Metagenome Family F030765

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F030765
Family Type	Metagenome
Number of Sequences	184
Average Sequence Length	40 residues
Representative Sequence	MDTEQTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ
Number of Associated Samples	101
Number of Associated Scaffolds	184

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	84.24 %
% of genes near scaffold ends (potentially truncated)	7.61 %
% of genes from short scaffolds (< 2000 bps)	59.78 %
Associated GOLD sequencing projects	92
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (64.130 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (20.652 % of family members)
Environment Ontology (ENVO)	Unclassified (51.630 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (54.348 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 184 Family Scaffolds
PF13640	2OG-FeII_Oxy_3	5.98
PF03767	Acid_phosphat_B	2.17
PF00255	GSHPx	2.17
PF05901	Excalibur	2.17
PF06067	DUF932	2.17
PF00166	Cpn10	2.17
PF04973	NMN_transporter	2.17
PF00067	p450	1.63
PF14020	DUF4236	1.63
PF02945	Endonuclease_7	1.09
PF13578	Methyltransf_24	1.09
PF04488	Gly_transf_sug	1.09
PF03796	DnaB_C	1.09
PF12849	PBP_like_2	1.09
PF01844	HNH	1.09
PF07235	DUF1427	0.54
PF00534	Glycos_transf_1	0.54
PF01464	SLT	0.54
PF04860	Phage_portal	0.54
PF00535	Glycos_transf_2	0.54
PF07739	TipAS	0.54
PF00011	HSP20	0.54
PF05050	Methyltransf_21	0.54
PF13155	Toprim_2	0.54
PF00565	SNase	0.54
PF12587	DUF3761	0.54
PF08795	DUF1796	0.54
PF00296	Bac_luciferase	0.54
PF00210	Ferritin	0.54
PF13469	Sulfotransfer_3	0.54
PF00685	Sulfotransfer_1	0.54
PF16861	Carbam_trans_C	0.54
PF07883	Cupin_2	0.54
PF03171	2OG-FeII_Oxy	0.54
PF05257	CHAP	0.54
PF14025	DUF4241	0.54
PF02467	Whib	0.54
PF01391	Collagen	0.54
PF03031	NIF	0.54
PF13419	HAD_2	0.54
PF11397	GlcNAc	0.54

COG ID	Name	Functional Category	% Frequency in 184 Family Scaffolds
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	2.17
COG0386	Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides	Defense mechanisms [V]	2.17
COG2503	Predicted secreted acid phosphatase	General function prediction only [R]	2.17
COG3201	Nicotinamide riboside transporter PnuC	Coenzyme transport and metabolism [H]	2.17
COG3700	Acid phosphatase, class B	Inorganic ion transport and metabolism [P]	2.17
COG2124	Cytochrome P450	Defense mechanisms [V]	1.63
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	1.09
COG1066	DNA repair protein RadA/Sms, contains AAA+ ATPase domain	Replication, recombination and repair [L]	1.09
COG3774	Mannosyltransferase OCH1 or related enzyme	Cell wall/membrane/envelope biogenesis [M]	1.09
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.54
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.54
COG4317	Xanthosine utilization system component, XapX domain	Nucleotide transport and metabolism [F]	0.54
COG5190	TFIIF-interacting CTD phosphatase, includes NLI-interacting factor	Transcription [K]	0.54

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
All Organisms	root	All Organisms	35.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
Viruses	superkingdom	All Organisms → Viruses	29.89 %
cellular organisms	root	All Organisms → cellular organisms	5.98 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	19.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.80 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	2.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	19.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.63 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	1.63 %
unclassified Archaea	no rank	All Organisms → cellular organisms → Archaea → unclassified Archaea	0.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	19.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
Methanomada group	clade	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group	1.63 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.63 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	19.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
Methanobacteria	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria	1.63 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.63 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	17.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
Methanobacteriales	order	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales	1.63 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	1.63 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.54 %
Donellivirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Donellivirus	0.54 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
Aphanizomenonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae	1.63 %
Methanobacteriaceae	family	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae	1.63 %
Donellivirus gee	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Donellivirus → Donellivirus gee	0.54 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.54 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
Aphanizomenon	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon	1.63 %
Methanobrevibacter	genus	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter	1.63 %
Donellivirus gee	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Donellivirus → Donellivirus gee	0.54 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.54 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
unclassified Methanobrevibacter	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter	1.63 %
