


| Basic Information | |
|---|---|
| Family ID | F030602 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 185 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTE |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 185 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 89.19 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.78 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.649 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.838 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.216 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (37.297 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 185 Family Scaffolds |
|---|---|---|
| PF13640 | 2OG-FeII_Oxy_3 | 9.19 |
| PF10263 | SprT-like | 3.78 |
| PF13884 | Peptidase_S74 | 3.24 |
| PF13385 | Laminin_G_3 | 1.08 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.08 |
| PF01521 | Fe-S_biosyn | 0.54 |
| PF00550 | PP-binding | 0.54 |
| PF00487 | FA_desaturase | 0.54 |
| PF16778 | Phage_tail_APC | 0.54 |
| PF09636 | XkdW | 0.54 |
| PF07120 | DUF1376 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 185 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.54 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.54 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.54 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.35 % |
| Unclassified | root | N/A | 48.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10131499 | Not Available | 959 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_110064145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300001450|JGI24006J15134_10075093 | Not Available | 1283 | Open in IMG/M |
| 3300001450|JGI24006J15134_10145207 | Not Available | 785 | Open in IMG/M |
| 3300001460|JGI24003J15210_10050002 | All Organisms → Viruses | 1399 | Open in IMG/M |
| 3300005069|Ga0071350_1018767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1715 | Open in IMG/M |
| 3300005346|Ga0074242_11176806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1471 | Open in IMG/M |
| 3300005528|Ga0068872_10698393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 532 | Open in IMG/M |
| 3300005581|Ga0049081_10146043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300005583|Ga0049085_10021039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2471 | Open in IMG/M |
| 3300005662|Ga0078894_10682399 | Not Available | 908 | Open in IMG/M |
| 3300005913|Ga0075108_10013065 | All Organisms → Viruses → Predicted Viral | 3261 | Open in IMG/M |
| 3300006639|Ga0079301_1230475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300006802|Ga0070749_10297020 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300006867|Ga0075476_10063948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1464 | Open in IMG/M |
| 3300006874|Ga0075475_10290659 | Not Available | 676 | Open in IMG/M |
| 3300006916|Ga0070750_10351514 | Not Available | 622 | Open in IMG/M |
| 3300006990|Ga0098046_1045935 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300007276|Ga0070747_1246371 | Not Available | 621 | Open in IMG/M |
| 3300007346|Ga0070753_1259086 | Not Available | 629 | Open in IMG/M |
| 3300007538|Ga0099851_1178203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 781 | Open in IMG/M |
| 3300007540|Ga0099847_1010670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep1-CGR2-KM23-C896 | 3039 | Open in IMG/M |
| 3300007541|Ga0099848_1088480 | Not Available | 1199 | Open in IMG/M |
| 3300007542|Ga0099846_1167574 | Not Available | 785 | Open in IMG/M |
| 3300007640|Ga0070751_1216475 | All Organisms → Viruses | 739 | Open in IMG/M |
| 3300007722|Ga0105051_10075369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2663 | Open in IMG/M |
| 3300008012|Ga0075480_10390283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 688 | Open in IMG/M |
| 3300008107|Ga0114340_1144873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300008110|Ga0114343_1056615 | Not Available | 1492 | Open in IMG/M |
| 3300008113|Ga0114346_1198490 | Not Available | 803 | Open in IMG/M |
| 3300008114|Ga0114347_1123049 | Not Available | 968 | Open in IMG/M |
| 3300008221|Ga0114916_1034445 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
| 3300008221|Ga0114916_1117628 | Not Available | 624 | Open in IMG/M |
| 3300008221|Ga0114916_1154519 | Not Available | 510 | Open in IMG/M |
| 3300008261|Ga0114336_1321835 | Not Available | 570 | Open in IMG/M |
| 3300008266|Ga0114363_1157246 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300008448|Ga0114876_1037116 | Not Available | 2320 | Open in IMG/M |
| 3300009037|Ga0105093_10916024 | Not Available | 516 | Open in IMG/M |
| 3300009076|Ga0115550_1072371 | Not Available | 1336 | Open in IMG/M |
| 3300009081|Ga0105098_10149227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
| 3300009081|Ga0105098_10442072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 653 | Open in IMG/M |
| 3300009081|Ga0105098_10607162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300009151|Ga0114962_10659838 | Not Available | 538 | Open in IMG/M |
| 3300009155|Ga0114968_10443688 | Not Available | 703 | Open in IMG/M |
| 3300009159|Ga0114978_10685690 | Not Available | 585 | Open in IMG/M |
| 3300009164|Ga0114975_10334241 | Not Available | 835 | Open in IMG/M |
| 3300009164|Ga0114975_10493344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300009169|Ga0105097_10002155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9654 | Open in IMG/M |
| 3300009169|Ga0105097_10317529 | Not Available | 862 | Open in IMG/M |
| 3300009169|Ga0105097_10524116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300009170|Ga0105096_10723816 | Not Available | 528 | Open in IMG/M |
| 3300009420|Ga0114994_10266924 | Not Available | 1144 | Open in IMG/M |
| 3300009420|Ga0114994_10702543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED222 | 660 | Open in IMG/M |
| 3300009428|Ga0114915_1039425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED222 | 1572 | Open in IMG/M |
| 3300009508|Ga0115567_10526151 | Not Available | 718 | Open in IMG/M |
| 3300009785|Ga0115001_10060904 | All Organisms → Viruses → Predicted Viral | 2481 | Open in IMG/M |
| 3300009785|Ga0115001_10168012 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300010299|Ga0129342_1247058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300010316|Ga0136655_1064965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1124 | Open in IMG/M |
| 3300010354|Ga0129333_10618589 | Not Available | 938 | Open in IMG/M |
| 3300010388|Ga0136551_1065271 | Not Available | 654 | Open in IMG/M |
| 3300013372|Ga0177922_10789140 | Not Available | 555 | Open in IMG/M |
| 3300013372|Ga0177922_11245991 | Not Available | 736 | Open in IMG/M |
| 3300015050|Ga0181338_1000786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6002 | Open in IMG/M |
| 3300015050|Ga0181338_1058917 | Not Available | 554 | Open in IMG/M |
| 3300017700|Ga0181339_1037367 | Not Available | 529 | Open in IMG/M |
| 3300017722|Ga0181347_1013308 | Not Available | 2654 | Open in IMG/M |
| 3300017722|Ga0181347_1074202 | Not Available | 1000 | Open in IMG/M |
| 3300017722|Ga0181347_1094225 | Not Available | 861 | Open in IMG/M |
| 3300017723|Ga0181362_1009090 | Not Available | 2134 | Open in IMG/M |
| 3300017745|Ga0181427_1141881 | Not Available | 583 | Open in IMG/M |
| 3300017761|Ga0181356_1101930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300017761|Ga0181356_1116125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM68 | 858 | Open in IMG/M |
| 3300017777|Ga0181357_1035512 | Not Available | 1963 | Open in IMG/M |
| 3300017777|Ga0181357_1138437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300017777|Ga0181357_1245712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300017778|Ga0181349_1002303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8186 | Open in IMG/M |
| 3300017778|Ga0181349_1094533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300017778|Ga0181349_1143372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300017778|Ga0181349_1260423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300017778|Ga0181349_1265585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 567 | Open in IMG/M |
| 3300017784|Ga0181348_1020402 | Not Available | 2826 | Open in IMG/M |
| 3300017785|Ga0181355_1119268 | Not Available | 1081 | Open in IMG/M |
| 3300017824|Ga0181552_10445715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300017964|Ga0181589_10721096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
| 3300017967|Ga0181590_10980625 | Not Available | 552 | Open in IMG/M |
| 3300017968|Ga0181587_10553653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300017969|Ga0181585_10287692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1148 | Open in IMG/M |
| 3300019783|Ga0181361_100131 | Not Available | 3281 | Open in IMG/M |
| 3300019783|Ga0181361_103527 | Not Available | 1164 | Open in IMG/M |
| 3300019784|Ga0181359_1121832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300019784|Ga0181359_1270963 | Not Available | 504 | Open in IMG/M |
| 3300020141|Ga0211732_1591244 | Not Available | 976 | Open in IMG/M |
| 3300020165|Ga0206125_10178248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Methylophilales phage Venkman EXVC282S | 839 | Open in IMG/M |
| 3300020191|Ga0181604_10020185 | Not Available | 4474 | Open in IMG/M |
| 3300020498|Ga0208050_1029691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300020515|Ga0208234_1022843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300021140|Ga0214168_1101822 | Not Available | 615 | Open in IMG/M |
