NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029969

Metagenome / Metatranscriptome Family F029969

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029969
Family Type Metagenome / Metatranscriptome
Number of Sequences 186
Average Sequence Length 137 residues
Representative Sequence MSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGEGWLRIKDDKTIDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVSGQYLAVRNDEVVAGIGGEFCVFELFREK
Number of Associated Samples 108
Number of Associated Scaffolds 186

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.76 %
% of genes near scaffold ends (potentially truncated) 69.35 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.88

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(88.710 % of family members)
Environment Ontology (ENVO) Unclassified
(40.323 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(94.086 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.64%    β-sheet: 39.39%    Coil/Unstructured: 56.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.88
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.42.2.1: Ricin B-like lectinsd3aj6a13aj60.83
b.42.1.1: Cytokined1nuna_1nun0.82
b.42.6.1: MIR domaind1t9fa11t9f0.81
b.42.6.0: MIR domaind3mala_3mal0.81
b.42.2.1: Ricin B-like lectinsd5mu9a15mu90.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009411|Ga0115017_1292588All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa631Open in IMG/M
3300010870|Ga0102750_10471399All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis571Open in IMG/M
3300012469|Ga0150984_104602680All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis529Open in IMG/M
3300016705|Ga0181507_1416898All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis659Open in IMG/M
3300016728|Ga0181500_1561561All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis522Open in IMG/M
3300016750|Ga0181505_10043449All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis577Open in IMG/M
3300019212|Ga0180106_1029518All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa569Open in IMG/M
3300019240|Ga0181510_1293757All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis659Open in IMG/M
3300019256|Ga0181508_1241059All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis551Open in IMG/M
3300019268|Ga0181514_1429598All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa553Open in IMG/M
3300028554|Ga0302047_10274675All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis571Open in IMG/M
3300030526|Ga0210267_1043378All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa567Open in IMG/M
3300030528|Ga0210277_10137803All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa546Open in IMG/M
3300030528|Ga0210277_10614687All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa534Open in IMG/M
3300030528|Ga0210277_10690828All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis586Open in IMG/M
3300030528|Ga0210277_10995796All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis516Open in IMG/M
3300030529|Ga0210284_1216601All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa505Open in IMG/M
3300030529|Ga0210284_1440790All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa579Open in IMG/M
3300030531|Ga0210274_1021721All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis582Open in IMG/M
3300030531|Ga0210274_1714468All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa672Open in IMG/M
3300030532|Ga0210290_1423557All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa554Open in IMG/M
3300030535|Ga0210285_1281940All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis600Open in IMG/M
3300030535|Ga0210285_1395454All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa524Open in IMG/M
3300030536|Ga0210266_1229717All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa725Open in IMG/M
3300030537|Ga0247642_1011381All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa703Open in IMG/M
3300030537|Ga0247642_1031096All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa578Open in IMG/M
3300030537|Ga0247642_1038301All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa552Open in IMG/M
3300030537|Ga0247642_1047425All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa526Open in IMG/M
3300030540|Ga0247649_1081800All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa542Open in IMG/M
3300030540|Ga0247649_1098452All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa521Open in IMG/M
3300030543|Ga0210289_1064264All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa605Open in IMG/M
3300030545|Ga0210271_10786041All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis560Open in IMG/M
3300030545|Ga0210271_10941216All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa547Open in IMG/M
3300030545|Ga0210271_11074193All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa508Open in IMG/M
3300030546|Ga0247646_1107359All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa699Open in IMG/M
3300030546|Ga0247646_1192620All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa580Open in IMG/M
3300030547|Ga0247656_1108643All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis636Open in IMG/M
3300030547|Ga0247656_1140125All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa595Open in IMG/M
3300030548|Ga0210252_10321760All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa614Open in IMG/M
3300030548|Ga0210252_10739770All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa522Open in IMG/M
3300030549|Ga0210257_10785521All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa511Open in IMG/M
3300030550|Ga0247631_1051686All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa689Open in IMG/M
3300030550|Ga0247631_1075807All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa642Open in IMG/M
3300030550|Ga0247631_1205528All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa518Open in IMG/M
3300030551|Ga0247638_1131070All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa593Open in IMG/M
3300030552|Ga0247654_1080083All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis660Open in IMG/M
3300030552|Ga0247654_1166411All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa545Open in IMG/M
3300030553|Ga0247645_1209651All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa533Open in IMG/M
3300030563|Ga0247653_1079796All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa542Open in IMG/M
3300030563|Ga0247653_1085592All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa534Open in IMG/M
3300030565|Ga0247635_1165247All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa638Open in IMG/M
3300030565|Ga0247635_1314633All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa514Open in IMG/M
3300030569|Ga0247628_1215037All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa558Open in IMG/M
3300030570|Ga0247647_1271602All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa509Open in IMG/M