Aphanizomenon flos-aquae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae	1.63 %
Donellivirus gee	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Donellivirus → Donellivirus gee	0.54 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.54 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	64.13 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.87 %
Aphanizomenon flos-aquae WA102	isolate	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	1.63 %
Methanobrevibacter sp.	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp.	1.63 %
Donellivirus gee	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Donellivirus → Donellivirus gee	0.54 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.54 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.54 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001282\|B570J14230_10026734	Not Available	2070	Open in IMG/M
3300002161\|JGI24766J26685_10031423	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1265	Open in IMG/M
3300002273\|B570J29588_107657	Not Available	617	Open in IMG/M
3300002298\|B570J29599_1003985	Not Available	962	Open in IMG/M
3300002303\|B570J29644_1000002	Not Available	43494	Open in IMG/M
3300002408\|B570J29032_109417435	All Organisms → cellular organisms → Bacteria → Proteobacteria	749	Open in IMG/M
3300002408\|B570J29032_109843227	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp.	1599	Open in IMG/M
3300002470\|metazooDRAFT_1363935	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	771	Open in IMG/M
3300002835\|B570J40625_100060907	Not Available	5171	Open in IMG/M
3300002835\|B570J40625_100073130	Not Available	4521	Open in IMG/M
3300002835\|B570J40625_100078016	All Organisms → Viruses → Predicted Viral	4315	Open in IMG/M
3300002835\|B570J40625_100211478	Not Available	2083	Open in IMG/M
3300002835\|B570J40625_101333168	Not Available	595	Open in IMG/M
3300004054\|Ga0063232_10179086	Not Available	626	Open in IMG/M
3300004096\|Ga0066177_10223749	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	779	Open in IMG/M
3300004112\|Ga0065166_10003268	Not Available	3815	Open in IMG/M
3300004112\|Ga0065166_10114016	Not Available	998	Open in IMG/M
3300004112\|Ga0065166_10234493	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	733	Open in IMG/M
3300004112\|Ga0065166_10406338	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	569	Open in IMG/M
3300004112\|Ga0065166_10465884	Not Available	533	Open in IMG/M
3300004124\|Ga0066178_10050467	All Organisms → Viruses → Predicted Viral	1056	Open in IMG/M
3300004124\|Ga0066178_10081407	Not Available	862	Open in IMG/M
3300005517\|Ga0070374_10060211	All Organisms → Viruses → Predicted Viral	1977	Open in IMG/M
3300005517\|Ga0070374_10244344	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	919	Open in IMG/M
3300005527\|Ga0068876_10136184	All Organisms → Viruses → Predicted Viral	1450	Open in IMG/M
3300005662\|Ga0078894_10083313	All Organisms → Viruses → Predicted Viral	2789	Open in IMG/M
3300005662\|Ga0078894_10403431	Not Available	1235	Open in IMG/M
3300005662\|Ga0078894_10416105	Not Available	1213	Open in IMG/M
3300005662\|Ga0078894_10501882	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1089	Open in IMG/M
3300005662\|Ga0078894_10525924	All Organisms → Viruses → Predicted Viral	1060	Open in IMG/M
3300005662\|Ga0078894_10832058	Not Available	805	Open in IMG/M
3300005662\|Ga0078894_11269606	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	621	Open in IMG/M
3300005662\|Ga0078894_11638724	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	530	Open in IMG/M
3300005662\|Ga0078894_11755599	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	507	Open in IMG/M
3300005805\|Ga0079957_1007210	Not Available	8772	Open in IMG/M
3300005805\|Ga0079957_1010828	Not Available	6865	Open in IMG/M
3300005805\|Ga0079957_1062134	Not Available	2209	Open in IMG/M
3300005805\|Ga0079957_1116789	Not Available	1419	Open in IMG/M
3300005941\|Ga0070743_10004540	Not Available	5050	Open in IMG/M
3300005941\|Ga0070743_10118679	Not Available	885	Open in IMG/M
3300006484\|Ga0070744_10002280	Not Available	5802	Open in IMG/M
3300006484\|Ga0070744_10009756	Not Available	2846	Open in IMG/M
3300006484\|Ga0070744_10014701	Not Available	2321	Open in IMG/M
3300006639\|Ga0079301_1031662	Not Available	1780	Open in IMG/M
3300007545\|Ga0102873_1029306	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1690	Open in IMG/M
3300007547\|Ga0102875_1032913	Not Available	1702	Open in IMG/M
3300007606\|Ga0102923_1130469	Not Available	787	Open in IMG/M
3300007632\|Ga0102894_1144903	Not Available	629	Open in IMG/M
3300008055\|Ga0108970_11242059	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	586	Open in IMG/M
3300008107\|Ga0114340_1003252	Not Available	9174	Open in IMG/M
3300008107\|Ga0114340_1093566	All Organisms → Viruses → Predicted Viral	1215	Open in IMG/M
3300008107\|Ga0114340_1096758	Not Available	2370	Open in IMG/M
3300008108\|Ga0114341_10421603	Not Available	637	Open in IMG/M
3300008110\|Ga0114343_1021331	Not Available	2857	Open in IMG/M
3300008110\|Ga0114343_1129967	Not Available	831	Open in IMG/M
3300008113\|Ga0114346_1138628	Not Available	1056	Open in IMG/M
3300008113\|Ga0114346_1216479	Not Available	748	Open in IMG/M
3300008261\|Ga0114336_1036829	All Organisms → cellular organisms → Bacteria	2651	Open in IMG/M
3300009158\|Ga0114977_10186206	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1223	Open in IMG/M