| 3300021438|Ga0213920_1089130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300021960|Ga0222715_10040076 | All Organisms → Viruses → Predicted Viral | 3302 | Open in IMG/M |
| 3300021961|Ga0222714_10024420 | All Organisms → Viruses | 4632 | Open in IMG/M |
| 3300021962|Ga0222713_10282375 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300021962|Ga0222713_10408095 | Not Available | 834 | Open in IMG/M |
| 3300021963|Ga0222712_10357950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
| 3300022063|Ga0212029_1040101 | Not Available | 671 | Open in IMG/M |
| 3300022168|Ga0212027_1040985 | Not Available | 596 | Open in IMG/M |
| 3300022176|Ga0212031_1088364 | Not Available | 529 | Open in IMG/M |
| 3300022190|Ga0181354_1234559 | Not Available | 530 | Open in IMG/M |
| 3300022198|Ga0196905_1003245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6002 | Open in IMG/M |
| 3300022407|Ga0181351_1209753 | Not Available | 642 | Open in IMG/M |
| 3300022848|Ga0222674_1003275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3500 | Open in IMG/M |
| 3300022851|Ga0222691_1039358 | Not Available | 657 | Open in IMG/M |
| 3300022857|Ga0222653_1006740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3477 | Open in IMG/M |
| 3300023170|Ga0255761_10358415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300023184|Ga0214919_10038249 | Not Available | 4826 | Open in IMG/M |
| 3300023184|Ga0214919_10042012 | Not Available | 4517 | Open in IMG/M |
| 3300023184|Ga0214919_10138500 | Not Available | 1960 | Open in IMG/M |
| 3300023184|Ga0214919_10256200 | Not Available | 1248 | Open in IMG/M |
| 3300023235|Ga0222634_1058491 | Not Available | 542 | Open in IMG/M |
| 3300024301|Ga0233451_10225538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
| 3300025075|Ga0209615_110794 | Not Available | 504 | Open in IMG/M |
| 3300025120|Ga0209535_1037210 | Not Available | 2219 | Open in IMG/M |
| 3300025137|Ga0209336_10034074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED222 | 1687 | Open in IMG/M |
| 3300025137|Ga0209336_10122892 | Not Available | 710 | Open in IMG/M |
| 3300025138|Ga0209634_1057166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Methylophilales phage Venkman EXVC282S | 1894 | Open in IMG/M |
| 3300025266|Ga0208032_1106394 | Not Available | 525 | Open in IMG/M |
| 3300025425|Ga0208646_1045847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 847 | Open in IMG/M |
| 3300025438|Ga0208770_1008083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3486 | Open in IMG/M |
| 3300025645|Ga0208643_1101123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 789 | Open in IMG/M |
| 3300025655|Ga0208795_1025018 | Not Available | 1932 | Open in IMG/M |
| 3300025778|Ga0208388_1019385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300025889|Ga0208644_1034640 | All Organisms → Viruses | 2978 | Open in IMG/M |
| 3300025889|Ga0208644_1078204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1705 | Open in IMG/M |
| 3300025889|Ga0208644_1376135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300025897|Ga0209425_10102495 | Not Available | 1696 | Open in IMG/M |
| 3300027210|Ga0208802_1049770 | Not Available | 568 | Open in IMG/M |
| 3300027683|Ga0209392_1051471 | Not Available | 1338 | Open in IMG/M |
| 3300027683|Ga0209392_1246653 | Not Available | 533 | Open in IMG/M |
| 3300027693|Ga0209704_1023154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1598 | Open in IMG/M |
| 3300027759|Ga0209296_1009182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6013 | Open in IMG/M |
| 3300027772|Ga0209768_10278288 | Not Available | 713 | Open in IMG/M |
| 3300027798|Ga0209353_10002375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10276 | Open in IMG/M |
| 3300027808|Ga0209354_10002706 | Not Available | 7477 | Open in IMG/M |
| 3300027808|Ga0209354_10078266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1344 | Open in IMG/M |
| 3300027808|Ga0209354_10311440 | Not Available | 625 | Open in IMG/M |
| 3300027816|Ga0209990_10261180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300027888|Ga0209635_11150867 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027969|Ga0209191_1079561 | Not Available | 1433 | Open in IMG/M |
| 3300027969|Ga0209191_1318812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300027976|Ga0209702_10019903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5589 | Open in IMG/M |
| 3300027976|Ga0209702_10146207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
| 3300028025|Ga0247723_1084246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 830 | Open in IMG/M |
| 3300028103|Ga0255172_1000968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 6874 | Open in IMG/M |
| 3300028115|Ga0233450_10201363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 929 | Open in IMG/M |
| 3300029302|Ga0135227_1017906 | Not Available | 679 | Open in IMG/M |
| 3300031142|Ga0308022_1196712 | Not Available | 565 | Open in IMG/M |
| 3300031519|Ga0307488_10696960 | Not Available | 575 | Open in IMG/M |
| 3300031519|Ga0307488_10843852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300031539|Ga0307380_10885298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 726 | Open in IMG/M |
| 3300031565|Ga0307379_10870065 | Not Available | 784 | Open in IMG/M |
| 3300031566|Ga0307378_11058868 | Not Available | 655 | Open in IMG/M |
| 3300031569|Ga0307489_10600078 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 759 | Open in IMG/M |
| 3300031570|Ga0308144_1029296 | Not Available | 688 | Open in IMG/M |
| 3300031588|Ga0302137_1041169 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
| 3300031707|Ga0315291_10164577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2302 | Open in IMG/M |
| 3300031746|Ga0315293_10488982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300031758|Ga0315907_10173619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1817 | Open in IMG/M |
| 3300031787|Ga0315900_10739405 | Not Available | 689 | Open in IMG/M |
| 3300031848|Ga0308000_10329175 | Not Available | 581 | Open in IMG/M |
| 3300031951|Ga0315904_10195998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1989 | Open in IMG/M |
| 3300031951|Ga0315904_10860391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 737 | Open in IMG/M |
| 3300032053|Ga0315284_11852841 | Not Available | 619 | Open in IMG/M |
| 3300032177|Ga0315276_10703280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300032177|Ga0315276_12108801 | Not Available | 573 | Open in IMG/M |
| 3300033742|Ga0314858_159512 | All Organisms → Viruses | 580 | Open in IMG/M |
| 3300033742|Ga0314858_189319 | Not Available | 528 | Open in IMG/M |
| 3300033816|Ga0334980_0081707 | Not Available | 1350 | Open in IMG/M |
| 3300034092|Ga0335010_0595140 | Not Available | 562 | Open in IMG/M |
| 3300034095|Ga0335022_0128992 | All Organisms → Viruses → Predicted Viral | 1584 | Open in IMG/M |
| 3300034102|Ga0335029_0203197 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300034106|Ga0335036_0580574 | Not Available | 684 | Open in IMG/M |
| 3300034111|Ga0335063_0435536 | Not Available | 653 | Open in IMG/M |
| 3300034283|Ga0335007_0772543 | Not Available | 526 | Open in IMG/M |
| 3300034284|Ga0335013_0367996 | Not Available | 894 | Open in IMG/M |
| 3300034375|Ga0348336_044685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1893 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.84% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.95% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.32% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.24% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.70% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.70% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.16% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.62% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.62% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.62% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.62% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.08% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.08% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.08% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.08% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.08% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.54% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.54% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.54% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.54% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.54% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.54% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.54% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.54% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.54% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.54% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.54% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.54% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022848 | Saline water microbial communities from Ace Lake, Antarctica - #866 | Environmental | Open in IMG/M |
| 3300022851 | Saline water microbial communities from Ace Lake, Antarctica - #1237 | Environmental | Open in IMG/M |
| 3300022857 | Saline water microbial communities from Ace Lake, Antarctica - #419 | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031570 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031588 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCM | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031848 | Marine microbial communities from water near the shore, Antarctic Ocean - #3 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101314993 | 3300000101 | Marine | MLSILSGILGFATSGLPSVLKFFEQKGDQNHEREMAKIEMQRSLAM |
| JGIcombinedJ13530_1100641453 | 3300001213 | Wetland | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMA |
| JGI24006J15134_100750931 | 3300001450 | Marine | VLSVLSGILGFATSGLPSVLKFFEQKGDNAHEEAM |
| JGI24006J15134_101452073 | 3300001450 | Marine | MLSILSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEMER |
| JGI24003J15210_100500021 | 3300001460 | Marine | MLSILSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEMERALAMAE |
| Ga0071350_10187674 | 3300005069 | Freshwater | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTE |
| Ga0074242_111768063 | 3300005346 | Saline Water And Sediment | MLSIISGILGFATSGLPSVLDFFKQKGDQKHEQAMARLEMERAM |
| Ga0068872_106983931 | 3300005528 | Freshwater Lake | MFSIISGILGFATSGLPSLLGFFQQKGDQAHEREMAKLQN |
| Ga0049081_101460431 | 3300005581 | Freshwater Lentic | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTERELELAKAGF |
| Ga0049085_100210391 | 3300005583 | Freshwater Lentic | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNEQTMAMAQAGFQ |
| Ga0078894_106823991 | 3300005662 | Freshwater Lake | MLSILSSILGFATAGLPNILGFFQQRGDQKHEREMAQLQNAQAMAMAEKGFV |
| Ga0075108_100130655 | 3300005913 | Saline Lake | MLSILSGILGFATSGLPSVLKFFEQKGDQKHEQSMA |
| Ga0079301_12304751 | 3300006639 | Deep Subsurface | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTERELELAKAG |
| Ga0070749_102970201 | 3300006802 | Aqueous | MLSILSAILGFATSGLPSVLDFFKQKGDQKHEREMAEIEM |
| Ga0075476_100639481 | 3300006867 | Aqueous | MLSILSGILGFATSGLPSILDFFKQKGDQKHELEMA |
| Ga0075475_102906592 | 3300006874 | Aqueous | MLSILSSILGFATSGLPSVLDYFKNRSDQKHEQTMARLEME |
| Ga0070750_103515143 | 3300006916 | Aqueous | MLSILSGILGFATSGLPSILDFFKQKGDQKHELAMSKLDMERSLA |
| Ga0098046_10459351 | 3300006990 | Marine | MLSILSGILGFATSGLPSVLKFFEQKNDQKHEQEMAKLEI |
| Ga0070747_12463711 | 3300007276 | Aqueous | MLSILSGILGFATSGLPSVLKFFEQKGDQNHEREMAKIEM |
| Ga0070753_12590863 | 3300007346 | Aqueous | MLSMLSGILGFATSGLPNVLKFFQEKGNQKHEQEMA |
| Ga0099851_11782031 | 3300007538 | Aqueous | MLSILSGILGFATSGLPSVLDFFKQKGDQKHEREM |
| Ga0099847_10106705 | 3300007540 | Aqueous | MLSILSAILGFATSGLPSVLDFFKQKGDQKHEREMAEIEMRRAMELAKA |
| Ga0099848_10884801 | 3300007541 | Aqueous | MLSILSGILGFATSGLPSVLDFFKQKGDQKHELEMARLDMERTL |
| Ga0099846_11675742 | 3300007542 | Aqueous | MLSILSGILGFATSGLPSVLDFFKQKGDQKHELEMARLDMERTLAL |
| Ga0070751_12164753 | 3300007640 | Aqueous | MLSILSGILGFATSGLPSVLKFFEQKGDQNHEREMAK |
| Ga0105051_100753696 | 3300007722 | Freshwater | MLSILSAVLGFATSGLPNVLKFFEQKGDQKHERDMAEIEIR |
| Ga0075480_103902831 | 3300008012 | Aqueous | MLSILSGILGFATSGLPSVLKFFENKSDQKHEREMAQLQMDRELALA |
| Ga0114340_11448733 | 3300008107 | Freshwater, Plankton | VLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTERELELAKA |
| Ga0114343_10566155 | 3300008110 | Freshwater, Plankton | MLSIISAILGIGSSALPNVLSFFQQKGDQKHEREMAMLQNQQTLAM |
| Ga0114346_11984903 | 3300008113 | Freshwater, Plankton | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKL |
| Ga0114347_11230491 | 3300008114 | Freshwater, Plankton | MLSIISAILGIGSSALPNVLSFFQQKGDQKHEREMAMLQNQQAMAMAE |
| Ga0114916_10344454 | 3300008221 | Deep Ocean | MISILSGILGFATSGLPSVLKFFEQKGDNAHEETMA |
| Ga0114916_11176281 | 3300008221 | Deep Ocean | VISILSGILGFATSGLPSVLKFFEQKGDNAHEAAMAKLEMERSLAMAEK |
| Ga0114916_11545191 | 3300008221 | Deep Ocean | MISILSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEM |
| Ga0114336_13218353 | 3300008261 | Freshwater, Plankton | MLSILSGILGFATSGLPSILGFFQQKGDQKHEREMAK |
| Ga0114363_11572461 | 3300008266 | Freshwater, Plankton | MFSIISGILGFATSGLPSLLGFFQQRGDQKHERDMAKLQNEQQMAM |
| Ga0114876_10371166 | 3300008448 | Freshwater Lake | MLSILSSILGFATAGLPNILQFFQQKGDQKHEREMAMLQNQQTLAMAEKGF |
| Ga0105093_109160241 | 3300009037 | Freshwater Sediment | MLSILSGLLGIGSSALPSVLGFFQQKGDQKHEIAMAK |
| Ga0115550_10723713 | 3300009076 | Pelagic Marine | MLTVLSSILGFATSGLPNLLKFFEQKGDQKHELEMAKLE |
| Ga0105098_101492274 | 3300009081 | Freshwater Sediment | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAKMQNEQALLMA |
| Ga0105098_104420721 | 3300009081 | Freshwater Sediment | MFSIISGILGFATSGLPSLLGFFQQKGDQAHEREMAKLQNEQA |
| Ga0105098_106071622 | 3300009081 | Freshwater Sediment | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAQLQNQQAL |
| Ga0114962_106598383 | 3300009151 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQSHEREMARLQN |
| Ga0114968_104436881 | 3300009155 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARL |
| Ga0114978_106856901 | 3300009159 | Freshwater Lake | MFSIISGILGFATSGLPSLLSFFQQKGDQKHEREMAKLQTER |
