAAEYVHQMV |
Ga0099829_104771143 | 3300009038 | Vadose Zone Soil | MNESISRRDILRTLAVGAVGGSVLQVIPAEAAEYVH |
Ga0099829_114527861 | 3300009038 | Vadose Zone Soil | MNDSISRRDILRTLAVTAAGSILQVIPAEAAEYVHQMVHKEKA |
Ga0099829_116094251 | 3300009038 | Vadose Zone Soil | MNMPNESISRRDILRTLAFGAAAGSVLQVIPAEAAEYVHQMVHKEKAA |
Ga0099830_110703781 | 3300009088 | Vadose Zone Soil | MANEGISRRDILRTLAVGAVGGSVLQIIPAEAAEYVHQMVHKEKAA |
Ga0099827_103316362 | 3300009090 | Vadose Zone Soil | MVNQGISRRDILRTLAVGAVGGSVLQIIPAEAAEYVHQMV |
Ga0099827_106245342 | 3300009090 | Vadose Zone Soil | MANESISRRDILRTLALGAAGGSVLQVIPAEAAEYVNQMV |
Ga0099792_110724341 | 3300009143 | Vadose Zone Soil | MSSQGVTRRDILKTLAMGAVGGSVLQVIPAKAAEFVHQ |
Ga0116225_14235852 | 3300009524 | Peatlands Soil | MMRGISRRDVLKNLAVGAAGGSVLQMIPAEAAALVHQMVHQEKAASSS |
Ga0126374_108126722 | 3300009792 | Tropical Forest Soil | MKPNAISRRDILRTLALGAAAGSVLEVIPAEAAAYVHNAIDAEKS |
Ga0126370_108850471 | 3300010358 | Tropical Forest Soil | MASESISRRDILRTLAVGVTGSVLQVIPAEAAEYVHQMVHKEKAAAPTG |
Ga0126376_109028112 | 3300010359 | Tropical Forest Soil | MTTGISRSDVLKTLAAGAAGGSVLRVIPLEAAELTHRLVQKEKAAA |
Ga0126378_111620551 | 3300010361 | Tropical Forest Soil | MPANPISRRDILKTLAMGAVGGSVLQVIPAEAAEHVHQ |
Ga0126377_132225661 | 3300010362 | Tropical Forest Soil | MSTQGISRRDVLKTLAVSAVGGSVLQVIPLQAAEMA |
Ga0126379_108335432 | 3300010366 | Tropical Forest Soil | MPSNPISRRDILKTLALGSIGGSVLQVIPLEAAEQA |
Ga0126379_114401981 | 3300010366 | Tropical Forest Soil | MSGISRRDILRNLAAGAAGGSVLQMIPARAAELAH |
Ga0136449_1046078372 | 3300010379 | Peatlands Soil | MNDSITRRDILRTFAFGAAAGSVLQIIPAEAAAYVHQMVHKEK |
Ga0126383_100051618 | 3300010398 | Tropical Forest Soil | MSGHGVTRRDVLRTLAAGAVGGSVLQVIPAKAAEYAHQVTRKEKASAPS |
Ga0137389_104106052 | 3300012096 | Vadose Zone Soil | MNDSISRRDILRTLAFGAASSSVLQVIPVAAAEYVHQMVHKEKAAAPAGK |
Ga0137389_116016212 | 3300012096 | Vadose Zone Soil | MSSQSVTRRDILKTLAIGAVGGSVLQVIPAQAAEFVHQAVRKEKAASPAG |
Ga0137363_113433752 | 3300012202 | Vadose Zone Soil | MSSQSVTRRDILKSLAMGAVGGSVLQVIPAEAAEFVHQSVRKE |
Ga0137363_114424532 | 3300012202 | Vadose Zone Soil | MSAHGVTRRDILKTLAMGAVGGSVLQVIPAKAAEFVHQAVRK |
Ga0137399_101598842 | 3300012203 | Vadose Zone Soil | MAMAKNPITRRDVLKTLAIGAAGGSVLQSVPLQAAE |
Ga0137399_110521792 | 3300012203 | Vadose Zone Soil | MANESITRRDILRTLAFGATAGSVLQVIPAEAAEYIHQLVHKEKAAAPAG |