3300009159\|Ga0114978_10621449	Not Available	622	Open in IMG/M
3300009164\|Ga0114975_10781950	Not Available	501	Open in IMG/M
3300009183\|Ga0114974_10002650	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13751	Open in IMG/M
3300009183\|Ga0114974_10331589	Not Available	887	Open in IMG/M
3300009194\|Ga0114983_1023097	All Organisms → Viruses → Predicted Viral	1623	Open in IMG/M
3300009194\|Ga0114983_1073069	Not Available	778	Open in IMG/M
3300009419\|Ga0114982_1018132	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2367	Open in IMG/M
3300010354\|Ga0129333_10071784	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3216	Open in IMG/M
3300010388\|Ga0136551_1048725	Not Available	773	Open in IMG/M
3300010388\|Ga0136551_1091610	Not Available	533	Open in IMG/M
3300010970\|Ga0137575_10009603	All Organisms → Viruses → Predicted Viral	1686	Open in IMG/M
3300012286\|Ga0157137_100027	Not Available	8749	Open in IMG/M
3300012286\|Ga0157137_102231	Not Available	1552	Open in IMG/M
3300012346\|Ga0157141_1000486	Not Available	11798	Open in IMG/M
3300012352\|Ga0157138_1000018	Not Available	54788	Open in IMG/M
3300012352\|Ga0157138_1023100	Not Available	997	Open in IMG/M
3300012663\|Ga0157203_1029765	Not Available	768	Open in IMG/M
3300012665\|Ga0157210_1010471	Not Available	1641	Open in IMG/M
3300013004\|Ga0164293_10076668	Not Available	2618	Open in IMG/M
3300013004\|Ga0164293_10499330	Not Available	803	Open in IMG/M
3300013005\|Ga0164292_10564174	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	739	Open in IMG/M
3300020048\|Ga0207193_1012993	Not Available	11335	Open in IMG/M
3300020048\|Ga0207193_1013067	Not Available	11287	Open in IMG/M
3300020151\|Ga0211736_10019674	All Organisms → Viruses → Predicted Viral	2787	Open in IMG/M
3300020151\|Ga0211736_10925824	Not Available	40136	Open in IMG/M
3300020159\|Ga0211734_10627824	Not Available	7281	Open in IMG/M
3300020161\|Ga0211726_10500117	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31288	Open in IMG/M
3300020480\|Ga0208201_108752	Not Available	771	Open in IMG/M
3300020494\|Ga0208326_100339	Not Available	3417	Open in IMG/M
3300020498\|Ga0208050_1005989	All Organisms → Viruses → Predicted Viral	1471	Open in IMG/M
3300020501\|Ga0208590_1019126	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	798	Open in IMG/M
3300020506\|Ga0208091_1007763	Not Available	1384	Open in IMG/M
3300020506\|Ga0208091_1029458	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	617	Open in IMG/M
3300020519\|Ga0208223_1001036	Not Available	6285	Open in IMG/M
3300020531\|Ga0208487_1001410	All Organisms → Viruses → Predicted Viral	4620	Open in IMG/M
3300020531\|Ga0208487_1025753	Not Available	698	Open in IMG/M
3300021956\|Ga0213922_1012307	Not Available	2334	Open in IMG/M
3300021961\|Ga0222714_10090190	All Organisms → Viruses → Predicted Viral	1970	Open in IMG/M
3300021962\|Ga0222713_10004228	Not Available	14483	Open in IMG/M
3300021962\|Ga0222713_10014559	Not Available	6853	Open in IMG/M
3300021962\|Ga0222713_10431149	Not Available	804	Open in IMG/M
3300021963\|Ga0222712_10159320	Not Available	1515	Open in IMG/M
3300021963\|Ga0222712_10791513	Not Available	524	Open in IMG/M
3300022200\|Ga0196901_1030351	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2112	Open in IMG/M
3300023174\|Ga0214921_10000295	Not Available	98310	Open in IMG/M
3300023174\|Ga0214921_10001877	Not Available	35173	Open in IMG/M
3300023174\|Ga0214921_10006652	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	15701	Open in IMG/M
3300023174\|Ga0214921_10034705	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4833	Open in IMG/M
3300023174\|Ga0214921_10077856	Not Available	2647	Open in IMG/M
3300024343\|Ga0244777_10186852	Not Available	1333	Open in IMG/M
3300024346\|Ga0244775_10012800	Not Available	7897	Open in IMG/M
3300024346\|Ga0244775_10024338	Not Available	5451	Open in IMG/M
3300024346\|Ga0244775_10096912	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	2509	Open in IMG/M
3300024346\|Ga0244775_10140085	Not Available	2044	Open in IMG/M
3300024346\|Ga0244775_10192070	Not Available	1715	Open in IMG/M
3300024346\|Ga0244775_10289252	All Organisms → Viruses → Predicted Viral	1360	Open in IMG/M
3300024346\|Ga0244775_10809212	Not Available	749	Open in IMG/M
3300024348\|Ga0244776_10000326	Not Available	55326	Open in IMG/M
3300024348\|Ga0244776_10213843	All Organisms → Viruses → Predicted Viral	1363	Open in IMG/M
3300025091\|Ga0209616_1015869	Not Available	766	Open in IMG/M
3300027114\|Ga0208009_1007521	All Organisms → Viruses → Predicted Viral	2794	Open in IMG/M
3300027499\|Ga0208788_1025466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Donellivirus → Donellivirus gee	1811	Open in IMG/M
3300027499\|Ga0208788_1151194	Not Available	507	Open in IMG/M
3300027710\|Ga0209599_10000020	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	124368	Open in IMG/M
3300027710\|Ga0209599_10000044	Not Available	87910	Open in IMG/M
3300027710\|Ga0209599_10000200	Not Available	42280	Open in IMG/M
3300027710\|Ga0209599_10001755	Not Available	9737	Open in IMG/M
3300027710\|Ga0209599_10003682	Not Available	5808	Open in IMG/M
3300027710\|Ga0209599_10016544	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2131	Open in IMG/M
3300027759\|Ga0209296_1002329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13728	Open in IMG/M
3300027759\|Ga0209296_1014049	All Organisms → cellular organisms → Bacteria	4709	Open in IMG/M