| Ga0114975_103342413 | 3300009164 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNEQ |
| Ga0114975_104933443 | 3300009164 | Freshwater Lake | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAQLQNQQ |
| Ga0105097_1000215525 | 3300009169 | Freshwater Sediment | MFSLLSSILGFATAGLPSILGFFQQKGDQAHERQMAKLQN |
| Ga0105097_103175293 | 3300009169 | Freshwater Sediment | MLSILSSILGFATSGLPNILSFFQQKGDQKHEREMAQLQNAQ |
| Ga0105097_105241163 | 3300009169 | Freshwater Sediment | MFSLLSSILGFATAGLPSLLGFFQQKGDQAHERQMAKLQNEQQMAM |
| Ga0105096_107238162 | 3300009170 | Freshwater Sediment | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQNAQAMAMAEKGFI |
| Ga0114994_102669243 | 3300009420 | Marine | MLSVLSAVLGFATSGLPNVLKFFEQKGDQKHEREMAE |
| Ga0114994_107025433 | 3300009420 | Marine | MLSVLSAILGFATSGLPNVLKFFEQKGDQKHEREMAEIEMR |
| Ga0114915_10394254 | 3300009428 | Deep Ocean | MISILSGILGFATSGLPSVLKFFEQKGDNAHEEAMA |
| Ga0115567_105261511 | 3300009508 | Pelagic Marine | MLSMLSGILGFATSGLPNVLKFFQEKGNQKHEQEMARLATERSLA |
| Ga0115001_100609044 | 3300009785 | Marine | VLSILSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEM |
| Ga0115001_101680121 | 3300009785 | Marine | VLSVLSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEME |
| Ga0129342_12470583 | 3300010299 | Freshwater To Marine Saline Gradient | MLSILSGILGFATSGLPSILDFFKQKGDQKHEQSMARLDMERALALA |
| Ga0136655_10649651 | 3300010316 | Freshwater To Marine Saline Gradient | MLSILSGILGFATSGLPSVLKFFEQKGDQKHEQEMAKLEIQRTME |
| Ga0129333_106185891 | 3300010354 | Freshwater To Marine Saline Gradient | MLSILSSILGFATAGLPNILGFFQQKGDQKHEREMAQLQNAQAMAMAEK |
| Ga0136551_10652711 | 3300010388 | Pond Fresh Water | MLSIISGLLGIGSSALPSLLGFFQQKGDQKHEMAMARL |
| Ga0177922_107891401 | 3300013372 | Freshwater | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQNAQALL |
| Ga0177922_112459911 | 3300013372 | Freshwater | MFSILSSILGFATAGLPSILGFFQQKGDQSHEREMA |
| Ga0181338_10007861 | 3300015050 | Freshwater Lake | MFSILSSILGFATAGIPSILGFFQQKGDQSHEREMARLQNEQAL |
| Ga0181338_10589171 | 3300015050 | Freshwater Lake | MFSILSSILGFATAGLPSVLGFFQQKGDQAHEREMARLQNEQTMAMAQAG |
| Ga0181339_10373672 | 3300017700 | Freshwater Lake | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQ |
| Ga0181347_10133081 | 3300017722 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNEQALLMA |
| Ga0181347_10742021 | 3300017722 | Freshwater Lake | MLSILSSILGFATAGLPNILSFFQQKGDQAHERKMAEMQNQQQMAMAEKG |
| Ga0181347_10942251 | 3300017722 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQSHEREMARLQNEQA |
| Ga0181362_10090905 | 3300017723 | Freshwater Lake | MFTLLGSLLGFGSSALPSILNFFQQKGDQKHEREM |
| Ga0181427_11418813 | 3300017745 | Seawater | MLSMLSGILGFATSGLPNVLKFFQEKGNQKHEQEM |
| Ga0181356_11019303 | 3300017761 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNEQALLMAEKGFV |
| Ga0181356_11161251 | 3300017761 | Freshwater Lake | MFSILSSILGFATAGLPNILSFFQQKGDQAHEREMARLQNEQALLMAEKGFV |
| Ga0181357_10355126 | 3300017777 | Freshwater Lake | MLSILSSILGFATAGLPNILSFFQQKGDQAHERKMAEMQNQ |
| Ga0181357_11384371 | 3300017777 | Freshwater Lake | MFSILSSILGFATAGLPSVLGFFQQKGDQAHEREMARLQNE |
| Ga0181357_12457123 | 3300017777 | Freshwater Lake | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQT |
| Ga0181349_100230313 | 3300017778 | Freshwater Lake | MFSILSSILGFATAGLPNILSFFQQKGDQAHEREMARLQNEQALLMAEKGFVS |
| Ga0181349_10945331 | 3300017778 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQSHEREMARLQNEQALLMA |
| Ga0181349_11433722 | 3300017778 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMAKMQNEQAMLMAQKGFQS |
| Ga0181349_12604233 | 3300017778 | Freshwater Lake | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTERELE |
| Ga0181349_12655853 | 3300017778 | Freshwater Lake | MFSILSSILGFATAGLPSVLGFFQQKGDQSHEREMARLQ |
| Ga0181348_10204026 | 3300017784 | Freshwater Lake | MFSILSSILGFATAGLPSVLNFFQQKGDQAHEREMARLQ |
| Ga0181355_11192683 | 3300017785 | Freshwater Lake | MLSIISAILGIGSSALPNVLSFFQQKGDQKHEREMAMLQ |
| Ga0181552_104457152 | 3300017824 | Salt Marsh | MLSIISGILGFATSGLPSVLDYFKNKGDQKHEQAMARLEMERTMEMAKAG |
| Ga0181589_107210963 | 3300017964 | Salt Marsh | MLSIISGILGFATSGLPSVLDYFKNKGDQKHEQAMARLEMERTMEMA |
| Ga0181590_109806251 | 3300017967 | Salt Marsh | MLSILSAILGFATSGLPSVLDFFKQKGDQKHEREMAQIEMQRAMEMAKA |
| Ga0181587_105536533 | 3300017968 | Salt Marsh | MLSIISGILGFATSGLPSVLDFFKNKGDQKHEQAMARL |
| Ga0181585_102876923 | 3300017969 | Salt Marsh | MLSILSGILGFATSGLPRILDFFKQKGDQKHEQSMARLDTERALA |
| Ga0181361_1001314 | 3300019783 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNEQALLMAE |
| Ga0181361_1035271 | 3300019783 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQSHEREMARLQNEQALLMAQKGFQS |
| Ga0181359_11218321 | 3300019784 | Freshwater Lake | MFSILSSILGFATAGLPSVLGFFQQKGDQAHEREMARLQNEQALLMA |
| Ga0181359_12709633 | 3300019784 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMA |
| Ga0211732_15912444 | 3300020141 | Freshwater | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQNAQALLMAEKGF |
| Ga0206125_101782481 | 3300020165 | Seawater | MLSILSGILGFATSGLPSVLKFFEQKGDQNHEREMAKIEMERSL |
| Ga0181604_100201857 | 3300020191 | Salt Marsh | MLSILSGILGFATSGLPSVLDFFKQKGDQKHERQMAQLDMERTLALAEK |
| Ga0208050_10296911 | 3300020498 | Freshwater | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAQLQNQQA |
| Ga0208234_10228433 | 3300020515 | Freshwater | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTERELEL |
| Ga0214168_11018221 | 3300021140 | Freshwater | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQNAQALLMAEK |
| Ga0213920_10891301 | 3300021438 | Freshwater | MLSILSSILGFATAGLPSILGFFQQKGDQKHEREMAQLQNAQ |
| Ga0222715_100400761 | 3300021960 | Estuarine Water | MLSILSAILGFATSGLPSVLDFFKQKGDQKHEREMAEIEMRRAMELAK |
| Ga0222714_100244207 | 3300021961 | Estuarine Water | MLSILSGILGFATSGLPSVLDFFRQKGDQKHELEMA |
| Ga0222713_102823751 | 3300021962 | Estuarine Water | MLSILSAVLGFATSGLPSVLDYFKNKGDQKHELAMAR |
| Ga0222713_104080953 | 3300021962 | Estuarine Water | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMAKMQNEQAMLMAQKG |
| Ga0222712_103579501 | 3300021963 | Estuarine Water | MFSIISGILGFATSGLPSLLGFFQQRGDQKHEREMAKMQNEQALL |
| Ga0212029_10401011 | 3300022063 | Aqueous | MLSMLSGILGFATSGLPNVLKFFQEKGNQKHEQEMARLATPF |
| Ga0212027_10409853 | 3300022168 | Aqueous | MLSILSGILGFATSGLPSVLDFFKNKADQKHEREMASLQTEREL |
| Ga0212031_10883641 | 3300022176 | Aqueous | MLSILSAVLGFATSGLPSILDYFKQKGDQKHEQSMARLDM |
| Ga0181354_12345592 | 3300022190 | Freshwater Lake | MLSILSSILGFATAGLPNILGFFQQRGDQKHEREMAQLQNAQALLMAE |
| Ga0196905_10032451 | 3300022198 | Aqueous | MLSILSAILGFATSGLPSVLDFFKQKGDQKHEREMAQIEMQRAM |
| Ga0181351_12097532 | 3300022407 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMAKMQ |
| Ga0222674_10032755 | 3300022848 | Saline Water | MLSILSAVLGFATSGLPSVLKFFEQKGDQKHEQSMARLEIDRTIE |
| Ga0222691_10393581 | 3300022851 | Saline Water | MLSILSAVLGFATSGLPSVLKFFEQKGDQKHEQSMA |
| Ga0222653_10067405 | 3300022857 | Saline Water | MLSILSAVLGFATSGLPSVLKFFEQKGDQKHEQSMAR |
| Ga0255761_103584153 | 3300023170 | Salt Marsh | MLSIISGILGFATSGLPSVLDFFKNKGDQKHEQAMARLEME |
| Ga0214919_100382491 | 3300023184 | Freshwater | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNEQA |
| Ga0214919_100420121 | 3300023184 | Freshwater | MFSILSSILGFATAGLPSILGFFQQKGDQSHEREMAR |
| Ga0214919_101385003 | 3300023184 | Freshwater | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNE |
| Ga0214919_102562004 | 3300023184 | Freshwater | MFSILSSILGFATAGLPSILGFFQQKGDQSHEREMARL |
| Ga0222634_10584911 | 3300023235 | Saline Water | MLSILSAVLGFATSGLPNVLKFFEQKGDNAHEQAMAKLDIQRTMEMAKA |
| Ga0233451_102255381 | 3300024301 | Salt Marsh | MLSIISGILGFATSGLPSVLDFFKNKGDQKHEQAMARLEMERAMEMAKAGY |
| Ga0209615_1107941 | 3300025075 | Freshwater | MLSILSSILGFATAGLPNILSFFQQRGDQKHEREMAQLQ |
| Ga0209535_10372101 | 3300025120 | Marine | MLSILSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEMERALAMAEKG |
| Ga0209336_100340745 | 3300025137 | Marine | MLSILSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEMERALAMAEK |
| Ga0209336_101228923 | 3300025137 | Marine | MLSILSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEME |
| Ga0209634_10571663 | 3300025138 | Marine | MLSVLSAVLGFATSGLPNVLKFFEQKGDQKHEREMAEIE |
| Ga0208032_11063941 | 3300025266 | Deep Ocean | MISILSGILGFATSGLPSVLKFFEQKGDNAHEETM |
| Ga0208646_10458474 | 3300025425 | Saline Lake | MLSVLSAVLGFATSGLPNVLKFFEQKGDNAHEQAMAKLDIQ |
| Ga0208770_10080838 | 3300025438 | Saline Lake | MLSILSAVLGFATSGLPNVLKFFEQKGDQKHERDMAEIEIRRTMEMAK |
| Ga0208643_11011233 | 3300025645 | Aqueous | MLSILSGILGFATSGLPSILDFFKQKGDQKHEQSMARLDMERALALAEKG |
| Ga0208795_10250181 | 3300025655 | Aqueous | MLSILSGILGFATSGLPSVLQFFQQKGDQKHELQMAKLDME |
| Ga0208388_10193851 | 3300025778 | Freshwater | MFSMLSGILGFATSGLPSILNFFQQKSDQKHELEMAQ |
| Ga0208644_10346401 | 3300025889 | Aqueous | MLSILSGILGFATSGLPSVLDFFRQKGDQKHELEMAKLDM |
| Ga0208644_10782044 | 3300025889 | Aqueous | MLSILSGILGFATSGLPSVLQFFQQKGDQKHELQMAKL |
| Ga0208644_13761351 | 3300025889 | Aqueous | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAKMQNEQALLMAQQGF |
| Ga0209425_101024955 | 3300025897 | Pelagic Marine | MLSILSGILGFATSGLPSVLKFFEQKGDQNHEREMAKI |
| Ga0208802_10497701 | 3300027210 | Estuarine | MLSILSSILGFATAGLPNILGFFQQKGDQKHEREMAQ |
| Ga0209392_10514711 | 3300027683 | Freshwater Sediment | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQNAQAMAM |
| Ga0209392_12466532 | 3300027683 | Freshwater Sediment | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQNAQAMA |
| Ga0209704_10231545 | 3300027693 | Freshwater Sediment | MLSIFSGLLGIASSSLPNILGFFQAKADQKHELEMMKQQKER |
| Ga0209296_10091828 | 3300027759 | Freshwater Lake | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAMLQNQQTLAMAEK |
| Ga0209768_102782881 | 3300027772 | Freshwater Lake | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAMLQNQQALLMAEKG |
| Ga0209353_1000237514 | 3300027798 | Freshwater Lake | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTERELELAKA |
| Ga0209354_1000270612 | 3300027808 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMAKMQNEQAMLMAQKGFQ |
| Ga0209354_100782664 | 3300027808 | Freshwater Lake | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMA |
| Ga0209354_103114402 | 3300027808 | Freshwater Lake | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAQLQNQQALLMAEKGFV |
| Ga0209990_102611801 | 3300027816 | Freshwater Lake | MFSIISGILGFATSGLPSLLGFFQQRGDQKHERDMAKLQNEQQMA |
| Ga0209635_111508671 | 3300027888 | Marine Sediment | MLSILSAVLGFATSGLPSVLDFFKQKGDQKHEQSMARLDMERALALAE |
| Ga0209191_10795611 | 3300027969 | Freshwater Lake | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNEQAMAMA |
| Ga0209191_13188123 | 3300027969 | Freshwater Lake | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAQLQN |
| Ga0209702_100199031 | 3300027976 | Freshwater | MLSILSAVLGFATSGLPSVLKFFEQKGDQKHEQSMARLEIDRT |
| Ga0209702_101462071 | 3300027976 | Freshwater | MLSILSGILGFATSGLPSVLKFFEQKGDQKHERDMAEIEIRRTME |
| Ga0247723_10842461 | 3300028025 | Deep Subsurface Sediment | MLSILSGILGFATSGLPSILGFFQQKGDQKHEREMAKLQTERELEL |
| Ga0255172_10009681 | 3300028103 | Freshwater | MFALLSSVLGFATAGLPSILGFFQQKGDQKHEREMAMLQNEQ |
| Ga0233450_102013633 | 3300028115 | Salt Marsh | MLSIISGILGFATSGLPSVLDYFKNKGDQKHEQAMARLEMERTM |
| Ga0135227_10179061 | 3300029302 | Marine Harbor | MLSIISGILGFATSGLPSVLDFFKQKGDQKHEQAMARLEMERAMEMAKAGK |
| Ga0308022_11967121 | 3300031142 | Marine | VLSILSGILGFATSGLPSVLKFFEQKGDNAHEETMAKLEMERSLAMAEKG |
| Ga0307488_106969602 | 3300031519 | Sackhole Brine | MLSILSGILGFATSGLPSVLKFFEQKGDNAHEEAMAKLEM |
| Ga0307488_108438522 | 3300031519 | Sackhole Brine | MLSVLSAILGFATSGLPNVLKFFEQKGDQKHEREM |
| Ga0307380_108852981 | 3300031539 | Soil | MLSILSGILGFATSGLPSVLKFFENKSDQKHEREMAQ |
| Ga0307379_108700653 | 3300031565 | Soil | MLSILSGVLGFATSGLPSVLKFFEQKGDQKHEQAMAELEIKRTMELAKA |
| Ga0307378_110588681 | 3300031566 | Soil | MLSILSAVLGFATSGLPNVLKFFEQKGDQKHEQAMAELEIKRTMELAK |
| Ga0307489_106000781 | 3300031569 | Sackhole Brine | MLSVLSAVLGFATSGLPNVLKFFEQKGDQKHEREMAEIEMRRSLAMA |
| Ga0308144_10292963 | 3300031570 | Marine | MLSMISGILGFATSGLPNVLKFFQEKGNHKHEQEMARLATERSLAMA |
| Ga0302137_10411691 | 3300031588 | Marine | VLSILSGILGFATSGLPSVLKFFEQKGDNAHEQAMAQLEMERSLAMAE |
| Ga0315291_101645771 | 3300031707 | Sediment | MLSILSGILGFATSGLPSLLGFFQQKGDQKHEREMAKL |
| Ga0315293_104889821 | 3300031746 | Sediment | MLSILSGILGFATSGLPSLLGFFQQKGDQKHEREMAKLQ |
| Ga0315907_101736191 | 3300031758 | Freshwater | MLSILSSILGFATAGLPNVLNFFQQKGDQKHEREMAKLQTE |
| Ga0315900_107394053 | 3300031787 | Freshwater | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQNAQAMAMAE |
| Ga0308000_103291751 | 3300031848 | Marine | MISMLSGILGFATSGLPNVLKFFQQKGDQKHERDMAQL |
| Ga0315904_101959985 | 3300031951 | Freshwater | VFSLLSSVLGFATAGLPSVLSFFQQKGDQKHERDMAKLQNEQA |
| Ga0315904_108603913 | 3300031951 | Freshwater | MFSIISGILGFATSGLPSLLGFFQQKGDQAHEREMAKL |
| Ga0315284_118528413 | 3300032053 | Sediment | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREMARLQNEQTMAMAQAGF |
| Ga0315276_107032804 | 3300032177 | Sediment | MLSILSGILGFATSGLPSLLGFFQQKGDQKHEREMAKLQTERELELAKAG |
| Ga0315276_121088013 | 3300032177 | Sediment | MFSILSSILGFATAGLPSILGFFQQKGDQAHEREM |
| Ga0314858_159512_433_579 | 3300033742 | Sea-Ice Brine | MLSILSGVLGFATSGLPSVLKFFEQKGDQKHEQAMAELDIKRTMELAKA |
| Ga0314858_189319_391_528 | 3300033742 | Sea-Ice Brine | MLSMLSGILGFATSGLPNVLKFFQEKGNQKHEQEMARLATERSLAM |
| Ga0334980_0081707_1226_1348 | 3300033816 | Freshwater | MLSILSSILGFATAGLPNILSFFQQKGDQKHEREMAQLQNA |
| Ga0335010_0595140_446_562 | 3300034092 | Freshwater | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAQLQ |
| Ga0335022_0128992_1443_1583 | 3300034095 | Freshwater | MLSIISGLLGIGSSALPSILGFFQQKGDQKHEMAMARLQTEREAAMA |
| Ga0335029_0203197_1188_1313 | 3300034102 | Freshwater | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAKLQTER |
| Ga0335036_0580574_1_120 | 3300034106 | Freshwater | MFSIISGILGFATSGLPSLLGFFQQKGDQKHEREMAMLQN |
| Ga0335063_0435536_515_652 | 3300034111 | Freshwater | MLSIISGLLGIGSSALPSLLGFFQQKGDQKHEMNMARLQTEREAAM |
| Ga0335007_0772543_415_525 | 3300034283 | Freshwater | MLSILSGILGFATSGLPSVLGFFQQKGDQKHEREMAK |
| Ga0335013_0367996_775_894 | 3300034284 | Freshwater | MLSILSSILGFATAGLPNILSFFQQKGDQAHERKMAEMQN |
| Ga0348336_044685_2_139 | 3300034375 | Aqueous | MLSILSGILGFATSGLPSVLDFFKNKADQKHEREMASLQTERELAL |
| ⦗Top⦘ |