3300030570|Ga0247647_1281187All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa502Open in IMG/M
3300030572|Ga0210258_10605215All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa570Open in IMG/M
3300030574|Ga0247648_1125028All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis605Open in IMG/M
3300030574|Ga0247648_1151873All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa567Open in IMG/M
3300030574|Ga0247648_1156967All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa561Open in IMG/M
3300030576|Ga0247644_1106992All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa631Open in IMG/M
3300030578|Ga0210275_10322627All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa545Open in IMG/M
3300030579|Ga0247633_10154992All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa632Open in IMG/M
3300030579|Ga0247633_10179599All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa609Open in IMG/M
3300030579|Ga0247633_10193397All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa597Open in IMG/M
3300030579|Ga0247633_10239925All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa562Open in IMG/M
3300030581|Ga0210270_1571320All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa549Open in IMG/M
3300030584|Ga0247658_1115527All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa553Open in IMG/M
3300030585|Ga0247639_1312624All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa505Open in IMG/M
3300030586|Ga0265393_1129246All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis606Open in IMG/M
3300030586|Ga0265393_1171299All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa555Open in IMG/M
3300030588|Ga0210283_1125523All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa573Open in IMG/M
3300030588|Ga0210283_1562600All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa521Open in IMG/M
3300030590|Ga0247643_1105952All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa622Open in IMG/M
3300030591|Ga0247626_1172711All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa604Open in IMG/M
3300030592|Ga0247612_1127788All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis610Open in IMG/M
3300030592|Ga0247612_1160641All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa561Open in IMG/M
3300030592|Ga0247612_1163113All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa558Open in IMG/M
3300030594|Ga0210280_1079477All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis664Open in IMG/M
3300030594|Ga0210280_1171063All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis536Open in IMG/M
3300030594|Ga0210280_1202190All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis509Open in IMG/M
3300030594|Ga0210280_1210607All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa502Open in IMG/M
3300030595|Ga0210276_10048248All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis543Open in IMG/M
3300030597|Ga0210286_1246260All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa565Open in IMG/M
3300030597|Ga0210286_1285063All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa536Open in IMG/M
3300030599|Ga0247630_1163839All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa568Open in IMG/M
3300030600|Ga0247659_1111320All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa624Open in IMG/M
3300030600|Ga0247659_1158088All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa566Open in IMG/M
3300030600|Ga0247659_1186074All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa539Open in IMG/M
3300030600|Ga0247659_1206291All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa522Open in IMG/M
3300030600|Ga0247659_1208254All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa521Open in IMG/M
3300030601|Ga0247650_1076961All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa621Open in IMG/M
3300030602|Ga0210254_10554115All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa665Open in IMG/M
3300030602|Ga0210254_10881077All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa505Open in IMG/M
3300030603|Ga0210253_11145012All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa504Open in IMG/M
3300030604|Ga0247637_1181803All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis538Open in IMG/M
3300030605|Ga0210265_1114314All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis580Open in IMG/M
3300030607|Ga0247615_10267154All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa595Open in IMG/M
3300030608|Ga0247651_10199577All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis610Open in IMG/M
3300030608|Ga0247651_10234892All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa579Open in IMG/M
3300030608|Ga0247651_10276016All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa549Open in IMG/M
3300030609|Ga0247634_10308743All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis632Open in IMG/M
3300030609|Ga0247634_10317528All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa626Open in IMG/M
3300030609|Ga0247634_10383935All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa586Open in IMG/M
3300030609|Ga0247634_10508093All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa527Open in IMG/M
3300030609|Ga0247634_10564943All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa506Open in IMG/M
3300030614|Ga0247657_10052543All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis793Open in IMG/M
3300030614|Ga0247657_10179062All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa592Open in IMG/M
3300030621|Ga0247655_10149704All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa650Open in IMG/M
3300030621|Ga0247655_10213008All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa585Open in IMG/M
3300030621|Ga0247655_10281144All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa534Open in IMG/M
3300030623|Ga0265392_1185343All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis564Open in IMG/M
3300030625|Ga0210259_10771513All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa530Open in IMG/M
3300030627|Ga0210269_10297239All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa561Open in IMG/M
3300030630|Ga0210282_10253566All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa599Open in IMG/M
3300030631|Ga0210279_10296254All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa618Open in IMG/M
3300030633|Ga0247623_10164935All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis640Open in IMG/M
3300030633|Ga0247623_10194922All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa608Open in IMG/M
3300030634|Ga0247636_10300468All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa545Open in IMG/M
3300030634|Ga0247636_10327224All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa527Open in IMG/M
3300030635|Ga0247627_10171926All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa643Open in IMG/M
3300030635|Ga0247627_10248545All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa572Open in IMG/M