3300027759\|Ga0209296_1116378	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1252	Open in IMG/M
3300027797\|Ga0209107_10081930	Not Available	1758	Open in IMG/M
3300027805\|Ga0209229_10013656	All Organisms → Viruses → Predicted Viral	3455	Open in IMG/M
3300027805\|Ga0209229_10060070	All Organisms → Viruses → Predicted Viral	1699	Open in IMG/M
3300027805\|Ga0209229_10141519	Not Available	1084	Open in IMG/M
3300027805\|Ga0209229_10186403	Not Available	930	Open in IMG/M
3300027805\|Ga0209229_10218765	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	851	Open in IMG/M
3300027805\|Ga0209229_10380240	Not Available	615	Open in IMG/M
3300027805\|Ga0209229_10410838	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	586	Open in IMG/M
3300027892\|Ga0209550_10115840	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1974	Open in IMG/M
3300027892\|Ga0209550_10382976	Not Available	876	Open in IMG/M
3300027892\|Ga0209550_10585222	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	657	Open in IMG/M
3300028025\|Ga0247723_1000055	Not Available	64365	Open in IMG/M
3300028025\|Ga0247723_1023874	Not Available	2018	Open in IMG/M
3300028025\|Ga0247723_1052302	Not Available	1163	Open in IMG/M
3300028025\|Ga0247723_1074063	Not Available	910	Open in IMG/M
3300028027\|Ga0247722_10131422	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	910	Open in IMG/M
3300029349\|Ga0238435_113808	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	697	Open in IMG/M
3300031784\|Ga0315899_11132936	Not Available	684	Open in IMG/M
3300031857\|Ga0315909_10556146	Not Available	778	Open in IMG/M
3300031857\|Ga0315909_10950969	Not Available	524	Open in IMG/M
3300031963\|Ga0315901_11218391	Not Available	509	Open in IMG/M
3300032092\|Ga0315905_10007888	Not Available	10760	Open in IMG/M
3300032092\|Ga0315905_10444006	Not Available	1208	Open in IMG/M
3300033816\|Ga0334980_0000095	Not Available	41955	Open in IMG/M
3300033978\|Ga0334977_0002020	Not Available	11819	Open in IMG/M
3300033978\|Ga0334977_0272484	Not Available	824	Open in IMG/M
3300033980\|Ga0334981_0245573	Not Available	813	Open in IMG/M
3300033992\|Ga0334992_0076639	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp.	1830	Open in IMG/M
3300033992\|Ga0334992_0365648	Not Available	657	Open in IMG/M
3300033993\|Ga0334994_0422281	Not Available	639	Open in IMG/M
3300033994\|Ga0334996_0062373	Not Available	2274	Open in IMG/M
3300033994\|Ga0334996_0072347	Not Available	2073	Open in IMG/M
3300033995\|Ga0335003_0172036	All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp.	1060	Open in IMG/M
3300034012\|Ga0334986_0445659	Not Available	648	Open in IMG/M
3300034018\|Ga0334985_0004747	Not Available	10993	Open in IMG/M
3300034019\|Ga0334998_0698561	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	541	Open in IMG/M
3300034021\|Ga0335004_0083311	Not Available	2172	Open in IMG/M
3300034022\|Ga0335005_0274243	Not Available	1013	Open in IMG/M
3300034061\|Ga0334987_0598008	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300034062\|Ga0334995_0198922	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1395	Open in IMG/M
3300034062\|Ga0334995_0472370	Not Available	763	Open in IMG/M
3300034066\|Ga0335019_0002801	Not Available	11572	Open in IMG/M
3300034066\|Ga0335019_0014836	Not Available	5361	Open in IMG/M
3300034066\|Ga0335019_0162396	All Organisms → Viruses → Predicted Viral	1465	Open in IMG/M
3300034066\|Ga0335019_0268646	Not Available	1080	Open in IMG/M
3300034082\|Ga0335020_0000032	Not Available	111384	Open in IMG/M
3300034093\|Ga0335012_0306478	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	804	Open in IMG/M
3300034102\|Ga0335029_0448639	Not Available	764	Open in IMG/M
3300034102\|Ga0335029_0531360	Not Available	675	Open in IMG/M
3300034111\|Ga0335063_0013601	Not Available	5226	Open in IMG/M
3300034111\|Ga0335063_0063794	All Organisms → Viruses → Predicted Viral	2297	Open in IMG/M
3300034118\|Ga0335053_0187658	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1368	Open in IMG/M
3300034283\|Ga0335007_0000360	Not Available	34438	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.46%
Host-Associated	Host-Associated	0.54%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	89.67%
Terrestrial	Environmental → Terrestrial	9.78%
Plants	Host-Associated → Plants	0.54%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	75.00%
Marine	Environmental → Aquatic → Marine	14.67%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	9.78%
Leaf	Host-Associated → Plants → Leaf	0.54%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	35.87%
Lentic	Environmental → Aquatic → Freshwater → Lentic	29.35%
Unclassified	Environmental → Aquatic → Marine → Unclassified	9.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	9.78%
Lotic	Environmental → Aquatic → Freshwater → Lotic	3.80%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	3.80%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.80%
Pond	Environmental → Aquatic → Freshwater → Pond	1.63%
Coastal	Environmental → Aquatic → Marine → Coastal	1.09%