Ga0137362_102623591 | 3300012205 | Vadose Zone Soil | MSSQSVTRRDILKTLAMGAVGGSVLQVIPAKAAEFA |
Ga0137362_109892341 | 3300012205 | Vadose Zone Soil | MAMQGISRRDVLRTLAVGIAGGGVLQVIPLEAAELAHQMV |
Ga0137362_116105461 | 3300012205 | Vadose Zone Soil | MSSQGVTRRDILKTLAMGAVGGSVLQVIPAKAAEFVHQA |
Ga0137387_109781231 | 3300012349 | Vadose Zone Soil | MANESISRRDILRTLAVTAAGSVLRVIPAEAAEYVHQMVHKEKAAAPAG |
Ga0137385_109495661 | 3300012359 | Vadose Zone Soil | MANESISRRDILRTLAVTAAGGTVLQVIPAEAAAYVHQV |
Ga0137360_100536901 | 3300012361 | Vadose Zone Soil | MNDSISRRDILRTLAFGAASSSVLQVIPAAAAEYVHQMVHKEKAAAPA |
Ga0137360_105063321 | 3300012361 | Vadose Zone Soil | MNMPNDSISRRDILRTLAVTAAGSVLQIIPAEAAEYVHQMV |
Ga0137360_106223062 | 3300012361 | Vadose Zone Soil | MNDSISRRDILRTLAVTAAGSVLQIIPAEAAEYVHQMVHK |
Ga0137361_110453031 | 3300012362 | Vadose Zone Soil | MSGQGVSRRDVLRTLAAGGVSGSVLPVIQVKAAEYAHEMVN |
Ga0137361_112469052 | 3300012362 | Vadose Zone Soil | MNDSISRRDILRTLAFGAASSSVLQVIPAAAAEYVHQMVHKEKA |
Ga0137361_116355092 | 3300012362 | Vadose Zone Soil | MTAQGITRRDVLRTLALGVAGGGVLQMIPLAAAELAHQMV |
Ga0137390_103391691 | 3300012363 | Vadose Zone Soil | MPNESITRRDVLRTLAFGAAAGSVLQVIPAEAAEYVHQMV |
Ga0137390_107453501 | 3300012363 | Vadose Zone Soil | MSSQSVTRRDILKTLAIGAVGGSVLQVIPAQAAEFVHQAVR |
Ga0137390_108478151 | 3300012363 | Vadose Zone Soil | MNDSISRRDILRTLAFGAASSSVLQVIPAAAAEYVHQMV |
Ga0137390_118653132 | 3300012363 | Vadose Zone Soil | MPNESISRRDILRTLALGAAGGSVLQVIPAEAAEYIHQMV |
Ga0137358_109275792 | 3300012582 | Vadose Zone Soil | MSGQGVTRRDILRTLAAGAVGGSVLRVIPAKAAEYAHQMVHK |
Ga0137394_109083192 | 3300012922 | Vadose Zone Soil | MTAQGITRRDVLRTLALGVAGGGVLQMIPLEAAELAHQ |
Ga0137413_116486931 | 3300012924 | Vadose Zone Soil | MNASISRRDILRTLAVTAAGSVLQVIPAEAAEYVHQM |
Ga0137419_103776832 | 3300012925 | Vadose Zone Soil | MAKEGISRRDVLRTLAVGAASSSVLQVIPAAAAEYVHQMVHKEKAAAPA |
Ga0137419_108679452 | 3300012925 | Vadose Zone Soil | MSAQGITRRDILKTLAMGAVGGSVLQVIPAKAAEFVHQAVRKEKAASP |
Ga0137419_112062591 | 3300012925 | Vadose Zone Soil | MANEGISRRDILRTLAVGAVGGSVLQIIPAEAAEYIHQMVHKEKAAA |
Ga0137416_100406611 | 3300012927 | Vadose Zone Soil | MANESISRRDILRTLAFGAAGGSVLQVIPAEAAEYVHQ |
Ga0126375_116221652 | 3300012948 | Tropical Forest Soil | MSQGITRRDILRTLAAGAVGGSVLQVIPAKGAEYAHQVVRK |
Ga0134077_104894282 | 3300012972 | Grasslands Soil | MANESISRRDILRTLAVTAAGGSVLQVIPAEAAAYVHQVVRKE |
Ga0164305_106532691 | 3300012989 | Soil | METQGISRRDVLRTLAMGMAGGSVLQVIPLEAAEL |
Ga0120132_11445182 | 3300013832 | Permafrost | MSAGISRRDILKTLALSAVGGSVLQVIPAQAAEYAHQAVQ |
Ga0134075_103983401 | 3300014154 | Grasslands Soil | MPNESITRRDILRTLAFGAAAGSVLQIIPAEAAEYVHQMVHKEKAAAQAG |
Ga0137418_107952092 | 3300015241 | Vadose Zone Soil | MSAQGITRRDILKTLAMGAVGGSVLQVIPAKAAEFVHQ |
Ga0137412_104873341 | 3300015242 | Vadose Zone Soil | MMTTHGISRRDVLRTLAVGVAGGSVLQVIPLEAAELAHQLVH |
Ga0137409_110392702 | 3300015245 | Vadose Zone Soil | MAISGISRRDVLKTLALGAAGGSVLQMIPLEAAEL |
Ga0137403_111290662 | 3300015264 | Vadose Zone Soil | MSSQSVTRRDILKTLAVGAVGGSVLQVIPAKAAEFVHQAVRKEK |
Ga0134073_100614252 | 3300015356 | Grasslands Soil | MANEGITRRDILRTLTVGAVGGSVLQVIPAKAAEYIHQMVHKEK |
Ga0134089_100855092 | 3300015358 | Grasslands Soil | MPNESISRRDVLRTLAVTAAGSVLQIIPAEAAEYVHQMVHKEK |
Ga0187802_102089801 | 3300017822 | Freshwater Sediment | MNESITRRDVLRTLAIGAAGGSVLRVIPAEAAALVHQMVHKEKAAAAG |
Ga0187817_111201641 | 3300017955 | Freshwater Sediment | MNESISRRDVLRTLAIGAAGGSVLRVIPAEAAALVHQMVHKEKATAA |
Ga0187777_102780741 | 3300017974 | Tropical Peatland | MSGISRRDLLRNIAVGAAGGSVLQMIPARAAELAHEL |
Ga0187804_101504431 | 3300018006 | Freshwater Sediment | MMRGISRRDVLKNLAFGAAGGSVLQIIPAEAAALAHQMVHKEKSASPAG |
Ga0187886_13192601 | 3300018018 | Peatland | MRGISRRDVLKNLAVGAAGGSVLQMIPAEAAALVHQMVHKEKAA |
Ga0066667_103775581 | 3300018433 | Grasslands Soil | MDAGPISRRDILRALTLGTTAGSVLKIIPLQAAEHVHKI |
Ga0179594_100285471 | 3300020170 | Vadose Zone Soil | MANESISRRDILRTLAFGAAAGSVLQIIPAEAAEYVH |
Ga0179594_101565371 | 3300020170 | Vadose Zone Soil | MMKEGISRRDVLRTLAVGAASSSVLQVIPAAAAEYVHQMVHKEKAAAP |
Ga0179592_100162503 | 3300020199 | Vadose Zone Soil | MPNESITRRDILRTLAFGAAAGSVLQVIPAAAAEYV |
Ga0210404_105723282 | 3300021088 | Soil | MSENSVTRRDILRTLAVGAVSGSVLQVIPAKAAEYAHQLVHNE |
Ga0210406_102794902 | 3300021168 | Soil | MATPGISRRDILRTLAVGAVGGSVLQVIPAEAAEYVHQVVRGEKAAAGTY |
Ga0210396_110371921 | 3300021180 | Soil | MPTNSVSRRDVLRTLAMGAVGGSVLQLIPLQAAAQVHHMVK |
Ga0210388_113202712 | 3300021181 | Soil | MATTGISRRDVLRTLAVGMAGGSVLQVIPLEAAEL |
Ga0210393_102653191 | 3300021401 | Soil | MSEHSVTRRDILRTLAVGVASGSVLQVIPAKAAEYAHKVVHNEKS |
Ga0210389_113875602 | 3300021404 | Soil | MPTNSVSRRDVLRTLAMGAVGGSVLQLIPLQAAEQVHHMVKQEKAH |
Ga0210387_114302402 | 3300021405 | Soil | MATQGISRRDVLKTLMMGVGGGVLQVIPLEAAELAHQMVH |
Ga0210386_114348101 | 3300021406 | Soil | MPHESISRRDILRTLAVGAVSGSVLQIIPAEAAAYIHQ |
Ga0210383_104074602 | 3300021407 | Soil | MSGISRRDVLRNLTVGALGGSVMNIIPIEAAELAHQM |
Ga0210394_107061512 | 3300021420 | Soil | MSEHSVTRRDILRTLAVGVASGSVLQVIPAKAAEYAHKVVHNEKSGSP |
Ga0210391_115578531 | 3300021433 | Soil | MATTGISRRDVLRTLAVGMAGGSVLQVIPLEAAELAHQMVRKE |
Ga0210390_107856862 | 3300021474 | Soil | MTENSVTRRDILRTLAVGAVSGSVLQVIPAKAAEYAHQ |
Ga0210390_113945341 | 3300021474 | Soil | MSEHSVTRRDILRTLAVSAVGGSVLQVIPAKAAEFAH |
Ga0210402_108284742 | 3300021478 | Soil | MNESISRRDILRTLAIGAAGSVLQVIPAEAAEYAHQM |
Ga0210410_107200352 | 3300021479 | Soil | MSEHSVTRRDILRTLAVGVASGSVLQVIPAKAAEYAHK |
Ga0210410_115054322 | 3300021479 | Soil | MANEGISRRDILKTLAVGVVGGSVLQMIPAEAAEYVHQMVRKEKAA |
Ga0247669_10281361 | 3300024182 | Soil | MSSHGVTRRDILRTLAMGAVGGSVLQVIPAKAAEFVHQAVRKEKA |
Ga0224572_10742332 | 3300024225 | Rhizosphere | VTTTLGVGRRDILKTLALGAVGGSVLQVIPAAAAEYAHL |
Ga0247677_10324871 | 3300024245 | Soil | MSGQRVSRRDVLRTLAAGAVSGSVLQVIPARAAEYAHQMVHKEKAA |
Ga0247687_10078761 | 3300024286 | Soil | MSGQGVSRRDVLRTLAAGAVGGSVLRVIPAKAAEYAHQMVRNEKAAA |
Ga0179589_105991231 | 3300024288 | Vadose Zone Soil | MATSGISRRDVLKTLALGAAGGSVLQMIPLEAAEL |
Ga0247667_10053791 | 3300024290 | Soil | MSGQRVSRRDVLRTLAAGAVSGSVLQVIPARAAEYAHQMVHK |
Ga0137417_12492991 | 3300024330 | Vadose Zone Soil | MANDSISRRDILRTLAVGAVGGSVLQVIPAEAAEYVHQMVHKEKAAAPAG |
Ga0247668_10745752 | 3300024331 | Soil | MSGQGVSRRDVLRTLAAGAVGGSVLRVIPAKAAEYAHQMVRN |
Ga0208076_10785732 | 3300025464 | Arctic Peat Soil | MSAGISRRDILKTLAITAAGGSVLQLIPAQAAEYAHQAVHKEK |
Ga0208219_10469472 | 3300025625 | Arctic Peat Soil | MSVGITRRDILKTLALSAVGGSVLQVIPAQAAEYA |
Ga0207699_107367812 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGQGVSRRDVLRTLAAGAVSGTVLQAIPAKAAEY |
Ga0207663_115345371 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRISRRDVLRNLTVGAAAGSILQVIPAEAAALVHQMVHEAKA |
Ga0209839_100457711 | 3300026294 | Soil | MSVGISRRDILKTLAITAAGGSVLQLIPAQAAEYAHQAVHKEKAA |
Ga0209159_11443702 | 3300026343 | Soil | MVNEGITRRDILRTLAVGAVGGSVLQVIPAKAAEYIHQMV |
Ga0209157_10372881 | 3300026537 | Soil | MANQSISRRDILRTLAVGAAGSVLQVIPAKAAAYAHQMV |
Ga0209161_101563611 | 3300026548 | Soil | MANQSISRRDILRTLAVGAAGSVLQVIPAKAAAYAHQ |
Ga0209648_100182861 | 3300026551 | Grasslands Soil | MSSQSVTRRDILKTLAIGAVGGSVLQVIPAQAAEFVHQAVRKEKAASPA |
Ga0209577_101948171 | 3300026552 | Soil | MPRNSVSRRDVLRTLAMGAVGGSVLQLIPLQAAEQVHHMVK |
Ga0209419_10822722 | 3300027537 | Forest Soil | MSSQSVTRRDILKTLAIGAFGGSVLQVIPAQAAEFAHQTVRKEKAASPA |
Ga0209076_10817341 | 3300027643 | Vadose Zone Soil | MSAHGVTRRDILKTLAMGAVGGSVLQVIPAKAAEFVHQAVRKEKAAS |
Ga0209076_10956281 | 3300027643 | Vadose Zone Soil | MPNESITRRDILRTLAFGAAAGSVLQVIPAAAAEYVHQMVHK |
Ga0209076_11058781 | 3300027643 | Vadose Zone Soil | MMKEGISRRDVLRTLAVGAASSSVLQVIPAAAAEYVHQMVHKEKA |
Ga0209009_10114131 | 3300027667 | Forest Soil | MSGISRRDVLRNLTVGALGGSVLNIIPIEAAELAHQMVHQEKSTT |
Ga0209009_11567931 | 3300027667 | Forest Soil | MSDEGISRRDILKTLALSVVGGSVLQVIPAQAAEYAHQAVQKDKAAAPSG |
Ga0209581_10864982 | 3300027706 | Surface Soil | MGTQGVSRRDILRTLAIGAVGGSVLQVIPAEAAEYA |
Ga0209178_10634071 | 3300027725 | Agricultural Soil | MGANGVTRRDVLKTLAMGAVSGSVLQVIPAQAAEFA |
Ga0209773_103183832 | 3300027829 | Bog Forest Soil | MPNESISRRDILRTLAVGAVSGSVLQIIPAEAAADSDC |
Ga0209180_100144894 | 3300027846 | Vadose Zone Soil | MTTQGITRRDVLRTLALGMASGGVLQMIPLEAAELAHQM |
Ga0209166_100307283 | 3300027857 | Surface Soil | MATTGISRRDVLRTLAMGVAGGGVLQVIPLEAAELAHQMVHKEKAAAPAG |
Ga0209701_103020681 | 3300027862 | Vadose Zone Soil | MSAQGVTRRDILKTLAMGAVGGSVLQVIPAKAAEFVHQAV |
Ga0209701_106057082 | 3300027862 | Vadose Zone Soil | MPSESITRRDILRTLAFGAAAGSVLQVIPAEAAEY |
Ga0209583_102068662 | 3300027910 | Watersheds | MLSNPVSRRDILKTLAMGACGSVLQVIPLEAAEHVHQMIRTEKSQAASGKYVP |
Ga0247684_10300992 | 3300028138 | Soil | MSENSVSRRDILRTLAVGAVGGSVLQVIPAKAAEYAHQVIHSEKAASPS |
Ga0302300_11553331 | 3300030042 | Palsa | MNNHSVTRRDILRTLVVGTVAGSVLQMVPAQAAEYAHGLIEM |
Ga0311360_107019161 | 3300030339 | Bog | MALNPISRRDVLRTLAMGAAGGSVLQIIPLQAAEHVH |
Ga0311370_123911332 | 3300030503 | Palsa | VTTTQGVTRRDILRTLAIGAVGGSVLQVIPAAAAKYAHQIIRQE |
Ga0265720_10276562 | 3300030764 | Soil | MSEHSVTRRDILRTLAVSAVGGSVLQVIPAKAAEFA |
Ga0170820_111186651 | 3300031446 | Forest Soil | MATQGISRRDVLKTLMMGVGGGVLQVIPLEAAELAHQMVHKEK |
Ga0170820_130505621 | 3300031446 | Forest Soil | MGIQGISRRDVLRSLAVGAAGGSVLGMIPAQAAEY |
Ga0302326_134415792 | 3300031525 | Palsa | MSLKDVSRRDILKTLSWGAAGSVLQVIPAQAAEYVHRMVASEKAKAPKAGYS |
Ga0307476_104923981 | 3300031715 | Hardwood Forest Soil | MSSESISRRDVLRTLAMGAVGGSVLQLIPLAAAEHVHRMVKQEKAQ |
Ga0307474_110526451 | 3300031718 | Hardwood Forest Soil | MSATGISRRDVLKTLAISAAGGSVLQVIPAEAAELAHQMV |
Ga0307474_116640981 | 3300031718 | Hardwood Forest Soil | MTVGISRRDILKTLALSTVGGSVLQVIPAQAAEYAHQ |
Ga0306917_109990831 | 3300031719 | Soil | VSTDGISRRDVLRTLAIGAAGGSVLQVIPLQAAEMAHQAVRKEK |
Ga0307469_104800721 | 3300031720 | Hardwood Forest Soil | MATSGISRRDVLRTLAMGMAGGGVLQVIPLEAAELAHQMVRKEKVAA |
Ga0307469_106748762 | 3300031720 | Hardwood Forest Soil | MSENSVSRRDILRTLALGAVGGSVLQVIPAKAAEYAHQVVHK |
Ga0307468_1008616232 | 3300031740 | Hardwood Forest Soil | MATGISRRDVLKTLGITAAAGSVLQVIPAKAAAFAHEAIQKEKAASLT |
Ga0307468_1015729262 | 3300031740 | Hardwood Forest Soil | MTTQGLTRRDILRTLAVGAIGGSVLQVIPAEAAEYAHQMVR |
Ga0307477_109918862 | 3300031753 | Hardwood Forest Soil | MNESISRRDILRTLAVTAAGGSVLQVIPAHAAEYIHQMVHKEKS |
Ga0307475_108134882 | 3300031754 | Hardwood Forest Soil | MPNESITRRDILRTLAFGAAAGSVLQVIPAEAAEYVHQMVHKEKAATPAG |
Ga0307473_101532822 | 3300031820 | Hardwood Forest Soil | MTTHGISRRDVLRTLAVGVAGGSVLQVIPLEAAELAHQLVHKQ |
Ga0306919_103989832 | 3300031879 | Soil | MANESISRRDILRTLAVGAAGSVLQVIPAEAAEYIHQMVHKEKAASPT |
Ga0318536_106744121 | 3300031893 | Soil | MGISRRDVLKNLAIGAAAGSVLQVIPAEAAALARQMVQKEKAASPAG |
Ga0310910_113871161 | 3300031946 | Soil | MSAYGVSRRDVLKTLAFSAAGGSVLQVIPLEAAEL |
Ga0318545_101733711 | 3300032042 | Soil | VSTDGISRRDVLRTLAIGAAGGSVLQVIPLQAAEM |
Ga0306924_104944832 | 3300032076 | Soil | MGAYGVSRRDVLKTLAFGAAGGSVLQVIPLEAAELAHQMVHKE |
Ga0318540_102782261 | 3300032094 | Soil | MSAYGVSRRDVLKTLAFSAAGGSVLQVIPLEAAELAHQMVHK |
Ga0318540_102972312 | 3300032094 | Soil | MANQSISRRDILRTLAVGAAGSVLQVVPAEAAAYV |
Ga0307470_103055951 | 3300032174 | Hardwood Forest Soil | MPSNPISRRDVLRTLAMGAVGGSVLQVIPLQAAEQVHHM |
Ga0307471_1019617611 | 3300032180 | Hardwood Forest Soil | MPGISRRDVIRNLTVGAAAGSVLQVIPAEAAALVHRM |
Ga0307471_1032873261 | 3300032180 | Hardwood Forest Soil | MPNESISRRDILRTLAVTAAGSVLQIIPAEAAEYVHQMVH |
Ga0307471_1038673321 | 3300032180 | Hardwood Forest Soil | MSRNSVSRRDVLRTLAMGAVGGSVLKLIPLQAAEQVH |
Ga0307472_1026560832 | 3300032205 | Hardwood Forest Soil | MPVNPISRRDILKTLAMGAVGGSVLQVIPAEAAELVHQ |
Ga0335078_119287732 | 3300032805 | Soil | MSKPILPTRRDVLRTLALGASAGSVLRTIPFDAAGQVHHMVRA |
Ga0335080_103141501 | 3300032828 | Soil | MSSLSISRRDILKTLAVSAAGGSVLQVIPAKAAEFAHQAVHSEK |
Ga0335084_114914071 | 3300033004 | Soil | MSSNPISRRDVLRTLAMGAVGGSVLQVIPLQAAEQVHHMVKKEKAA |
Ga0335084_118513621 | 3300033004 | Soil | MPSSPISRRDILRTLAVGAAGGSVLQLIPVQAAAQVHH |
Ga0318519_100724211 | 3300033290 | Soil | MANQSISRRDILRTLAVGAAGSVLQVVPAEAAAYVHQ |
⦗Top⦘ |