3300030635|Ga0247627_10356324All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa505Open in IMG/M
3300030683|Ga0247621_1129269All Organisms → cellular organisms → Eukaryota602Open in IMG/M
3300030683|Ga0247621_1158459All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa560Open in IMG/M
3300030684|Ga0247617_1048849All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa651Open in IMG/M
3300030684|Ga0247617_1081716All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa585Open in IMG/M
3300030684|Ga0247617_1091614All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa570Open in IMG/M
3300030684|Ga0247617_1125910All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa527Open in IMG/M
3300030738|Ga0265462_10423231All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa919Open in IMG/M
3300030738|Ga0265462_11939019All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis570Open in IMG/M
3300030738|Ga0265462_12257305All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis537Open in IMG/M
3300030738|Ga0265462_12353252All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa528Open in IMG/M
3300030740|Ga0265460_12353636All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa564Open in IMG/M
3300030740|Ga0265460_12361873All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa563Open in IMG/M
3300030740|Ga0265460_12471452All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis552Open in IMG/M
3300030740|Ga0265460_12486578All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa551Open in IMG/M
3300030741|Ga0265459_12666767All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa619Open in IMG/M
3300030743|Ga0265461_12268230All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis631Open in IMG/M
3300030743|Ga0265461_12620748All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa597Open in IMG/M
3300030743|Ga0265461_12836411All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa579Open in IMG/M
3300030743|Ga0265461_13633271All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa523Open in IMG/M
3300030743|Ga0265461_13801806All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa513Open in IMG/M
3300030777|Ga0075402_12388176All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa552Open in IMG/M
3300030777|Ga0075402_12408822All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa591Open in IMG/M
3300030778|Ga0075398_11911719All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa525Open in IMG/M
3300030782|Ga0102754_1893064All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis604Open in IMG/M
3300030784|Ga0102758_11014996All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis580Open in IMG/M
3300030790|Ga0138304_1196990All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa551Open in IMG/M
3300030804|Ga0102769_10870976All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa650Open in IMG/M
3300030804|Ga0102769_11121838All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa614Open in IMG/M
3300030841|Ga0075384_11322171All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa512Open in IMG/M
3300030842|Ga0075404_11520967All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa568Open in IMG/M
3300030847|Ga0075405_12003053All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa533Open in IMG/M
3300030848|Ga0075388_10738118All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa516Open in IMG/M
3300030850|Ga0075387_10895455All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa502Open in IMG/M
3300030909|Ga0074033_10874590All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa509Open in IMG/M
3300030922|Ga0138300_1728430All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa558Open in IMG/M
3300030936|Ga0138306_1224586All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa540Open in IMG/M
3300030936|Ga0138306_1374408All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa613Open in IMG/M
3300030938|Ga0138299_10988379All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa590Open in IMG/M
3300030959|Ga0102747_10063471All Organisms → cellular organisms → Eukaryota591Open in IMG/M
3300030962|Ga0138297_1617732All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa594Open in IMG/M
3300030971|Ga0075375_11930124All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa562Open in IMG/M
3300030971|Ga0075375_12114473All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa598Open in IMG/M
3300030974|Ga0075371_10074568All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa543Open in IMG/M
3300030974|Ga0075371_11773017All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa628Open in IMG/M
3300030979|Ga0068589_11270330All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Monosiga → Monosiga brevicollis521Open in IMG/M
3300030979|Ga0068589_11914359All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa567Open in IMG/M
3300030992|Ga0074040_11405902All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa506Open in IMG/M
3300030997|Ga0073997_11071330All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa550Open in IMG/M
3300031035|Ga0074026_10866634All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa538Open in IMG/M
3300031057|Ga0170834_101424757All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa557Open in IMG/M
3300031057|Ga0170834_102414941All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa548Open in IMG/M
3300031057|Ga0170834_103452964All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa603Open in IMG/M
3300031057|Ga0170834_109557517All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa518Open in IMG/M
3300031064|Ga0102767_10981316All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa502Open in IMG/M
3300031122|Ga0170822_15273092All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa584Open in IMG/M
3300031128|Ga0170823_10188059All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa627Open in IMG/M
3300031231|Ga0170824_108489961All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa703Open in IMG/M
3300031231|Ga0170824_112566041All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa650Open in IMG/M
3300031231|Ga0170824_115293945All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa547Open in IMG/M
3300031411|Ga0102761_12150675All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa579Open in IMG/M
3300031446|Ga0170820_10205968All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa534Open in IMG/M
3300031446|Ga0170820_14794932All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa580Open in IMG/M
3300031469|Ga0170819_12228610All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa546Open in IMG/M