Creek	Environmental → Aquatic → Freshwater → Creek	0.54%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.54%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	34.78%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	18.48%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	10.33%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	9.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	9.78%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	3.80%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	3.80%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	3.80%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	1.63%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.09%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.09%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.54%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.54%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.54%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	20.65%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	13.04%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	9.78%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	7.07%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	6.52%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	4.89%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	4.35%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	4.35%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	3.80%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	3.80%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	3.26%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	3.26%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.72%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	2.72%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	2.17%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	1.63%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.09%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	1.09%
Lake	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake	0.54%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.54%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.54%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.54%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.54%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.54%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.54%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300002273	Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion	Environmental	Open in IMG/M
3300002298	Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion	Environmental	Open in IMG/M
3300002303	Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002470	Freshwater microbial communities from San Paulo Zoo lake, Brazil - FEB 2013	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300004054	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)	Environmental	Open in IMG/M
3300004096	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)	Environmental	Open in IMG/M
3300004112	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)	Environmental	Open in IMG/M
3300004124	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300005941	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300007545	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3	Environmental	Open in IMG/M
3300007547	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02	Environmental	Open in IMG/M
3300007606	Estuarine microbial communities from the Columbia River estuary - metaG 1569-02	Environmental	Open in IMG/M
3300007632	Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009194	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010388	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015	Environmental	Open in IMG/M
3300010970	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016	Environmental	Open in IMG/M
3300012286	Freshwater microbial communities from Ausable River, Ontario, Canada - S47	Environmental	Open in IMG/M
3300012346	Freshwater microbial communities from Emily Creek, Ontario, Canada - S29	Environmental	Open in IMG/M
3300012352	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020480	Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020494	Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020498	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020501	Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020519	Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020531	Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021956	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022200	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300025091	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes)	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027499	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028027	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC	Environmental	Open in IMG/M
3300029349	Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033980	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300033995	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental	Open in IMG/M
3300034021	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034111	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J14230_100267342	3300001282	Freshwater	MSAVVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ*
JGI24766J26685_100314232	3300002161	Freshwater And Sediment	MNEAEFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ*
B570J29588_1076571	3300002273	Freshwater	VDTEQTFDQEFSVEEITNAIVNQAKAEVKSKFGNKKRHRQ*
B570J29599_10039852	3300002298	Freshwater	VDTEETFDQEFTVEDITNAIVEQAKAEVKARYGNKKRHRQ*
B570J29644_10000022	3300002303	Freshwater	VDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ*
B570J29032_1094174352	3300002408	Freshwater	MDTEEEFNLEDITNAIVNQAKADVKSRYGNKKRHRQ*
B570J29032_1098432272	3300002408	Freshwater	MSALVDTEQTFDQEFTVEDITKAIVNQARADVKSKFGNKKRHRQ*
metazooDRAFT_13639353	3300002470	Lake	VNEAQFDEEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ*
B570J40625_1000609075	3300002835	Freshwater	VDTEQAFDQEFSVEEITNAIVNQAEAEVKSKFGNKKRHRQ*
B570J40625_1000731302	3300002835	Freshwater	MDTEQNFDQEFSVEDITNAIVNQAKAEVKSRFGNKKRHRQ*
B570J40625_10007801613	3300002835	Freshwater	VDTEQTFDQEFTVEEITKAIVDQAKADIKAKFGNRKRHRQ*
B570J40625_1002114783	3300002835	Freshwater	MDTEESFDQEFSIEDITKAIVDQAKAEIKSKYGNKKRHRQ*
B570J40625_1013331681	3300002835	Freshwater	MDTEQTFDQEFTVEEITKAIVDQAKSDVKAKYGNKKRHRQ*
Ga0063232_101790863	3300004054	Freshwater Lake	VNEAEFDQEFNLEDITNAIVNQAKSEVKSKFGNKKRHRQ*
Ga0066177_102237492	3300004096	Freshwater Lake	MNEAEFDQEFNVEDITNAIVNQAKADVKSKFGNKKRHRQ*
Ga0065166_100032687	3300004112	Freshwater Lake	MNEQQFDEEFNVDLLTQSIVEKAKAEVKSRYGNKKRHRQ*
Ga0065166_101140162	3300004112	Freshwater Lake	VDTEQTFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ*
Ga0065166_102344932	3300004112	Freshwater Lake	MNEQQFDDEFNVDLITKLIVDKAKAEVKSIYGNKKRHRQ*
Ga0065166_104063382	3300004112	Freshwater Lake	MNEAQFDEEFNVEDITNAIVNQAKAEVKSKFGNKKRHRQ*
Ga0065166_104658842	3300004112	Freshwater Lake	MNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ*
Ga0066178_100504672	3300004124	Freshwater Lake	MNEQQFDDEFNVEVLTQSIVDKAKAEVKARYGNKKRHRQ*
Ga0066178_100814072	3300004124	Freshwater Lake	MDTEQTFDQEFKVEEAVRVIVEKAKADVKARYGNKKRHRQ*
Ga0070374_100602118	3300005517	Freshwater Lake	MNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKR
Ga0070374_102443442	3300005517	Freshwater Lake	MNEQQFDDEFNVDVLTQSIVDKAKAEVKARYGNKKRHRQ*
Ga0068876_101361841	3300005527	Freshwater Lake	QEMSAVVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ*
Ga0078894_100833131	3300005662	Freshwater Lake	MDTEQTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ*
Ga0078894_104034314	3300005662	Freshwater Lake	MDTEQTFDQEFSVEEITKAIVDQAKADIKARFGNKKRHRQ*
Ga0078894_104161055	3300005662	Freshwater Lake	MDTEEEFNLEDITNAIVNQAKADVKSKFGNKKRHRQ*
Ga0078894_105018823	3300005662	Freshwater Lake	MNEAEFDQEFSVEEITKIIVDNAKAEVKAKFGNKKRHRQ*
Ga0078894_105259243	3300005662	Freshwater Lake	MDTEETFDQEFSVEDITNAIVNQAKAEVRSKFGNKKRHRQ*
Ga0078894_108320584	3300005662	Freshwater Lake	VDTEQASDQEFSVEEITNAIVNQAKADVKSKFGNKKRHRQ*
Ga0078894_112696061	3300005662	Freshwater Lake	MNEQQFDDEFNVEVIAQSIVDKAKAEVKARYGNKKRHRQ*
Ga0078894_116387242	3300005662	Freshwater Lake	MNEAQFDEEFNLEDITNAIVNQAKAKVKSKFGNKKRHRQ*
Ga0078894_117555991	3300005662	Freshwater Lake	MNEAEFDQEFSVEEITKIIVDNAKAQVKAKYGNKRRHRQ*
Ga0079957_100721018	3300005805	Lake	VDTEKQFDQEFSIEDITNAIVNQAKADIKAKFGNKKRHRQ*
Ga0079957_101082811	3300005805	Lake	MNEAEFDQEFTVEEITKAIVDQAKAEVKSRFGNKKRHRQ*
Ga0079957_10621345	3300005805	Lake	MNEAQFDEEFSVEDITNAIVNQAKADVKAKFGNKKRHRQ*
Ga0079957_11167892	3300005805	Lake	MNEAEFDQEFTVEEITKAIVDKAKADIRAKFGNKKRHRQ*
Ga0070743_100045402	3300005941	Estuarine	MDTEKTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ*
Ga0070743_101186793	3300005941	Estuarine	MDTEQTFDQEFSVEDIANAIVEQAKSDIKSRYGNKKRHRQY*
Ga0070744_1000228014	3300006484	Estuarine	VNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ*
Ga0070744_100097568	3300006484	Estuarine	MNEAQFDEEFNVEEIANAIVNQAKADVKSRFGNKKRHRQ*
Ga0070744_100147016	3300006484	Estuarine	VDTEQTFDKEFNVEEIAQAILEKAKAEVKGRYGNKKRHRQ*
Ga0079301_10316624	3300006639	Deep Subsurface	VNEAEFDQEFNLEDITNAIVNQAKADVKSKFGNKKRHRQ*
Ga0102873_10293067	3300007545	Estuarine	MNEAEFDQEFSVEDITKAIVDQAKAEVKSRFGNKKRHRQ*
Ga0102875_10329134	3300007547	Estuarine	MSAWVDTEQTFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ*
Ga0102923_11304692	3300007606	Estuarine	MDTEQQFDAEFSVEDITKAIVDQAKAEVKSRFGNKKRHRQ*
Ga0102894_11449033	3300007632	Estuarine	MDTEQTFDQEFSVEEITKAIVDQAKADIKSRFGNKKRHRQY*
Ga0108970_112420591	3300008055	Estuary	MNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNRKRHRQ*
Ga0114340_10032525	3300008107	Freshwater, Plankton	MDTEQTFDQEFSVEEITKAIVDQAKADVKSRYGNKKRHRQ*
Ga0114340_10935664	3300008107	Freshwater, Plankton	MNEAQFDEEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ*
Ga0114340_10967584	3300008107	Freshwater, Plankton	MDTEQTFDQEFSVEEITNAIVNQAKAEVKSRYGNKKRHRQ*
Ga0114341_104216032	3300008108	Freshwater, Plankton	MDTEQTFDQEFSVEEITNAILNQAKAEVKSKFGNKKRHRQ*
Ga0114343_10213314	3300008110	Freshwater, Plankton	MDTEQTFDQEFTVEDITNAIVNQAKADVKAKFGNKKRHRQ*
Ga0114343_11299672	3300008110	Freshwater, Plankton	MDTEQTFDEEFSVEDITNAIVSQAKSEVKAKYGNKKRHRQ*
Ga0114346_11386283	3300008113	Freshwater, Plankton	MDTEQTFDEEFSVEDITNAIVNQAKSEVKAKYGNKKRHRQ*
Ga0114346_12164791	3300008113	Freshwater, Plankton	MDTEKTFDEEFSVEDITNAIVSQAKSEVKAKYGNKKRHRQ*
Ga0114336_10368295	3300008261	Freshwater, Plankton	VDTEQTFDQEFSVEEITKAIVEQAKAQVKSRYGNRKRHRQ*
Ga0114977_101862061	3300009158	Freshwater Lake	MDTEQTFDQEFTVEEITKAIVDQAKSDIKAKYGNKKRHRQ*
Ga0114978_106214493	3300009159	Freshwater Lake	MDTEETFDQEFTVKEITKAIVDQAKSDVKAKYGNKKRHRQ*
Ga0114975_107819502	3300009164	Freshwater Lake	MDTEETFDQKFTVEEITKAIVDQARSDVKAKYGNRKRHRQ*
Ga0114974_1000265041	3300009183	Freshwater Lake	MDTEKSFDKEFDVEETTKVIVDKAKAEVRSRYGNKKRHRQ*
Ga0114974_103315891	3300009183	Freshwater Lake	MDTEQTFDQEFTVEEITKAIVDQAKSDVKAKYGNRKRHRQ*
Ga0114983_10230974	3300009194	Deep Subsurface	MDTEQTFDQEFDVKETTKAIVDKAKAEVKAKYGNKKRHRQ*
Ga0114983_10730691	3300009194	Deep Subsurface	MDTEQTFDQEFSVEEITKAIVDRAKSEVKSKFGNKKRHRQ*