3300031474|Ga0170818_106345907All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa593Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil88.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil6.99%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.23%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.54%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.54%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009411Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010870Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019212Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028554Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9)EnvironmentalOpen in IMG/M
3300030526Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030532Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030536Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030537Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030540Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030550Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030553Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030563Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030565Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030569Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030574Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030576Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030584Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030585Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030590Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030592Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030597Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030599Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030600Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030601Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030603Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030605Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030607Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030614Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030633Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030634Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030683Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030684Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030782Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030784Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030790Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030804Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030922Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030936Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030959Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030962Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030992Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031064Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0115017_129258813300009411SoilLLNKNKKKNIMSFEHHYMFAQDNTVVLQSEKGGKFLRIHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIMDDGVIDAGGVKGGPYTWFKVHKEKKDGHYKFESIKVHGKYIAVRDDHVVTGVGGEFCVFELFREK*
Ga0102750_1047139913300010870SoilMFAQDNNVVLQSEKGGKYLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRDDEVVSGVGGEYCVFELYREK*
Ga0150984_10460268013300012469Avena Fatua RhizosphereMSYEHHYMFAQDNNVVLQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHNVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGIGGEFCVFELYREK*
Ga0181507_141689813300016705PeatlandMPFENHYMFAQDNVVVIHSEKGGKFIRVHPDNNKKVDHGGVKGGPLTIWHANKEGDKIAFKSDKGGGWLRITEEHVVDADGVKGGPQTWFKVHKVKDGFYKFESVKHEGHYIAVKNDEVTTGSGGPFCEFELFREK
Ga0181500_156156113300016728PeatlandYMFAQDNVVVIHSEKGGKFIRVHPDNNKKVDHGGVKGGPLTIWHANKEGDKIAFKSDKGGGWLRITEEHVVDADGVKGGPQTWFKVHKVKDGFYKFESVKHEGHYIAVKNDEVTTGSGGPFCEFELFREK
Ga0181505_1004344913300016750PeatlandKDKMPFENHYMFAQDNVVVIHSEKGGKFIRVHPDNNKKVDHGGVKGGPLTIWHANKEGDKIAFKSDKGGGWLRITEEHVVDADGVKGGPQTWFKVHKVKDGFYKFESVKHEGHYIAVKNDEVTTGSGGPFCEFELFREK
Ga0180106_102951813300019212Groundwater SedimentKKKKMSYEHHYMFAQDNNVVLQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGGKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRDDEVVSGVGGEFCVFEAFREK
Ga0181510_129375713300019240PeatlandMPFEDDYLFLQDNEVVLHSVKGGKFLRVHPDNNKKVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITEEHKVDADGVKGGPQTWFKVHKIKEGHYKFESVKHEGHYIAVREDEVTTGPGGPFCDFHAFRK
Ga0181508_124105913300019256PeatlandEKKERKMPFEDDYLFLQDNEVVLHSVKGGKFLRVHPDNNKKVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITEEHKVDADGVKGGPQTWFKVHKIKEGHYKFESVKHEGHYIAVREDEVTTGPGGPFCDFHAFRK
Ga0181514_142959813300019268PeatlandLLEISEGKKKRMPFDNHYLFAQNNTVVMYSEKGGKFLRVHPDNNKKVDHGGVKGGPLTIWHAVKDGEKIAFKSDKGGGWLRITEESTIDAAGVEGGPQTWFKVHKESKEGHYKFESVKHTGKYLAVRSDEVVTGIGGEFCVFELFREK
Ga0302047_1027467513300028554SoilMSYEHHYMFAQDNNVVLQSEKGGKYLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRDDEVVSGVGGEYCVFELYREK
Ga0210267_104337813300030526SoilLKVPTYFLQNNSVVLKSERGGKFLRVHPDNNKNVDHGGVQGGPLTIWKAVKDGDKIAFQSNKGGGWLRITESDKIDADGVEGGPQTWFLVHKEKAEGHYKFESVKHKGKYIAVRNDEVVTGVGGEFCEFHAFREK
Ga0210277_1013780313300030528SoilFEHHYLFAQDNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFELFREK
Ga0210277_1061468713300030528SoilMPYDNHYLFAQNNTVVLYSEKGGKFLRVHPDNNKKVDHGGVKGGPLTIWHAVKDGDNIAFKSDKGQGWLRITEEHTIDASGVQGGPQTWFKVHKEKKEGHYKFESVKHSGKFIAVRNDEVVTGIGGEFCVFELFREK
Ga0210277_1069082813300030528SoilMPFEDSYLFKQDNTVVIHSEKGGKFIRVHPDNNKRVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITENHEVDADGVKGGPQTWFKVHHVKEGYYKFESHKHEGYYIAVKNDEVTTGSGGPFCEFHLFREK
Ga0210277_1099579613300030528SoilKDHYLFAKDNIVVIYSEKGGKFIRIHPDNQKKVDHGGVKGGPLTIWHATKDGEKICFKSDKGGGYLRITEEHNVDADGVKGGPQTWFKVHKVKEGHYKFESVKHEGYYIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0210284_121660113300030529SoilYDNHYLFAQNNTVVLYSEKGGKFLRVHPDNNKKVDHGGVKGGPLTIWHAVKDGDNIAFKSDKGQGWLRITEEHTIDASGVQGGPQTWFKVHKEKKEGHYKFESVKHSGKFIAVRNDEVVTGIGGEFCVFELFREK
Ga0210284_144079023300030529SoilARREMSFENHYLFAQDNIVVMHSEKGGKFIRVHPDNNKKVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITENHTVDADGVKGGPQTWFKVHKVKEGFYKFESHKHEGYYVAVKNDEVTTGSGGPFCEFELFREKK
Ga0210274_102172113300030531SoilLFRTRKKKMSFKDHYLFAKDNIVVIYSEKGGKFIRIHPDNQKKVDHGGVKGGPLTIWHATKDGEKICFKSDKGGGYLRITEEHNVDADGVKGGPQTWFKVHKVKEGHYKFESVKHEGYYIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0210274_171446823300030531SoilMPFEDSYLFKQDNTVVIHSEKGGKFIRVHPDNNKRVDHGGVKGGPLTIWFAVKDGDKIAFRSDKGGGWLRITENHEVDADGVKGGPQTWFKVHHVKEGYYKFESHKHEGYYIAVKNDEVTTGSGGPFCEFHLFREK
Ga0210290_142355713300030532SoilMPFEHHYLFAQDNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFHLFREK
Ga0210285_128194013300030535SoilMSFKDHYLFAKDNIVVIYSEKGGKFIRIHPDNQKKVDHGGVKGGPLTIWHATKDGEKICFKSDKGGGYLRITEEHNVDADGVKGGPQTWFKVHKVKEGHYKFESVKHEGYYIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0210285_139545423300030535SoilSFKEHYLFAKDNIVVIYNEKGGKFIRVHPGLHKKVDHGGVKGGPETIWHATKDGDKICFKSDKGGGFLRITEDHKVDAEGVKGGPQTWFKVHKVKEGHYKFESVKHEGDFLAVKSDDVTTGSGGPFCEFEVFRKD
Ga0210266_122971713300030536SoilMPFEHHYLFAQDNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFELFREK
Ga0247642_101138113300030537SoilMPFDHHYLFAQDNVVVLQAEKGGKYLRVHPDNQKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSTVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVAGIGGEYCVFELYREK
Ga0247642_103109613300030537SoilTMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFELYREK
Ga0247642_103830113300030537SoilLIFFFFVTQSIQVKELPFYHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDALVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCV
Ga0247642_104742513300030537SoilMSYEHHYLFAQDNTVVLQSEKGGKYLRVHPDNHKKVDHGGSKGGPLTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVNGIGGEFCVFEVFREK
Ga0247649_108180013300030540SoilMPYEHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGSKGGPMTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESIKVSGQYIAVRSDEVVTGIGGEFCVFELFREK
Ga0247649_109845213300030540SoilVKEMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSLVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELFREK
Ga0210289_106426423300030543SoilMPFDNHYLFAQDNTVVIHSEKGGKFVRVHPDDDKRVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGKGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKEGFYKFESKAHEGKFLAVRDDHVVTGVGGEFCVFELFREK
Ga0210271_1078604113300030545SoilSLFRTRKKKMSFKDHYLFAKDNIVVIYSEKGGKFIRIHPDNQKKVDHGGVKGGPLTIWHATKDGEKICFKSDKGGGYLRITEEHNVDADGVKGGPQTWFKVHKVKEGHYKFESVKHEGYYIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0210271_1094121623300030545SoilMSFKEHYLFAKDNIVVIYNEKGGKFIRVHPGLHKKVDHGGVKGGPETIWHATKDGDKICFKSDKGGGFLRITEDHKVDAEGVKGGPQTWFKVHKVKEGHYKFESVKHEGDFLAVKSDDVTTGSGGPFCEFEVFRKD
Ga0210271_1107419313300030545SoilYLFAQSNTVVLKSERGAKFLRVHPDNNTKVDHGGVKGGPLTIWNAVKEGENIAFESDKGKGWLRITEKHIVDAGGVQGGPQTWFKVHKEKKEGHYKFESLKHEGKFLAVRNDEVVTGEGGEFCVFEVFREK
Ga0247646_110735913300030546SoilMPFDHHYLFAQDNVVVLQAEKGGKYLRVHPDNQKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSTVDADGGKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVAGIGGEYCVFELYREK
Ga0247646_119262013300030546SoilRTMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHDRVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGIKGGPYTWFKVHKEKKDGHYKFESIKVPGKYIAVRNDEVVTGVGGEFCVFELFREK
Ga0247656_110864313300030547SoilMSYEHHYLFAQDNNVVLQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGVKNGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGVGGEFCVFELYREK
Ga0247656_114012513300030547SoilSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHDHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGVKGGPYTWFKVHKEKKDGHYKFESVRIPGKYIAVRDDKVVIGVGGEFCVFELFREK
Ga0210252_1032176013300030548SoilMSFESPYLFLQNNSVVLKSERGGKFLRVHPDNNKNVDHGGVQGGPLTIWKAVKDGDKIAFQSNKGGGWLRITESDKIDADGVEGGPQTWFLVHKEKAEGHYKFESVKHKGKYIAVRNDEVVTGVGGEFCEFHAFREK
Ga0210252_1073977013300030548SoilVEIRKRMPYDNHYLFAQNNTVVLHSERGGKFLRVHPDNQKKVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITEEHQVDAAGVEGGPQTWFKVHREKNEGHYKFESVKHSGKYLAVRNDEVVTGVGGEFCVFELYREK
Ga0210257_1078552113300030549SoilKFVRVHPDDDKRVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGKGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKEGFYKFESKAHEGKFLAVRDDHVVTGVGGEFCVFELFREK
Ga0247631_105168613300030550SoilFCSFFFYPFNTDFLTNCPTNRQAMSYEHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGSKGGPMTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247631_107580713300030550SoilMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFEVYREK
Ga0247631_120552813300030550SoilEHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGTKGGPLTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVNGIGGEFCVFEVFREK
Ga0247638_113107013300030551SoilDCPTNRQAMSYEHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGSKGGPMTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247654_108008313300030552SoilTTFLCSYDKKMSYEHHYMFAQDNNVVIQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHGVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGVGGEFCVFELYREK
Ga0247654_116641113300030552SoilKKKKEERTMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFEVYREK
Ga0247645_120965113300030553SoilSQSIQVKEMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDALVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYYVFELFREK
Ga0247653_107979613300030563SoilKEMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSLVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELFREK
Ga0247653_108559213300030563SoilMPFDNHYLFAQDNVVVLKSEKGGSFLRVHPDNHKKVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDHTIDADGVKGGPQTWFKVHKEKKEGHYKFESVAHSGKYLAVRNDDVVSGIGGEFCVFELFREK
Ga0247635_116524713300030565SoilMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFELYREK
Ga0247635_131463313300030565SoilMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDALVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELFREK
Ga0247628_121503713300030569SoilRKLTNKQAMSYEHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGSKGGPMTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247647_127160223300030570SoilMSFEHHYMFAQDNVVVLKSEKGGHFLRIHPDNHKKVDHGGVKGGPLTIWHANKEGDKIAFKSDKGGGYLRIKDDKTIDADGVKGGPYTWFKVHKEKKDGHYKFESVKVDGQYIAVRNDEVVNGIGGEFCVFEAFREK
Ga0247647_128118713300030570SoilLQAEKGGKYLRVHPDNQKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSTVDADGGKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVAGIGGEYCVFELYRE
Ga0210258_1060521513300030572SoilMPFEHHYLFAQDNTVVIHSEKGGKFLRIHPDDGKKVDHGGMKGGPLTIWHARKDGESIAFKSNKGGKWLRIKEDHSVDADGVEGGPQTWFKVHKVKEGFYKFESKAHARHFLSIKGDKVVSAHSGDYCVFELFREK
Ga0247648_112502813300030574SoilNIITCFAQDNNVVIQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHGVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGVGGEFCVFELYREK
Ga0247648_115187313300030574SoilDFLTNCPTNRQAMSYVHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGSKGGPMTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVNGIGGEFCVFEVFREK
Ga0247648_115696713300030574SoilERTMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFELYREK
Ga0247644_110699213300030576SoilKKKRKRKMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHDHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGVKGGPYTWFKVHKEKKDGHYKFESVRIPGKYIAVRDDKVVIGVGGEFCVFELFREK
Ga0210275_1032262723300030578SoilQDNTVVIHSEKGGKFVRVHPDDDKRVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGKGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKEGFYKFESKAHEGKFLAVRDDHVVTGVGGEFCVFELFREK
Ga0247633_1015499213300030579SoilMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAGGIKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFELYREK
Ga0247633_1017959913300030579SoilMSYEHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGSKGGPMTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247633_1019339713300030579SoilYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGTKGGPLTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVNGIGGEFCVFEVFREK
Ga0247633_1023992513300030579SoilLIFFCNSQSIQVKEMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDALVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELYREK
Ga0210270_157132013300030581SoilMPYDNHYLFAQNNTVVLHSERGGKFLRVHPDNRKKVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITEEHQVDAAGVEGGPQTWFKVHREKNEGHYKFESVKHSGKYLAVRNDEVVTGVGGEFCVFELYREK
Ga0247658_111552713300030584SoilRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFEAYREK
Ga0247639_131262413300030585SoilRKLTNKQAMSYEHHYLFAQDNTVVLQSEKGGKYLRVHPDNHKKVDHGGSKGGPLTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVDGQYIAVRSDEVVSGIGGEFCVFELFREK
Ga0265393_112924613300030586SoilKFIRVHPDNNKRVDHGGVKGGPLTIWFAVKDGDKIAFRSDKGGGWLRITENHEVDADGVKGGPQTWFKVHHVKEGYYKFESHKHEGYYIAVKNDEVTTGSGGPFCEFHLFREK
Ga0265393_117129913300030586SoilSPYLFLQNNSVVLKSERGGKFLRVHPDNNKNVDHGGVQGGPLTIWKAVKDGDKIAFQSNKGGGWLRITESDKIDADGVEGGPQTWFLVHKEKAEGHYKFESVKHKGKYIAVRNDEVVTGVGGEFCEFHAFREK
Ga0210283_112552313300030588SoilMPYDNHYLFAQNNTVVLYSEKGGKFLRVHPDNNKKVDHGGVKGGPLTIWHAVKDGVNIAFKSDKGQGWLRITEEHTIDASGVQGGPQTWFKVHKEKKEGHYKFESVKHSGKFIAVRNDEVVTGIGGEFCVFELFREK
Ga0210283_156260013300030588SoilNKTMPFEHHYLFAQDNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFELFREK
Ga0247643_110595213300030590SoilLGKKQQERTMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESVKVDGRYLAVRNDEVVSGIGGEFCVFELFREK
Ga0247626_117271113300030591SoilFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHDHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGIKGGPYTWFKVHKEKKDGHYKFESVKIPGKYIAVRNDHVVTGVGGEFCVFEIFREK
Ga0247612_112778813300030592SoilYEHHYMFAQDNNVVIQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHGVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGVGGEFCVFELYREK
Ga0247612_116064113300030592SoilAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFEVYREK
Ga0247612_116311313300030592SoilRFFQVRKLTNKQAMSYEHHYLFAQDNTVVLQSEKGGKYLRVHPDNHKKVDHGGSKGGPLTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0210280_107947713300030594SoilMSFKEHYLFAKDNVVVIYSEKGGKFIRVHPDNDKKVDHGGVKGGPLTIWHATKDGEKISFKSEKGGGWLRITENHTVDAEGVKGGPQTWFKVHKVKEGHYKFESVKHEGYFIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0210280_117106313300030594SoilFKDHYLFAKDNIVVIYSEKGGKFIRIHPDNQKKVDHGGVKGGPLTIWHATKDGEKICFKSDKGGGYLRITEEHNVDADGVKGGPQTWFKVHKVKEGHYKFESVKHEGYYIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0210280_120219013300030594SoilSFEHHYLFAQDNIVVIHSEKGGKFIRVHPDNNKKVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITENHTVDADGVKGGPQTWFKVHKVNEGYYKFESHKHEGYYIAVKNDEVTTGSGGPFCEFELFREKK
Ga0210280_121060713300030594SoilKTMPFEHHYLFAQDNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFELFREK
Ga0210276_1004824813300030595SoilMSFEHHYLFAQDNIVVIHSEKGGKFIRVHPDNNKKVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITENHTVDADGVKGGPQTWFKVHKVNEGYYKFESHKHEGYYIAVKNDEVTTGSGGPFCEFELFREKK
Ga0210286_124626013300030597SoilMPYDNHYLFAQNNTVVLHSERGGKFLRVHPDNQKKVDHGGVKGGPLTIWHAVKDGDNIAFKSDKGQGWLRITEEHTIDASGVQGGPQTWFKVHKEKKEGHYKFESVKHSGKFIAVRNDEVVTGIGGEFCVFELFREK
Ga0210286_128506313300030597SoilIFSLKQMSFESPYLFLQNNSVVLKSERGGKFLRVHPDNNKNVDHGGVQGGPLTIWKAVKDGDKIAFQSNKGGGWLRITESDKIDADGVEGGPQTWFLVHKEKAEGHYKFESVKHKGKYIAVRNDEVVTGVGGEFCEFHAFREK
Ga0247630_116383913300030599SoilKMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHDHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGVKGGPYTWFKVHKEKKDGHYKFESVRIPGKYIAVRDDHVVTGIGGEFCVFELFREK
Ga0247659_111132013300030600SoilMPFEHHYLFGQDNVVVIQSEKGGKYIRVHPDDNKKVDHGGVKGGPLTIWHANKEGEKIAFKSDKGHGWLRIDGGEKIDAAGVQGGPQTWFKVHKVKEGHYKFESVSHSGKYIAVRNDEVVIGAGGEYCIFELFREK
Ga0247659_115808813300030600SoilMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSLVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELFKKN
Ga0247659_118607413300030600SoilSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHDHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGIKGGPYTWFKVHKEKKDGHYKFESVRIPGKYIAVRDDKVVIGVGGEFCVFELFREK
Ga0247659_120629113300030600SoilFDHHYLFAQDNVVVLQSDKGNKFLRVNTDNHKKVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDHTIDADGVKGGPQTWFKVHKEKKEGHYKFESVAHSGKYLAVRDDHVVSGIGGEFCVFELFREK
Ga0247659_120825413300030600SoilDNHYLFAQDNVVVLKSEKGGSFLRVHPDNHKKVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDHTIDADGVKGGPQTWFKVHKEKKEGHYKFESVAHSGKYLAVRNDDVVSGIGGEFCVFELFREK
Ga0247650_107696113300030601SoilKKKKMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHDHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGVKGGPYTWFKVHKEKKDGHYKFESVRIPGKYIAVRDDKVVIGVGGEFCVFELFREK
Ga0210254_1055411513300030602SoilMPYDNHYLFAQNNTVVLHSERGGKFLRVHPDNQKKVDHGGVKGGPLTIWHAVKDGDKIAFRSDKGGGWLRITEEHQVDAAGVEGGPQTWFKVHREKNEGHYKFESVKHSGKYLAVRNDEVVTGVGGEFCVFELYREK
Ga0210254_1088107713300030602SoilMPFDNHYLFQQDNTVVLQSERGGRCLRVHPDDNKRVDHGGVKGGPLTIWKAIKDGEKIAFESNAEGGWLRITENSVDAGGVKGGPQTWFKVHKEKAEGRYKFESVAHEGKYVAVREGEVVIGIGGEFCVFEAFREK
Ga0210253_1114501213300030603SoilESPYLFLQNNSVVLKSERGGKFLRVHPDNNKNVDHGGVQGGPLTIWKAVKDGDKIAFQSNKGGGWLRITESDKIDADGVEGGPQTWFLVHKEKAEGHYKFESVKHKGKYIAVRNDEVVTGVGGEFCEFHAFREK
Ga0247637_118180313300030604SoilKKMSYEHHYMFAQDNNVVLQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHGVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGVGGEFCVFELYREK
Ga0210265_111431413300030605SoilLEQERKKMSFKDHYLFAKDNIVVIYSEKGGKFIRIHPDNQKKVDHGGVKGGPLTIWHATKDGEKICFKSDKGGGYLRITEEHNVDADGVKGGPQTWFKVHKVKEGHYKFESVKHEGYYIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0247615_1026715413300030607SoilMSYEHHYLFAQDNTVVLQSEKGGKYLRVHPDNHKKVDHGGSKGGPLTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247651_1019957713300030608SoilHHYMFAQDNNVVIQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHGVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGVGGEFCVFELYREK
Ga0247651_1023489213300030608SoilHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGSKGGPMTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247651_1027601613300030608SoilVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFEVYREK
Ga0247634_1030874313300030609SoilEKRKKKKMSYEHHYMFAQDNNVVLQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGVKNGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRDDQVVSGVGGEFCVFEAYREK
Ga0247634_1031752813300030609SoilLGKKQQERTMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFEVYREK
Ga0247634_1038393513300030609SoilAQDNNVVLQSEKGGKFLRIHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGVKNGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGVGGEFCVFEVYREK
Ga0247634_1050809313300030609SoilMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSLVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELFREK
Ga0247634_1056494313300030609SoilMFAQDNTVVLQSEKGGKFLRVHPDNHDHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGIKGGPYTWFKVHKEKKDGHYKFESVRIPGKYIAVRDDKVVIGVGGEFCVFELFREK
Ga0247657_1005254313300030614SoilMSFEHHYLFAQDNEVVLQSEKGGKFIRIHPDNHKHVDHGGVKGGPLTIWHANKEGDKIAFKSHKGEGYLRIKDDHGVDAEGVKGGPYTWFKVHKEKKDGHYRFESVKVPGRYLAVRNDEVVSGIGGEFCVFEVYRDK
Ga0247657_1017906213300030614SoilMSYEHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGTKGGPLTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247655_1014970413300030621SoilMSYEHHYMFAQDNNVVLQSEKGGKFLRIHPDNHKHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGEGWLRIKEDHTVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVDGRYLAVRNDEVVSGVGGEFCVFELFREK
Ga0247655_1021300823300030621SoilMFAQDNTVVIHSEKGGKFLRVHPDNHKKVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDHTIDADGAKGGPQTWFKVHKEKKDGHYKFESIAHKGAYIAVREDQVVNGSGGEFCVFELFREK
Ga0247655_1028114413300030621SoilSQSIQVKEMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSLVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELFREK
Ga0265392_118534313300030623SoilKKMSFKDHYLFAKDNIVVIYSEKGGKFIRIHPDNQKKVDHGGVKGGPLTIWHATKDGEKICFKSDKGGGYLRITEEHNVDADGVKGGPQTWFKVHKVKEGHYKFESVKHEGYYIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0210259_1077151323300030625SoilGKKKEMSFKEHYLFAKDNIVVIYNEKGGKFIRVHPGLHKKVDHGGVKGGPETIWHATKDGDKICFKSDKGGGFLRITEDHKVDAEGVKGGPQTWFKVHKVKEGHYKFESVKHEGDFLAVKSDDVTTGSGGPFCEFEVFRKD
Ga0210269_1029723913300030627SoilMPFDNPYLFAQSNTVVLKSERGAKFLRVHPDNNTKVDHGGVKGGELTIWHAVKDGEKIAFQSKKGGGWLRITKEHTVDADGVRGGPQTWFKVYKEKNEGRYKFESVEHKGKFLAVRNDEVVTGEGGEFCVFEVFREKE
Ga0210282_1025356623300030630SoilPFEHHYLFAQDNTVVIHIEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFELFREK
Ga0210279_1029625413300030631SoilCSSVIRNHPCPLSDLNAILSPFNRMPYDNHYLFAQNNTVVLYSEKGGKFLRVHPDNNKKVDHGGVKGGPLTIWHAVKDGDNIAFKSDKGQGWLRITEEHTIDASGVQGGPQTWFKVHKEKKEGHYKFESVKHSGKFIAVRNDEVVTGIGGEFCVFELFREK
Ga0247623_1016493513300030633SoilMSYKNHYIFAQDNNVVLQSEKGGKYLRVHPDNHKHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGEGWLRIKDDHSVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGVGGEFCVFELYREK
Ga0247623_1019492213300030633SoilKKNKEERTMSFEHHYMFAQANTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFELYREK
Ga0247636_1030046813300030634SoilFCSFFFYPFNTDFLTNCPTKRQAMSYEHHYLFAQDNTVVLQSEKGGKFLRVHPDNHKKVDHGGSKGGPMTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247636_1032722413300030634SoilQSIQVKEMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSLVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELFREK
Ga0247627_1017192613300030635SoilHFYFFFLIVFCYFKTLGKKTKERTMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAGGIKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFEAYREK
Ga0247627_1024854513300030635SoilFAQDNTVVLQSEKGGKFLRVHPDNHEHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGEKWLRIKDDHSIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDTVVTGVGGEFCVFELFREK
Ga0247627_1035632413300030635SoilVKLLLKKNQRKMPYEHHYMFAQDNVVVIQSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHANKEGEKIAFKSDKGKGWLRIDGGEKVDAAGAQGGPQTWFKVHKVKDGHYKFESVSHHGKYIAVRNDEVVIGTGGEYCVFEVYREK
Ga0247621_112926913300030683SoilKKKKKKKMSFEHHYLFAQDNEVVLQSEKGGKFIRIHPDNHKHVDHGGVKGGPLTIWHANKEGDKIAFKSHKGEGYLRIKDDHGVDAEGVKGGPYTWFKVHKEKKDGHYRFESVKVPGRYLAVRNDEVVSGIGGEFCVFEVYRDK
Ga0247621_115845913300030683SoilFLIFFCNSQSIQVKEMPFDHHYLFAQDNVVVLQAEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFKSDKGGGWLRIKEDSLVDADGAKNGPQTWFKVHKEKKEGHYRFESVAHSGKYLAVRDDKVVSGIGGEYCVFELFREK
Ga0247617_104884923300030684SoilQDNNVVLQSEKGGKFLRVHPDKLKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDADGGKGGPFTWFKVHKEKKDGHYKFESIKVPGRYLAVRNDEVVSGVGGEFCVFEAFREK
Ga0247617_108171623300030684SoilRKLTNKQAMSYEHHYLFAQDNTVVLQSEKGGKYLRVHPDNHKKVDHGGSKGGPLTIWHANKEGDKIAFKSHKGEGYLRITEDKKIDAEGVKGGPYTWFKVHKEKKEGHYKFESVKVSGQYIAVRSDEVVTGIGGEFCVFEVFREK
Ga0247617_109161413300030684SoilSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHNHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQGWLRIKDDHGIDAAGVKGGPYTWFKVHKEKKDGHYKFESIKVPGQYIAVRNDEVVTGVGGEFCVFEVYREK
Ga0247617_112591013300030684SoilFAQDNTVVLQSEKGGKFLRVHPDNHDHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGQNWLRIKDDDTIDAGGVKGGPYTWFKVHKEKKDGHYKFESVRIPGKYIAVRDDKVVIGVGGEFCVFELFREK
Ga0265462_1042323113300030738SoilFIRIHPDDSKKVDHGGVKGGPLTIWHAHKDGESIAFKSDKGGKWLRIKEDHTVDADGVEGGPQTWFKVHRVKEGFYKFESKAHARHFLSVKGDKVVPAHKGDYCIFELFREK
Ga0265462_1193901913300030738SoilLEQAEKKKEMSFKEHYLFAKDNIVVIYNEKGGKFIRVHPGLHKKVDHGGVKGGPETIWHATKDGDKICFKSDKGGGFLRITEDHKVDAEGVKGGPQTWFKVHKVKEGHYKFESVKHEGDFLAVKSDDVTTGSGGPFCEFEVFRKD
Ga0265462_1225730513300030738SoilIRTSEKKKKKKEMSFKEHYLFARDNIVVLYSEKEGKLLRVHTDNNKKVDHGGVKGGPLTIWHATKDGEKISFKSDKGEGFLRITEDHKVDADGVKGGPQTWFKVHKVKEGFYKFESVKHEGHFVAVKNDDVTTGTGGPFCEFEVFRKD
Ga0265462_1235325213300030738SoilMSYENHYLVAEDNTVVLQSERGGRFLRVHPDNNKNVDHGGAKGGPLTIWKATIKDGEKIAFQSKVGGGYLRIFEKKVDAAGRSGEPQIWFKVHKEKNEGYYKFESVADAGTYLAVRDDKVVVGIGGEFCVFETFREK
Ga0265460_1235363613300030740SoilPFDNHYLFQQDNTVVLQSERGGRCLRVHPDDNKRVDHGGVKGGPLTIWKAIKDGEKIAFESNAEGGWLRITENSVDAGGVKGGPQTWFKVHKEKAEGRYKFESVAHEGKYVAVREGEVVIGIGGEFCVFEAFREK
Ga0265460_1236187313300030740SoilPYLFAQSNTVVLKSERGAKFLRVHPDNNTKVDHGGVKGGPLTIWNAVKEGENIAFESDKGKGWLRITEKHIVDAGGVQGGPQTWFKVHKEKKEGHYKFESLKHEGKFLAVRNDEVVTGEGGEFCVFEVFREK
Ga0265460_1247145213300030740SoilFRTSGKKKEMSFKEHYLFAKDNIVVIYNEKGGKFIRVHPGLHKKVDHGGVKGGPETIWHATKDGDKICFKSDKGGGFLRITEDHKVDAEGVKGGPQTWFKVHKVKEGHYKFESVKHEGDFLAVKSDDVTTGSGGPFCEFEVFRKD
Ga0265460_1248657813300030740SoilASHKMSYENHYLVAEDNTVVLQSERGGRFLRVHPDNNKNVDHGGAKGGPLTIWKATIKDGEKIAFQSKVGGGYLRIFEKKVDAAGRSGEPQIWFKVHKEKNEGYYKFESVADAGTYLAVRDDKVVVGIGGEFCVFETFREK
Ga0265459_1266676723300030741SoilMPFDNPYLFAQSNTVVLKSERGAKFLRVHPDNNTKVDHGGVKGGPLTIWNAVKEGENIAFESDKGKGWLRITEKHIVDAGGVQGGPQTWFKVHKEKKEGHYKFESLKHEGKFLAVRNDEVVTGEGGEFCVFEVFREK
Ga0265461_1226823013300030743SoilKKKEMSFKEHYLFAKDNVVVIYSEKGGKFIRVHPDNDKKVDHGGVKGGPLTIWHATKDGEKISFKSEKGGGWLRITENHTVDAEGVKGGPQTWFKVHKVKEGHYKFESVKHEGYFIAVKNDDVTTGSGGPFCEFEVFRKD
Ga0265461_1262074813300030743SoilMSFEHHYLFAQDNTVVIHSEKGGKFLRIHPDDGKKVDHGGMKGGPLTIWHARKDGESIAFKSNKGGKWLRIKEDHSVDADGVEGGPQTWFKVHKVKEGFYKFESKAHARHFLSIKGDKVVSAHSGDYCVFELFREK
Ga0265461_1283641123300030743SoilHYLFAQDNTVVIHSEKGGKFVRVHPDDDKRVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGKGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKEGFYKFESKAHEGKFLAVRDDHVVTGVGGEFCVFELFREK
Ga0265461_1363327113300030743SoilEHHYLFAQDNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVSGQGGEFCVFELFREK
Ga0265461_1380180613300030743SoilNVVVLQSEKGGKFLRIHPDNNKKIDHGGVKGGPLTIWHATKDGDKICFKSEKGGGYLRITQDHQVDADGVKGGPQTWFKVHTIKDGHYKFESIKHSGYYVAVRRDDVTTGPGGPFCEFEVFRKD
Ga0075402_1238817613300030777SoilVLSKTMPYEHHYLFAQNNTVVLHSEKGGKFLRVHPDDTKKVDHGGVKGGPMTIWHAHKEGEKIAFKSDKGGQWLRIDAGEKVDAAGIEGGHQIWFKVHKEKKEGHYKFESVAHSGKYIAVRDDHVVIGTGGEFCVFEVFREK
Ga0075402_1240882213300030777SoilFEHHYMFAQDNTVVLQSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIMDDGVIDAGGVKGGPYTWFKVHKEKKDGHYKFESIKVHGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0075398_1191171913300030778SoilYENHYMFAQDNKVVLQSEKGGKFLRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGQWLRIDGGDKIDAAGIEGGHQIWFKVHKEKKDGHYKFESVAHSGKYIAVRDEHVVIGTGGEFCVFEVFREK
Ga0102754_189306413300030782SoilYEHHYMFAQDNNVVLQSEKGGKYLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRDDEVVSGVGGEYCVFELYREK
Ga0102758_1101499613300030784SoilVTRFFKTNKKKNMSYEHHYMFAQDNNVVLQSEKGGKYLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRDDEVVSGVGGEYCVFELYREK
Ga0138304_119699013300030790SoilAQDNTVVLQSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDASGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0102769_1087097613300030804SoilMPYDHHYLFAQDNNVVIHSEKGGKFLRVHPDDHHKVDHGGVKGGPLTIWHAHKDGDKIAFKSDKGGKWLRIDGGEKIDAEGVEGGNQTWFKVHKVKEGHYKFESHAHSGKYLAVRDDHVVVGTGGEFCVFELFREK
Ga0102769_1112183813300030804SoilKKNKTKTMSFEHHYMFAQDNTVVLQSEKGGKFLRIHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDAGGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0075384_1132217113300030841SoilKKKMPYDNHYMFQQDNNVVIHSEKGGKFLRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSEKGGGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKDGYYKFESKAHEGKYLAVRDDHVVTGVGGEFCVFILFREK
Ga0075404_1152096723300030842SoilQKKKMPYDNHYMFQQDNNVVIHSEKGGKFLRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSEKGGGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKDGYYKFESKAHEGKYLAVRDDHVVTGVGGEFCVFILFREK
Ga0075405_1200305313300030847SoilHHYLFAQNNTVVLHSEKGGKFLRIHPDDHKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGQWLRIDAGEKVDAAGIEGGHQIWFKVHKEKKEGHYKFESVAHHGKYIAVRDDHVVIGTGGEFCVFEVFREK
Ga0075388_1073811813300030848SoilKMPYDNHYMFQQDNNVVIHSEKGGKFLRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSEKGGGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKDGYYKFESKAHEGKYLAVRDDHVVTGVGGEFCVFILFREK
Ga0075387_1089545513300030850SoilYDNHYMFQQDNNVVIHSEKGGKFLRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSEKGGGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKDGYYKFESKAHEGKYLAVRDDHVVTGVGGEFCVFILFREK
Ga0074033_1087459023300030909SoilNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFELFREK
Ga0138300_172843013300030922SoilMSFEHHYMFAQDNTVVLQSEKGGKFLRIHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIMDDGVIDAGGVKGGPYTWFKVHKEKKDGHYKFESIKVHGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0138306_122458613300030936SoilGNTNKTMSYEHHYMFQQDNKVVLHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHANKDGEKIAFKSDKGGGWLRVKEDHSIDAAGVQGGPQTWFKVHKVKDGFYKFESKAHEGKYLAVRDDHVVTGVGGEFCVFELFREK
Ga0138306_137440823300030936SoilVALLNKQKKNIMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDASGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0138299_1098837913300030938SoilFEHHYMFAQDNTVVLQSEKGGKFLRIHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDASGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0102747_1006347123300030959SoilKGGKYLRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHTVDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRDDEVVSGVGGEYCVFELYREK
Ga0138297_161773213300030962SoilFEHHYMFAQDNTVVLQSEKGGKFLRIHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIMDDGVIDAGGVKGGPYTWFKVHKEKKDGHYKFESIKVHGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0075375_1193012413300030971SoilISVLSKTMPYEHHYLFAQNNTVVLHSEKGGKFLRVHPDDTKKVDHGGVKGGPMTIWHAHKEGEKIAFKSDKGGQWLRIDAGEKVDAAGIEGGHQIWFKVHKEKKEGHYKFESVAHSGKYIAVRDDHVVIGTGGEFCVFEVFREK
Ga0075375_1211447313300030971SoilKKNIMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDASGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0075371_1007456813300030974SoilMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDASGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0075371_1177301713300030974SoilMSYEHHYMFAQDNHVVIHSPKGGKFIRVHPDNNKKVDHGGVKGGPLTIWHAHKEGDKIAFKSEKGGGWLRITQDEKIDAEGVEGGPQTWFHVHKEKQDGHYKFESVAHKNKWIAVREDHVVIGGGGEFCVFELFREK
Ga0068589_1127033013300030979SoilFLKKKKKKLIMSYEHHYLFAQDNNVVLQSEKGGKFIRVHPDNHKHVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRIKDDHNVDAEGAKGGPYTWFKVHKEKKDGHYKFESVKVPGRYLAVRNDEVVSGIGGEFCVFELFREK
Ga0068589_1191435913300030979SoilNIMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDASGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0074040_1140590223300030992SoilQDNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFELFREK
Ga0073997_1107133013300030997SoilPFDHHYLFAQDNTVVLHSEKGGKFLRVHPDNHKKVDHGGVKGGPLTIWHANKEGDKIAFKSDKGGGWLRITEEHNIDADGAKGGPQTWFKVHKIKDGFYKFESVKHEGKYLAVRDDHVVSGIGGEYCTFEAFREK
Ga0074026_1086663423300031035SoilTMPFEHHYLFAQDNTVVIHSEKGGKFIRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGKWLRIKEDHNVDADGADGGPQTWFKVHKVKEGFYKFESKAHEGHFLAVKDDHVVAGQGGEFCVFELFREK
Ga0170834_10142475723300031057Forest SoilYEHHYLFAQNNTVVLHSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGGWLRIDGGEHVDAAGIEGGHQVWFKVHKEKKDGHYKFESVAHHGKYIAVRDDHVVIGTGGEFCVFEVFREK
Ga0170834_10241494113300031057Forest SoilPYENHYMFAQNNTVVLHSEKGGKFLRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGQWLRIDGGDKIDAAGIEGGHQIWFKVHKEKKDGFYKFESVAHSGKYIAVRDDHVVIGTGGEFCVFEVFREK
Ga0170834_10345296413300031057Forest SoilKKKKEMSYEHHYMFAQDNNVVLQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGEGWLRIKDDKTIDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVSGQYLAVRNDEVVAGIGGEFCVFELFREK
Ga0170834_10955751713300031057Forest SoilFDNHYLFAQDNTVVLHSEKGGKFLRVHPDNHKKVDHGGVKGGPLTIWHANKEGDKIAFKSDKGGGWLRIKEDHTIDADGAKDGPQTWFKVHKVKEGHYKFESVKHDGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0102767_1098131613300031064SoilFLKKNKTKTMSFEHHYMFAQDNTVVLQSEKGGKFLRIHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDAGGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0170822_1527309213300031122Forest SoilLLYQKKKMPYDNHYMFQQDNNVVIHSEKGGKFLRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSEKGGGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKDGYYKFESKAHEGKYLAVRDDHVVTGVGGEFCVFILFREK
Ga0170823_1018805913300031128Forest SoilMPYDNHYMFQQDNNVVIHSEKGGKFLRVHPDDNKKVDHGGVKGGPLTIWHAHKDGEKIAFKSEKGGGWLRVKEDHSIDAAGVEGGPQTWFKVHKVKDGYYKFESKAHEGKYLAVRDDHVVTGVGGEFCVFILFREK
Ga0170824_10848996113300031231Forest SoilMSFEHHYMFAQDNTVVLQSEKGGKFLRVHPDNHKHVDHGGVKGGPLTIWHANKEGDKIAFQSHKGEGWLRIKDDKTIDAEGVKGGPYTWFKVHKEKKDGHYKFESVKVSGQYLAVRNDEVVAGIGGEFCVFELFREK
Ga0170824_11256604113300031231Forest SoilMPYEHHYLFAQNNTVVLHSEKGGKFLRVHPDDTKKVDHGGVKGGPMTIWHAHKEGEKIAFKSDKGGQWLRIDAGEKVDAAGIEGGHQIWFKVHKEKKEGHYKFESVAHSGKYIAVRDDHVVIGTGGEFCVFEVFREK
Ga0170824_11529394523300031231Forest SoilFAQNNTVVLHSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGGWLRIDGGEHVDAAGIEGGHQVWFKVHKEKKDGHYKFESVAHHGKYIAVRDDHVVIGTGGEFCVFEVFREK
Ga0102761_1215067513300031411SoilFEHHYMFAQDNTVVLQSEKGGKFLRIHPDDHKKVDHGGVKGGPLTIWHANKEGEKIAFQSHKGEGWLRILDDGVIDAGGVKGGPYTWFKVHKEKKDGHYKFESVKVSGKYIAVRDDHVVTGVGGEFCVFELFREK
Ga0170820_1020596823300031446Forest SoilYEHHYLFAQNNTVVLHSEKGGKFLRVHPDDHKKVDHGGGKGGPLTIWHAHKDGEKIAFKSDKGGQWLRIDAGEKVDAAGIEGGHQIWFKVHKEKKEGHYKFESVAHHGKYIAVRDDHVVIGTGGEFCVFELFREK
Ga0170820_1479493213300031446Forest SoilMPYEHHYLFAQNNTVVLHSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGGWLRIDGGEHVDAAGIEGGHQVWFKVHKEKKDGHYKFESVAHHGKYIAVRDDHVVIGTGGEFCVFEVFREK
Ga0170819_1222861013300031469Forest SoilMPYEHHYLFAQNNTVVLHSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGQWLRIDAGEKVDAAGIEGGHQIWFKVHKEKKEGHYKFESVAHHGKYIAVRDDHVVIGTGGEFCVFELFREK
Ga0170818_10634590713300031474Forest SoilYLFAQNNTVVLHSEKGGKFLRVHPDDHKKVDHGGVKGGPLTIWHAHKDGEKIAFKSDKGGQWLRIDAGEKVDAAGIEGGHQIWFKVHKEKKEGHYKFESVAHHGKYIAVRDDHVVIGTGGEFCVFELFREK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.