Ga0114982_10181323	3300009419	Deep Subsurface	MNEQQFDEEFNVDVLTQSIVEKAKAEVKSRYGNKKRHRQ*
Ga0129333_1007178411	3300010354	Freshwater To Marine Saline Gradient	MNEAEFDQEFNLEDITNAIVNQAKSEVKSKFGNKKRHRQ*
Ga0136551_10487251	3300010388	Pond Fresh Water	VNSVEFDKEFDLEYILKLSQEITDKAKAEVKAKYGNKKRHRQ*
Ga0136551_10916101	3300010388	Pond Fresh Water	VNEKQFDDEFNLEQLTKAIVDKAKADIKAKYGKKKRHRQ*
Ga0137575_100096031	3300010970	Pond Fresh Water	MNEAQFDEEFNVEDITNAIVNQAKAEVKSKFGNKKR
Ga0157137_1000273	3300012286	Freshwater	MNEKQFDEEFDLEETTKRIVDRAKAEVKNRYGNKKRHRQ*
Ga0157137_1022312	3300012286	Freshwater	MNEQQFDEEFDLEETTKLIVAKAKAEVKSIYGNKKRHRQ*
Ga0157141_100048612	3300012346	Freshwater	VNEQEFDEEFDLESTTKAIVDKAKAEVKSRYGNKKRHRQ*
Ga0157138_100001830	3300012352	Freshwater	VKESEFDEEFDLEATTKAIVEKAKAEVKSKYGNKKRHRQ*
Ga0157138_10231001	3300012352	Freshwater	MSASMDTEQQFDQEFSVEEITNAIVNQAKADIKAKFGNKKRHRQ*
Ga0157203_10297651	3300012663	Freshwater	MNEAEFDKEFNLEEITRTIIDKAKAEVKSKYGNKKRHRQ*
Ga0157210_10104711	3300012665	Freshwater	MDTEQTFDQKFSVEEITKAIVDKAKAEVKTKFGNKKRHRQ*
Ga0164293_100766683	3300013004	Freshwater	MDNEKEFNVEDITNAIVNQAKAEVKAKFGNKKRHRQ*
Ga0164293_104993303	3300013004	Freshwater	MNEAEFDQEFTVEEITKAIVDQAKSDIKAKFGNKKRHRQ*
Ga0164292_105641742	3300013005	Freshwater	MDTEEEFNLEDITNAIVNQAKAEVKSKFGNKKRHKQ*
Ga0207193_101299313	3300020048	Freshwater Lake Sediment	MDTEEEFNLEDITNAIVNQAKAEVKSKYGNKKRHRQ
Ga0207193_10130676	3300020048	Freshwater Lake Sediment	MDTEKTFDQEFSIEDITNAIVNQAKAEVKASFGNKKRHRQY
Ga0211736_100196748	3300020151	Freshwater	MNEEDFDKEFNLEEITNAIVNQAKADVKSKFGNKKRHRQ
Ga0211736_1092582475	3300020151	Freshwater	MDTEKQFDQEFDLEEITKAIVDQAKSDVKSRFGNKKRHRQ
Ga0211734_106278248	3300020159	Freshwater	MDTEQTFDQEFTVEDITNAIVNQAKADVKAKFGNKKRHRQ
Ga0211726_1050011744	3300020161	Freshwater	MDTEKQFDQEFNIEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0208201_1087522	3300020480	Freshwater	MDTEQTFDQEFNLEDITNAIVNQAKAEVKARFGNKKRHRQ
Ga0208326_1003399	3300020494	Freshwater	MSAVVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ
Ga0208050_10059894	3300020498	Freshwater	MDTEEEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0208590_10191261	3300020501	Freshwater	EQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ
Ga0208091_10077632	3300020506	Freshwater	VDTEETFDQEFTVEDITNAIVEQAKAEVKARYGNKKRHRQ
Ga0208091_10294582	3300020506	Freshwater	MDTEEEFNLEDITNAIVNQAKADVKSRYGNKKRHRQ
Ga0208223_10010364	3300020519	Freshwater	VDTEQTFDQEFTVEEITKAIVDQAKADIKAKFGNRKRHRQ
Ga0208487_100141016	3300020531	Freshwater	VDTEQTFDQEFSVEEITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0208487_10257532	3300020531	Freshwater	VDTEQAFDQEFSVEEITNAIVNQAEAEVKSKFGNKKRHRQ
Ga0213922_10123072	3300021956	Freshwater	MNEAEFDQEFSVEEITKAIVEQAKAEVKSRFGNKKRHRQ
Ga0222714_100901906	3300021961	Estuarine Water	VVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ
Ga0222713_100042288	3300021962	Estuarine Water	MNEAQFDEEFNVEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0222713_100145596	3300021962	Estuarine Water	MSAWVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKIHRQ
Ga0222713_104311494	3300021962	Estuarine Water	VDTEQTFDQEFTVEELTKIIVDQAKAEVKSKFGNKKRHRQ
Ga0222712_101593202	3300021963	Estuarine Water	MNEAEFDQEFNLEDITNAIVNKAKDEVKSKFGNKKRHRQ
Ga0222712_107915133	3300021963	Estuarine Water	MNEKQFDEEFDLEETTKRIVDKAKAEVKSRYGNKKRHRQ
Ga0196901_10303512	3300022200	Aqueous	MDTEQTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0214921_10000295105	3300023174	Freshwater	MNEAEFDQEFDVEDITNAIVNQAKADVKSKFGNKKRHRQ
Ga0214921_100018774	3300023174	Freshwater	MNEAEFDKEFDLEEITRTIIDKAKAEVKSKYGNKKRHRQ
Ga0214921_1000665218	3300023174	Freshwater	MDTEQTFDQEFTVEEITKAIVNQAKSDIKAKYGNKKRHRQ
Ga0214921_1003470511	3300023174	Freshwater	MNEAEFDEEFNLVATTKAIVDKAKSEVKSRYGNKKRHRQ
Ga0214921_100778564	3300023174	Freshwater	MNEAEFDKEFNLEEITKIIVDKAKVEVKSKYGNKKRHRQ
Ga0244777_101868524	3300024343	Estuarine	MSAWVDTEQTFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ
Ga0244775_1001280012	3300024346	Estuarine	MNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0244775_100243386	3300024346	Estuarine	MDTEKTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0244775_100969122	3300024346	Estuarine	MNEAQFDEEFNVEEIANAIVNQAKADVKSRFGNKKRHRQ
Ga0244775_101400855	3300024346	Estuarine	VDTEQTFDKEFNVEEIAQAILEKAKAEVKGRYGNKKRHRQ
Ga0244775_101920706	3300024346	Estuarine	MDTEQTFDQEFSVEDIANAIVEQAKSDIKSRYGNKKRHRQY
Ga0244775_102892524	3300024346	Estuarine	MNEAEFDQEFNLEDITNAIVNQAKADVKTKFGNKKRHRQ
Ga0244775_108092121	3300024346	Estuarine	MNEAQFDEEFSVEDITNAIVNQAKAEVKSKFGNKKR
Ga0244776_1000032685	3300024348	Estuarine	MNEAEFDQEFSVEDITKAIVDQAKAEVKSRFGNKKRHRQ
Ga0244776_102138432	3300024348	Estuarine	MDTEQTFDQEFSVEEITKAIVDQAKADIKSRFGNKKRHRQY
Ga0209616_10158694	3300025091	Freshwater	MDTEQTFDQEFTVEEITKAIVDKAKSEVKSKYGNKKRHRQ
Ga0208009_100752112	3300027114	Deep Subsurface	VNEAEFDQEFNLEDITNAIVNQAKADVKSKFGNKKRHR
Ga0208788_10254663	3300027499	Deep Subsurface	VNEAEFDQEFNLEDITNAIVNQAKADVKSKFGNKKRHRQ
Ga0208788_11511941	3300027499	Deep Subsurface	DKGTKVNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0209599_10000020164	3300027710	Deep Subsurface	MDTEQTFDQEFSVEEITKAIVDRAKSEVKSKFGNKKRHRQ
Ga0209599_10000044123	3300027710	Deep Subsurface	MDTEQTFDQEFDVKETTKAIVDKAKAEVKAKYGNKKRHRQ
Ga0209599_100002008	3300027710	Deep Subsurface	MDTEQTFDQEFSVEEITKAIVDQAKADVKSRYGNKKRHRQ
Ga0209599_1000175520	3300027710	Deep Subsurface	MDTEQTFDQEFSVEEITNAILNQAKAEVKSKFGNKKRHRQ
Ga0209599_100036824	3300027710	Deep Subsurface	MDTEQTFDEEFSVEDITNAIVNQAKSEVKAKYGNKKRHRQ
Ga0209599_100165444	3300027710	Deep Subsurface	MNEQQFDEEFNVDVLTQSIVEKAKAEVKSRYGNKKRHRQ
Ga0209296_100232940	3300027759	Freshwater Lake	MDTEKSFDKEFDVEETTKVIVDKAKAEVRSRYGNKKRHRQ
Ga0209296_10140497	3300027759	Freshwater Lake	MDTEETFDQKFTVEEITKAIVDQARSDVKAKYGNRKRHRQ
Ga0209296_11163784	3300027759	Freshwater Lake	MDTEQTFDQEFTVEEITKAIVDQAKSDIKAKYGNKKRHRQ
Ga0209107_100819305	3300027797	Freshwater And Sediment	MDNEQEFNVEDITNAIVNQAKAEVKAKFGNKKRHRQ
Ga0209229_100136566	3300027805	Freshwater And Sediment	MNEAQFDEEFSVEDITNAIVNQAKADVKAKFGNKKRHRQ
Ga0209229_100600704	3300027805	Freshwater And Sediment	MNEAEFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ
Ga0209229_101415191	3300027805	Freshwater And Sediment	VDTEQTFDQEFSVEEITNAIVNQAKSEVKTKFGNKKRHRQY
Ga0209229_101864033	3300027805	Freshwater And Sediment	MNEAQFDEEFNVEDITNAIVNQAKADIKAKFGNKKRHRQ
Ga0209229_102187651	3300027805	Freshwater And Sediment	MTNSEQTFDQEFSVEDITNAIVDQAKAEVKARYGNKKRHRQ
Ga0209229_103802401	3300027805	Freshwater And Sediment	MNEAQFDEEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0209229_104108382	3300027805	Freshwater And Sediment	MNEAEFDKEFDLDAKTKEIVDKAKAEVKARYGNKKRHRQ
Ga0209550_101158405	3300027892	Freshwater Lake	MNEQQFDDEFNVDVLTQSIVDKAKAEVKARYGNKKRHRQ
Ga0209550_103829764	3300027892	Freshwater Lake	MDTEQTFDQEFKVEEITKAIVDQAKAEVKARYGNKKRHRQXENAL
Ga0209550_105852223	3300027892	Freshwater Lake	MNEAEFDQEFNVEDITNAIVNQAKADVKSKFGNKKRHRQ
Ga0247723_100005579	3300028025	Deep Subsurface Sediment	VDTEQTFDQEFTVEDITKAIVEQAKAEVKSRYGNKKRHRQ
Ga0247723_10238744	3300028025	Deep Subsurface Sediment	MDTEQTFDQEFSVEEITNAIVDQAKADVKSKYGNKKRHRQ
Ga0247723_10523024	3300028025	Deep Subsurface Sediment	MNEAEFDEEFSVEDITNAIVNQANAEVKSKFGNKKRHRQ
Ga0247723_10740631	3300028025	Deep Subsurface Sediment	MDTEQTFDEEFSVEDITNAIVNQAKSQVKAKYGNKKRHRQXILSEI
Ga0247722_101314222	3300028027	Deep Subsurface Sediment	MNEQQFDKEFNVEILTQSIVEKAKAEVKSRYGNKKRHRQ
Ga0238435_1138082	3300029349	Freshwater	MDTEQTFDQEFSVEEITKAIVDNAKAEVKSRYGNKKRHRQ
Ga0315899_111329363	3300031784	Freshwater	TEQTFDKEFNVEEIAQAILEKAKAEVKGRYGNKKRHRQ
Ga0315909_105561464	3300031857	Freshwater	MDTEQTFDQEFSVEEITNAIVNQAKAEVKSRYGNKK
Ga0315909_109509692	3300031857	Freshwater	MDTEQTFDEEFSVEDITNAIVNQAKSQVKAKYGNKKRHRQXILLEI
Ga0315901_112183911	3300031963	Freshwater	MDTEQTFDEEFSVEDITNAIVSQAKSEVKAKYGNKKRHRQXILSET
Ga0315905_100078887	3300032092	Freshwater	MDSEQEFDNEFSIDDITKAIVDQAKSEVKSRYGNKKRHRQ
Ga0315905_104440064	3300032092	Freshwater	MNEAEFDQEFNLEDITNAIVNQAKADIKAKFGNKKRHRQ
Ga0334980_0000095_22754_22876	3300033816	Freshwater	MDTEQNFDQEFSVEDITNAIVNQAKAEVKSRFGNKKRHRQ
Ga0334977_0002020_411_530	3300033978	Freshwater	MNEAEFDQEFSVEEITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0334977_0272484_266_385	3300033978	Freshwater	MNEAEFDQEFTVEEITKAIVDKAKADIKAKFGNKKRHRQ
Ga0334981_0245573_451_561	3300033980	Freshwater	MDTEEEFNLEDITNAIVNQAKADVKSKFGNKKRHRQ
Ga0334992_0076639_1714_1830	3300033992	Freshwater	TEQTFDQEFTVEDITKAIVNQARADVKSKFGNKKRHRQ
Ga0334992_0365648_390_512	3300033992	Freshwater	MDTEQTFDQEFTVEEITKAIVDQAKSDVKAKYGNKKRHRQ
Ga0334994_0422281_286_396	3300033993	Freshwater	MDNEKEFNVEDITNAIVNQAKAEVKAKFGNKKRHRQ
Ga0334996_0062373_515_649	3300033994	Freshwater	MNAQMDTEQAFDQEFNLEDITKAIVDQAKAEVKSKYGNKKRHRQ
Ga0334996_0072347_1096_1209	3300033994	Freshwater	MDTEEEFNVEDITNAIVNQAKAEVKSKLGNKKRHRQW
Ga0335003_0172036_1_129	3300033995	Freshwater	ALVDTEQTFDQEFNVEDITKAIVNQARADVKSKFGNKKRHRQ
Ga0334986_0445659_51_170	3300034012	Freshwater	MNEAEFDQEFTVEEITKAIVDQAKSDIKAKFGNKKRHRQ
Ga0334985_0004747_5708_5842	3300034018	Freshwater	MSALVDTEQTFDQEFTVEDITKAIVNQARADVKSKFGNKKRHRQ
Ga0334998_0698561_423_539	3300034019	Freshwater	TEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ
Ga0335004_0083311_1283_1417	3300034021	Freshwater	MSAVVDTEQAFDQEFTVEELTKIIVDQAKAEVKSKFGNKKRHRQ
Ga0335005_0274243_489_608	3300034022	Freshwater	MNEAEFDQEFSVEEITKAIVNQAKAEVKSKFGNKKRHRQ
Ga0334987_0598008_19_138	3300034061	Freshwater	MNEAEFDQEFTVEDITKTIVDNAKAEVKSKFGNRKRHRQ
Ga0334995_0198922_597_716	3300034062	Freshwater	MNEQQFDEEFNVEILTQSIVEKAKAEVKSRYGNKKRHRQ
Ga0334995_0472370_213_326	3300034062	Freshwater	MDTEKDFNLEDITNAIVNQAKAEVKSKFGNKKRHRQW
Ga0335019_0002801_10777_10899	3300034066	Freshwater	VDTEQTFDQEFSVEEITKAIVNQAKAEVKSKFGNKKRHRQ
Ga0335019_0014836_798_920	3300034066	Freshwater	MDTEQTFDQEFTVEEITKAIVDQARSDVKAKYGNKKRHRQ
Ga0335019_0162396_1325_1447	3300034066	Freshwater	VDTEKTFDQEFSVEEITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0335019_0268646_206_328	3300034066	Freshwater	VDTEQAFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0335020_0000032_23958_24077	3300034082	Freshwater	MNESEFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0335012_0306478_281_400	3300034093	Freshwater	MKEAEFDQEFTVEEITKAIVDQAKADIKAKFGNKKRHRQ
Ga0335029_0448639_505_627	3300034102	Freshwater	MDTEQTFDQEFSVEDITNAIVDKAKAEVKARYGNKKRHRQ
Ga0335029_0531360_421_543	3300034102	Freshwater	VDTEQTFDEEFSVEDITNAIVNQAKAEVKARFGNKKRHRQ
Ga0335063_0013601_961_1083	3300034111	Freshwater	MDTEQTFDQEFNVTETTKAIVDKAKAEVKAKYGNKKRHRQ
Ga0335063_0063794_82_204	3300034111	Freshwater	MDTEQTFDQEFTIEEITKAIVDQAKSDVKAKYGNKKRHRQ
Ga0335053_0187658_1057_1167	3300034118	Freshwater	MDTEEKFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ
Ga0335007_0000360_9597_9707	3300034283	Freshwater	MDTEEDFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F030765

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences