Metagenome / Metatranscriptome Family F029361

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F029361
Family Type	Metagenome / Metatranscriptome
Number of Sequences	188
Average Sequence Length	38 residues
Representative Sequence	LPNQRMKLSWRGGRLKGNGSILIAAAAPRSLCAIR
Number of Associated Samples	75
Number of Associated Scaffolds	184

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	20.32 %
% of genes near scaffold ends (potentially truncated)	79.26 %
% of genes from short scaffolds (< 2000 bps)	80.85 %
Associated GOLD sequencing projects	74
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (60.106 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (34.575 % of family members)
Environment Ontology (ENVO)	Unclassified (29.255 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (38.298 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 6.35% β-sheet: 0.00% Coil/Unstructured: 93.65%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 184 Family Scaffolds
PF07179	SseB	0.54
PF10604	Polyketide_cyc2	0.54
PF14018	DUF4234	0.54
PF13540	RCC1_2	0.54
PF15589	Imm21	0.54
PF03033	Glyco_transf_28	0.54
PF13495	Phage_int_SAM_4	0.54
PF12847	Methyltransf_18	0.54
PF04365	BrnT_toxin	0.54
PF10077	DUF2314	0.54
PF12158	DUF3592	0.54
PF00903	Glyoxalase	0.54
PF01042	Ribonuc_L-PSP	0.54
PF09346	SMI1_KNR4	0.54
PF03544	TonB_C	0.54
PF07007	LprI	0.54
PF04229	GrpB	0.54
PF13620	CarboxypepD_reg	0.54
PF13279	4HBT_2	0.54
PF14384	BrnA_antitoxin	0.54
PF05163	DinB	0.54
PF01694	Rhomboid	0.54
PF03992	ABM	0.54
PF12706	Lactamase_B_2	0.54
PF11622	DUF3251	0.54
PF09413	DUF2007	0.54
PF14317	YcxB	0.54
PF13787	HXXEE	0.54
PF09932	DUF2164	0.54
PF02517	Rce1-like	0.54
PF14534	DUF4440	0.54
PF13649	Methyltransf_25	0.54
PF06291	Lambda_Bor	0.54
PF15580	Imm53	0.54

COG ID	Name	Functional Category	% Frequency in 184 Family Scaffolds
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.54
COG0705	Membrane-associated serine protease, rhomboid family	Posttranslational modification, protein turnover, chaperones [O]	0.54
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.54
COG1266	Membrane protease YdiL, CAAX protease family	Posttranslational modification, protein turnover, chaperones [O]	0.54
COG2318	Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.54
COG2320	GrpB domain, predicted nucleotidyltransferase, UPF0157 family	General function prediction only [R]	0.54
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.54
COG3755	Uncharacterized conserved protein YecT, DUF1311 family	Function unknown [S]	0.54
COG4449	Predicted protease, Abi (CAAX) family	General function prediction only [R]	0.54

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
All Organisms	root	All Organisms	39.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
cellular organisms	root	All Organisms → cellular organisms	39.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	39.89 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	6.38 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	5.85 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.60 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.60 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	1.60 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.60 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.53 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	6.38 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.13 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	1.60 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.06 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	1.06 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.06 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	1.06 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.53 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.53 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.53 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.53 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.53 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.53 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	4.26 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	1.60 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	1.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.06 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.06 %
Candidatus Eisenbacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
unclassified Actinobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria	0.53 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.53 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.53 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.53 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.53 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	0.53 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.53 %
Opitutae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	0.53 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.53 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.53 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.53 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4.26 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	1.60 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	1.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.06 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.53 %
Candidatus Eisenbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium	0.53 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.53 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.53 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.53 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.53 %
Planctomycetes bacterium ADurb.Bin126	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126	0.53 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.53 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.53 %
Opitutales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales	0.53 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.53 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.53 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4.26 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	1.60 %
unclassified Gemmatimonadales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales	1.06 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.06 %
Prochlorococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	0.53 %
Opitutaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae	0.53 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.53 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	0.53 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.53 %
Candidatus Eisenbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium	0.53 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.53 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.53 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.53 %
Planctomycetes bacterium ADurb.Bin126	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126	0.53 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.53 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.53 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.53 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4.26 %
unclassified Nitrospira	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira	1.60 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	1.06 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.06 %
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	0.53 %
Cyanobium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	0.53 %
Opitutus	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus	0.53 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.53 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.53 %
Candidatus Eisenbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium	0.53 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.53 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.53 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.53 %
Planctomycetes bacterium ADurb.Bin126	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126	0.53 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.53 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.53 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.53 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4.26 %
Nitrospira sp.	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	1.60 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	1.06 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.06 %
unclassified Opitutus	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus	0.53 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.53 %
unclassified Cyanobium	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium	0.53 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.53 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.53 %
Candidatus Eisenbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium	0.53 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.53 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.53 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.53 %
Planctomycetes bacterium ADurb.Bin126	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126	0.53 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.53 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.53 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.53 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	60.11 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4.26 %
Nitrospira sp.	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	1.60 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	1.06 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.06 %
Opitutus sp. ER46	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. ER46	0.53 %
Cyanobium sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp.	0.53 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.53 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.53 %
Actinobacteria bacterium 13_1_40CM_4_65_12	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	0.53 %
Candidatus Eisenbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium	0.53 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.53 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.53 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.53 %
Planctomycetes bacterium ADurb.Bin126	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126	0.53 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.53 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.53 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.53 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.53 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005471\|Ga0070698_100109281	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2732	Open in IMG/M
3300005471\|Ga0070698_100259467	Not Available	1670	Open in IMG/M
3300005554\|Ga0066661_10056490	Not Available	2260	Open in IMG/M
3300005555\|Ga0066692_10115224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1613	Open in IMG/M
3300005713\|Ga0066905_100639636	Not Available	905	Open in IMG/M
3300005764\|Ga0066903_107456446	Not Available	565	Open in IMG/M
3300005875\|Ga0075293_1042191	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300005879\|Ga0075295_1038019	Not Available	622	Open in IMG/M
3300006049\|Ga0075417_10219405	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300006057\|Ga0075026_100996573	Not Available	521	Open in IMG/M
3300006806\|Ga0079220_11102436	Not Available	643	Open in IMG/M
3300006844\|Ga0075428_101517772	Not Available	702	Open in IMG/M
3300006845\|Ga0075421_100087592	All Organisms → cellular organisms → Bacteria	3925	Open in IMG/M
3300006847\|Ga0075431_100081948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3331	Open in IMG/M
3300006847\|Ga0075431_101321702	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300006847\|Ga0075431_101873641	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	555	Open in IMG/M
3300006852\|Ga0075433_10307289	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1404	Open in IMG/M
3300006852\|Ga0075433_11591160	Not Available	564	Open in IMG/M
3300006854\|Ga0075425_100022053	All Organisms → cellular organisms → Bacteria	6983	Open in IMG/M
3300006854\|Ga0075425_100054071	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	4496	Open in IMG/M
3300006854\|Ga0075425_100080117	All Organisms → cellular organisms → Bacteria → Acidobacteria	3690	Open in IMG/M
3300006854\|Ga0075425_100092712	All Organisms → cellular organisms → Bacteria → Proteobacteria	3426	Open in IMG/M
3300006854\|Ga0075425_100611334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	1253	Open in IMG/M
3300006854\|Ga0075425_100802732	Not Available	1078	Open in IMG/M
3300006854\|Ga0075425_101728129	Not Available	703	Open in IMG/M
3300006854\|Ga0075425_102003088	Not Available	647	Open in IMG/M
3300006854\|Ga0075425_102059519	Not Available	637	Open in IMG/M
3300006854\|Ga0075425_102141025	Not Available	624	Open in IMG/M
3300006854\|Ga0075425_102905952	Not Available	525	Open in IMG/M
3300006871\|Ga0075434_100151023	All Organisms → cellular organisms → Bacteria	2343	Open in IMG/M
3300006871\|Ga0075434_100151023	All Organisms → cellular organisms → Bacteria	2343	Open in IMG/M
3300006871\|Ga0075434_100192597	Not Available	2059	Open in IMG/M
3300006871\|Ga0075434_100299204	Not Available	1629	Open in IMG/M
3300006871\|Ga0075434_101195231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	772	Open in IMG/M
3300006871\|Ga0075434_101328231	Not Available	730	Open in IMG/M
3300006871\|Ga0075434_101414317	Not Available	705	Open in IMG/M
3300006871\|Ga0075434_101483534	Not Available	687	Open in IMG/M
3300006871\|Ga0075434_101598331	Not Available	660	Open in IMG/M
3300006871\|Ga0075434_101662536	Not Available	647	Open in IMG/M
3300006871\|Ga0075434_102148800	Not Available	562	Open in IMG/M
3300006871\|Ga0075434_102176928	Not Available	558	Open in IMG/M
3300006871\|Ga0075434_102510370	Not Available	516	Open in IMG/M
3300006880\|Ga0075429_100067258	Not Available	3118	Open in IMG/M
3300006880\|Ga0075429_100425134	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	1163	Open in IMG/M
3300006903\|Ga0075426_10256776	Not Available	1273	Open in IMG/M
3300006903\|Ga0075426_10926862	Not Available	657	Open in IMG/M
3300006903\|Ga0075426_11347740	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300006904\|Ga0075424_100200502	All Organisms → cellular organisms → Bacteria	2119	Open in IMG/M
3300006904\|Ga0075424_100353894	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12	1564	Open in IMG/M
3300006904\|Ga0075424_100448177	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126	1377	Open in IMG/M
3300006904\|Ga0075424_100829588	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300006904\|Ga0075424_101061115	Not Available	863	Open in IMG/M
3300006904\|Ga0075424_101507819	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300006904\|Ga0075424_101547384	Not Available	703	Open in IMG/M
3300006904\|Ga0075424_101588727	Not Available	693	Open in IMG/M
3300006904\|Ga0075424_101805000	Not Available	647	Open in IMG/M
3300006904\|Ga0075424_101811547	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300006904\|Ga0075424_101902629	Not Available	628	Open in IMG/M
3300006904\|Ga0075424_102138658	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	589	Open in IMG/M
3300006904\|Ga0075424_102659635	Not Available	523	Open in IMG/M
3300006904\|Ga0075424_102679946	Not Available	520	Open in IMG/M
3300006914\|Ga0075436_100081790	Not Available	2239	Open in IMG/M
3300006914\|Ga0075436_100161163	Not Available	1581	Open in IMG/M
3300006914\|Ga0075436_100170728	Not Available	1536	Open in IMG/M
3300006914\|Ga0075436_100342376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1077	Open in IMG/M
3300006914\|Ga0075436_101567658	Not Available	501	Open in IMG/M
3300006969\|Ga0075419_10460595	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300006969\|Ga0075419_10542016	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	812	Open in IMG/M
3300007076\|Ga0075435_100739643	Not Available	855	Open in IMG/M
3300009012\|Ga0066710_101325507	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1117	Open in IMG/M
3300009147\|Ga0114129_10134073	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp.	3400	Open in IMG/M
3300009147\|Ga0114129_10376643	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1875	Open in IMG/M
3300009147\|Ga0114129_10447493	Not Available	1694	Open in IMG/M
3300009147\|Ga0114129_11954658	Not Available	710	Open in IMG/M
3300009147\|Ga0114129_12289735	Not Available	649	Open in IMG/M
3300010043\|Ga0126380_12303031	Not Available	500	Open in IMG/M
3300010047\|Ga0126382_10052924	Not Available	2389	Open in IMG/M
3300010047\|Ga0126382_10192785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1442	Open in IMG/M
3300010047\|Ga0126382_11730389	Not Available	585	Open in IMG/M
3300010047\|Ga0126382_12321082	Not Available	519	Open in IMG/M
3300010358\|Ga0126370_10384074	Not Available	1148	Open in IMG/M
3300010359\|Ga0126376_10018527	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4502	Open in IMG/M
3300010359\|Ga0126376_10024164	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	4019	Open in IMG/M
3300010359\|Ga0126376_10644722	Not Available	1009	Open in IMG/M
3300010359\|Ga0126376_10896972	Not Available	876	Open in IMG/M
3300010359\|Ga0126376_11209381	Not Available	771	Open in IMG/M
3300010359\|Ga0126376_11365281	Not Available	732	Open in IMG/M
3300010359\|Ga0126376_11529268	Not Available	697	Open in IMG/M
3300010359\|Ga0126376_11931655	Not Available	631	Open in IMG/M
3300010359\|Ga0126376_12680903	Not Available	547	Open in IMG/M
3300010360\|Ga0126372_13152204	Not Available	512	Open in IMG/M
3300010361\|Ga0126378_13190968	All Organisms → cellular organisms → Bacteria → Proteobacteria	521	Open in IMG/M
3300010362\|Ga0126377_10937337	All Organisms → cellular organisms → Bacteria	930	Open in IMG/M
3300010362\|Ga0126377_11335769	All Organisms → cellular organisms → Bacteria	789	Open in IMG/M
3300010362\|Ga0126377_11406916	Not Available	770	Open in IMG/M
3300010362\|Ga0126377_12262891	Not Available	620	Open in IMG/M
3300010362\|Ga0126377_12284979	Not Available	617	Open in IMG/M
3300010362\|Ga0126377_12365495	Not Available	607	Open in IMG/M
3300010362\|Ga0126377_13603924	Not Available	501	Open in IMG/M
3300010366\|Ga0126379_11531516	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300010366\|Ga0126379_12505821	Not Available	614	Open in IMG/M
3300010366\|Ga0126379_13039533	Not Available	561	Open in IMG/M
3300010366\|Ga0126379_13864961	Not Available	502	Open in IMG/M
3300010366\|Ga0126379_13865275	Not Available	502	Open in IMG/M
3300010398\|Ga0126383_10172551	Not Available	2044	Open in IMG/M
3300010398\|Ga0126383_13320021	Not Available	526	Open in IMG/M
3300011444\|Ga0137463_1066603	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	1348	Open in IMG/M
3300011444\|Ga0137463_1354363	Not Available	527	Open in IMG/M
3300012096\|Ga0137389_10393247	Not Available	1183	Open in IMG/M
3300012209\|Ga0137379_11048656	Not Available	720	Open in IMG/M
3300012211\|Ga0137377_10699747	Not Available	948	Open in IMG/M
3300012400\|Ga0134048_1040032	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300012931\|Ga0153915_10167998	All Organisms → cellular organisms → Bacteria	2389	Open in IMG/M
3300012931\|Ga0153915_10569702	All Organisms → cellular organisms → Bacteria	1300	Open in IMG/M
3300012931\|Ga0153915_10800869	All Organisms → cellular organisms → Bacteria	1092	Open in IMG/M
3300012931\|Ga0153915_11957981	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300012931\|Ga0153915_12972622	Not Available	552	Open in IMG/M
3300012931\|Ga0153915_13010001	Not Available	549	Open in IMG/M
3300012931\|Ga0153915_13146989	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300012948\|Ga0126375_10222229	All Organisms → cellular organisms → Bacteria	1257	Open in IMG/M
3300012948\|Ga0126375_10782143	Not Available	753	Open in IMG/M
3300012948\|Ga0126375_10790983	Not Available	750	Open in IMG/M
3300012948\|Ga0126375_10875157	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	719	Open in IMG/M
3300012948\|Ga0126375_11002939	Not Available	680	Open in IMG/M
3300012948\|Ga0126375_11956326	Not Available	517	Open in IMG/M
3300012948\|Ga0126375_12069795	Not Available	505	Open in IMG/M
3300012971\|Ga0126369_11136434	Not Available	870	Open in IMG/M
3300017930\|Ga0187825_10016486	Not Available	2468	Open in IMG/M
3300017930\|Ga0187825_10086447	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	1078	Open in IMG/M
3300017930\|Ga0187825_10244198	Not Available	656	Open in IMG/M
3300017930\|Ga0187825_10251678	Not Available	648	Open in IMG/M
3300017936\|Ga0187821_10182566	Not Available	802	Open in IMG/M
3300017936\|Ga0187821_10468289	Not Available	524	Open in IMG/M
3300017961\|Ga0187778_10798877	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. ER46	643	Open in IMG/M
3300017961\|Ga0187778_11106076	Not Available	552	Open in IMG/M
3300017974\|Ga0187777_10793499	Not Available	676	Open in IMG/M
3300017994\|Ga0187822_10124536	Not Available	808	Open in IMG/M
3300017994\|Ga0187822_10124536	Not Available	808	Open in IMG/M
3300017994\|Ga0187822_10215778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	646	Open in IMG/M
3300017994\|Ga0187822_10362224	Not Available	526	Open in IMG/M
3300018063\|Ga0184637_10780436	Not Available	511	Open in IMG/M
3300018064\|Ga0187773_10728941	Not Available	622	Open in IMG/M
3300019360\|Ga0187894_10188943	Not Available	1015	Open in IMG/M
3300019360\|Ga0187894_10299430	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300019458\|Ga0187892_10095796	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	1791	Open in IMG/M
3300019458\|Ga0187892_10221617	Not Available	993	Open in IMG/M
3300019487\|Ga0187893_10095555	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2649	Open in IMG/M
3300019487\|Ga0187893_10191462	All Organisms → cellular organisms → Bacteria	1587	Open in IMG/M
3300024245\|Ga0247677_1010829	Not Available	1273	Open in IMG/M
3300024245\|Ga0247677_1018442	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300024246\|Ga0247680_1021526	Not Available	935	Open in IMG/M
3300024249\|Ga0247676_1000456	All Organisms → cellular organisms → Bacteria	6001	Open in IMG/M
3300024249\|Ga0247676_1020439	Not Available	1045	Open in IMG/M
3300024317\|Ga0247660_1024740	Not Available	953	Open in IMG/M
3300024317\|Ga0247660_1024795	Not Available	952	Open in IMG/M
3300024317\|Ga0247660_1029485	Not Available	879	Open in IMG/M
3300024317\|Ga0247660_1035672	Not Available	804	Open in IMG/M
3300024325\|Ga0247678_1004995	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1825	Open in IMG/M
3300025910\|Ga0207684_11270977	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	607	Open in IMG/M
3300025922\|Ga0207646_10059900	All Organisms → cellular organisms → Bacteria	3400	Open in IMG/M
3300027909\|Ga0209382_10111940	All Organisms → cellular organisms → Bacteria	3189	Open in IMG/M
3300027950\|Ga0209885_1027858	Not Available	626	Open in IMG/M
3300027961\|Ga0209853_1007491	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium	3392	Open in IMG/M
3300028072\|Ga0247675_1030256	Not Available	789	Open in IMG/M
3300028784\|Ga0307282_10320765	Not Available	748	Open in IMG/M
3300028803\|Ga0307281_10224644	Not Available	683	Open in IMG/M
3300031576\|Ga0247727_10297305	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1374	Open in IMG/M
3300031716\|Ga0310813_11094930	Not Available	730	Open in IMG/M
3300031716\|Ga0310813_11986752	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300031720\|Ga0307469_12349394	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	520	Open in IMG/M
3300032205\|Ga0307472_102701028	Not Available	507	Open in IMG/M
3300032782\|Ga0335082_10049058	All Organisms → cellular organisms → Bacteria	4373	Open in IMG/M
3300033412\|Ga0310810_10032531	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	6365	Open in IMG/M
3300033412\|Ga0310810_10032531	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	6365	Open in IMG/M
3300033412\|Ga0310810_10157474	Not Available	2629	Open in IMG/M
3300033433\|Ga0326726_10010910	All Organisms → cellular organisms → Bacteria	8024	Open in IMG/M
3300033433\|Ga0326726_10010910	All Organisms → cellular organisms → Bacteria	8024	Open in IMG/M
3300033433\|Ga0326726_10050040	All Organisms → cellular organisms → Bacteria	3654	Open in IMG/M
3300033433\|Ga0326726_10753700	All Organisms → cellular organisms → Bacteria	941	Open in IMG/M
3300033433\|Ga0326726_10991122	Not Available	816	Open in IMG/M
3300033805\|Ga0314864_0125663	Not Available	641	Open in IMG/M
3300033811\|Ga0364924_003517	All Organisms → cellular organisms → Bacteria	2715	Open in IMG/M
3300033811\|Ga0364924_079363	Not Available	727	Open in IMG/M
3300034090\|Ga0326723_0010760	All Organisms → cellular organisms → Bacteria	3593	Open in IMG/M
3300034090\|Ga0326723_0067955	Not Available	1519	Open in IMG/M
3300034090\|Ga0326723_0162847	Not Available	982	Open in IMG/M
3300034164\|Ga0364940_0127763	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.43%
Host-Associated	Host-Associated	34.57%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	54.26%
Plants	Host-Associated → Plants	34.57%
Aquatic	Environmental → Aquatic	11.17%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	44.68%
Rhizosphere	Host-Associated → Plants → Rhizosphere	34.57%
Freshwater	Environmental → Aquatic → Freshwater	9.04%
Peat	Environmental → Terrestrial → Peat	4.26%
Cave	Environmental → Terrestrial → Cave	3.72%
Sediment	Environmental → Aquatic → Sediment	2.13%
Floodplain	Environmental → Terrestrial → Floodplain	1.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	34.57%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	9.04%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.26%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.26%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	3.72%
Loam	Environmental → Terrestrial → Soil → Loam	3.19%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.13%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.60%
Sand	Environmental → Terrestrial → Soil → Sand	1.06%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	34.57%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.13%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.91%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	5.32%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.26%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.26%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.72%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	3.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.13%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.13%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.60%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.60%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.06%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.06%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.53%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	34.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	21.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.85%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	5.32%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	4.26%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	3.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.72%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.13%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.13%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	2.13%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.60%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.60%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.06%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.06%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.06%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.06%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.06%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.06%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	1.06%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.53%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.53%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.53%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.53%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.53%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.53%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.53%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.53%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005875	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101	Environmental	Open in IMG/M
3300005879	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012400	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental	Open in IMG/M
3300024245	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18	Environmental	Open in IMG/M
3300024246	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21	Environmental	Open in IMG/M
3300024249	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17	Environmental	Open in IMG/M
3300024317	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01	Environmental	Open in IMG/M
3300024325	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027950	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes)	Environmental	Open in IMG/M
3300027961	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)	Environmental	Open in IMG/M
3300028072	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033805	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10	Environmental	Open in IMG/M
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034164	Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070698_1001092813	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MAWDMLPNQRMKLAWRGGRSKGNGSILMAAAAPRSLCAIR*
Ga0070698_1002594671	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MITQGLALPNQRMKLSWSGGRLKGNWSLLMAAAAPRSLCAIR*
Ga0066661_100564905	3300005554	Soil	MGGLPNQRMKLSWRGGRLKGKGSVLMAAAAPRSLCAI
Ga0066692_101152241	3300005555	Soil	RPNQRMKLSWRGGRSKGNGSLLIAAAAPRSLSAIR*
Ga0066905_1006396362	3300005713	Tropical Forest Soil	IGSPLANQRMKLSWRGGRLKGNRSTLMAAAAPRSLCAIR*
Ga0066903_1074564462	3300005764	Tropical Forest Soil	PNQRMKLSWRGGRLKGNGSILMAAAAPRSLCAIR*
Ga0075293_10421911	3300005875	Rice Paddy Soil	PPNQRLKLSGCGGRLKGNWLVLIAAASPRSLSAIR*
Ga0075295_10380192	3300005879	Rice Paddy Soil	PPNQRLKLSGCGGRLKGNGSVLIAAAAPRSLSAIR*
Ga0075417_102194051	3300006049	Populus Rhizosphere	PNMRMKLSWRGGRLKGNWSIVMAAAAPRSLCAIR*
Ga0075026_1009965731	3300006057	Watersheds	PNQRMKLSWRGGRSKGNGSVLMAAAAPRSLCAIR*
Ga0079220_111024361	3300006806	Agricultural Soil	PLPNQRMKLSWRGGRLKGKRSVLMAAAAPRSLCAIR*
Ga0075428_1015177721	3300006844	Populus Rhizosphere	PPNQRLKLSGCGGRLKGNGSLLIAAAAPRSLSAIR*
Ga0075421_1000875921	3300006845	Populus Rhizosphere	LPRQPNMRLKLTGRGGRLKGKRSVLIAAAAPRSLSAIR*
Ga0075431_1000819488	3300006847	Populus Rhizosphere	PNQRLKLSGCGGRLKGNGSLLIAAAAPRSLSAIR*
Ga0075431_1013217022	3300006847	Populus Rhizosphere	PNLRLKLSGCGGRLKGRGSFLIAAAAPRCLSAIR*
Ga0075431_1018736411	3300006847	Populus Rhizosphere	PMLRPNQRLKLPGRGGRLLGNVSLLIAAAAPRSLSAIR*
Ga0075433_103072893	3300006852	Populus Rhizosphere	MLASNVLPNQRMKLSWRGGRLKGNGSIVIAAAAPRSLCAIR*
Ga0075433_115911603	3300006852	Populus Rhizosphere	LPNQRMKLAWRGGRLKGNGSIVMAAAAPRSLCAIR*
Ga0075425_1000220532	3300006854	Populus Rhizosphere	MDQKPRMNALPNLRMKLSWRGGRLKGNGSLLMVAAAPRSLCAIR*
Ga0075425_1000540718	3300006854	Populus Rhizosphere	MDCVVPPNMRMKLSWHGGRLKGNGSILMAAAAPRSLCAIR*
Ga0075425_1000801174	3300006854	Populus Rhizosphere	MKRTLPNQRLKLSGRGGRLKGKGSVLIAAAAPRSLSAIR*
Ga0075425_1000927121	3300006854	Populus Rhizosphere	ASVAPNMRMKLSWRGGRLKGKDSILMAAAAPRSLCAIR*
Ga0075425_1006113341	3300006854	Populus Rhizosphere	MLDMVFASLPSNQRMKLTWRGGRLKGNGSVLMAAAAPRSLCAIR*
Ga0075425_1008027322	3300006854	Populus Rhizosphere	MPAPNMRMKLAWRGGRSKGKGSVLMAAAAPRSLCAIR*
Ga0075425_1017281291	3300006854	Populus Rhizosphere	PPNQRMKLTWRGGRLKGKGSILIAAAAPRSLCAIR*
Ga0075425_1020030881	3300006854	Populus Rhizosphere	MALPNQRMKLPWRGGRSKGNAFLLMAAAAPRSLCAIR*
Ga0075425_1020595192	3300006854	Populus Rhizosphere	ARTRHGSQMGMLPNQRMKLSRRGGHLWWNTKGQPSFLMVAAPPRSLCAIR*
Ga0075425_1021410252	3300006854	Populus Rhizosphere	LPNQRMKLSWRGGRVKGKGSTLMAAAAPRSLCAIR*
Ga0075425_1029059522	3300006854	Populus Rhizosphere	LAQPNQRMKLPWRGGRLKGKRSILIAAAAPRSLCAIR*
Ga0075434_1001510231	3300006871	Populus Rhizosphere	LPPNQRMKLSWRGGRLKGNGSIVMAAAAPRSLCAFR*
Ga0075434_1001510235	3300006871	Populus Rhizosphere	MQLNMLPNQRMKLSWRGGRSKGNGSILMAAAAPRSLCAIR*
Ga0075434_1001925973	3300006871	Populus Rhizosphere	LPNQRMKLSWRGGRLKGKGSFLMAAAAPRSLCAIR*
Ga0075434_1002992045	3300006871	Populus Rhizosphere	PNQRMKLSWRGARLKGNGSILMAAAAPRSLCAIR*
Ga0075434_1011952311	3300006871	Populus Rhizosphere	RGGPPNQRMKLSWRGGRLKGKGSVLIAAAAPRTLCAIR*
Ga0075434_1013282311	3300006871	Populus Rhizosphere	PLPNQRMKLAWRGGRLKGNWSTLIAAAAPRSLCAIR*
Ga0075434_1014143172	3300006871	Populus Rhizosphere	LGPLPNQRMKLSWRGGRFKWKGSILLAAAAPRSLCAIR*
Ga0075434_1014835341	3300006871	Populus Rhizosphere	PNQRMKLPWRGGRLKGNGSILLAAAAPRSLCAIR*
Ga0075434_1015983311	3300006871	Populus Rhizosphere	HVVDPTGVLPNQRMKLPWRGGRSKGKGFILMAAAAPRSLCAIR*
Ga0075434_1016625361	3300006871	Populus Rhizosphere	MGPRVPLPNQRMKLSWRGGRLKGNGSILMAAAAPRS
Ga0075434_1021488001	3300006871	Populus Rhizosphere	ALPNQRMKLSWRSGRSKGNGSILIAAAAPRSLCAIR*
Ga0075434_1021769282	3300006871	Populus Rhizosphere	LPNMRMKLSWRGGRVKGKSSILIAAAAPRSLCAIR*
Ga0075434_1025103701	3300006871	Populus Rhizosphere	LPNQRMKLSWRGGRLKGNGSILIAAAAPRSLCAIR*
Ga0075429_1000672585	3300006880	Populus Rhizosphere	VGVSEAVLPNQRMKLSWRGGRLKGKGSVLIAAAAPRSLCAIR*
Ga0075429_1004251344	3300006880	Populus Rhizosphere	PNQRMKLSWRGGRLKGKRSILIAAAAPRSLCAIR*
Ga0075426_102567762	3300006903	Populus Rhizosphere	MVSICVDMLPNQRMKLPWRGGRLKENGSVSMAAAAPRSLCAIR*
Ga0075426_109268622	3300006903	Populus Rhizosphere	GLPNQRMKLSWRGGRLKGKGSFLMAAAAPRSLCAIR*
Ga0075426_113477401	3300006903	Populus Rhizosphere	PNQRMKLAWRGGRSKGNGLILMAAAAPRSLCAIR*
Ga0075424_1002005024	3300006904	Populus Rhizosphere	MMTYECPPLPNQRMKLSWRGGRLKGKGSVLIAAAAPRSLCAIR*
Ga0075424_1003538941	3300006904	Populus Rhizosphere	KRPNMRLKLAARGGRSKGNGSVLMAAAAGRSLSAIR*
Ga0075424_1004481774	3300006904	Populus Rhizosphere	AGLPNQRMKLSWRGGRLKGKGSFLMAAAAPRSLCAIR*
Ga0075424_1008295883	3300006904	Populus Rhizosphere	MLRPNQRLKLPGRGDRLKRKEPVLIAAAAPRSLSAIR*
Ga0075424_1010611151	3300006904	Populus Rhizosphere	VRPNQRMKLSWRGGRLKGKASVLMAAAAPRSLCAIR*
Ga0075424_1015078193	3300006904	Populus Rhizosphere	NLAQPNQRMKLPWRGGRLKGKRSILIAAAAPRSLCAIR*
Ga0075424_1015473841	3300006904	Populus Rhizosphere	LPNLRMKLSWRGGRLKGNGSLLMVAAAPRSLCAIR*
Ga0075424_1015887271	3300006904	Populus Rhizosphere	MTGTPPNQRMKLSWRGGRLKGKDFILMAAAAPRSLCAI
Ga0075424_1018050002	3300006904	Populus Rhizosphere	VDCGLRPNKRMKLSWRGGRLKGNGFILIAAAAPRSLCAIR*
Ga0075424_1018115471	3300006904	Populus Rhizosphere	KAGLPNQRMKLSWRGGRLKGKGSFLMAAAAPRSLCAIR*
Ga0075424_1019026291	3300006904	Populus Rhizosphere	LPNMRMKLSWRGGRLKGKGSILMAAAAPRSLCAIR*
Ga0075424_1021386582	3300006904	Populus Rhizosphere	GKLPNQRMKLSWRGGRLKGKDFILMAAAAPRSLCAIR*
Ga0075424_1026596352	3300006904	Populus Rhizosphere	PNKRMKLAWRGGRLKGNRSILMAAAAPRSLCAIR*
Ga0075424_1026799462	3300006904	Populus Rhizosphere	PNQRMKLPWRGGRSKGNAFLLMAAAAPRSLCAIR*
Ga0075436_1000817904	3300006914	Populus Rhizosphere	MTPLPNMRMKLPWRGGRLKGNGSLLMAAAAPRSLCAIR*
Ga0075436_1001611631	3300006914	Populus Rhizosphere	LPNQRMKLSWRGGRLKEKGSVLMAAAAPRSLCAIR*
Ga0075436_1001707281	3300006914	Populus Rhizosphere	LPNQRMKLSWRGGRLKGKGSILIAAAAPRSLCAIR*
Ga0075436_1003423763	3300006914	Populus Rhizosphere	PNQRMKLAWRGGRLKGKGLILMAAAAPRSLCAIR*
Ga0075436_1015676581	3300006914	Populus Rhizosphere	PPNMRMKLSWRGGRLKGNESILMAAAAPRSLCAIR*
Ga0075419_104605951	3300006969	Populus Rhizosphere	MSLLPNQRLKLSGCGGRLKGNGLVLIAAAAPRSLSASR*
Ga0075419_105420161	3300006969	Populus Rhizosphere	MTPPNKRLKLSGCGARLKGNGSLLIAAAAPRSLSAIR
Ga0075435_1007396431	3300007076	Populus Rhizosphere	RPNMRMKLAWRGGRLKGKESVLIAAAAPRSLCAIR*
Ga0066710_1013255075	3300009012	Grasslands Soil	ELVICSFTAMAPNLRMKLSWRGGRLKRKGSILMAAAAPRSLRAIR
Ga0114129_101340738	3300009147	Populus Rhizosphere	GLPRQPNMRLKLTGRGGRLKGKRSVLIAAAAPRSLSAIR*
Ga0114129_103766431	3300009147	Populus Rhizosphere	PNMRLKLSGCGGRLKGNWSILIAAATPRSLSAIR*
Ga0114129_104474931	3300009147	Populus Rhizosphere	GRWMRPNQRMKLSWRGGRSKGNGSISMAAAAPRSLCAIR*
Ga0114129_119546581	3300009147	Populus Rhizosphere	VLAVPPNMRMKLSWRGGRSKGNRSLLMAAAAPRSLCAIR*
Ga0114129_122897353	3300009147	Populus Rhizosphere	LLPNQRMKLSWRGGRLKGKGSILIAAAAPRSLCAIR*
Ga0126380_123030312	3300010043	Tropical Forest Soil	VPPNQRMKLSWRGGRLKGKESVLMAAAAPRSLCAIR*
Ga0126382_100529244	3300010047	Tropical Forest Soil	MDQQALSVLPNQRMKLTWRGGRLKGNGLLLMAAAAPRSLCAIR*
Ga0126382_101927852	3300010047	Tropical Forest Soil	MSHYWPLPNQRMKLSWRGGRSKGNGLIVMAAAAPRSLCAIR*
Ga0126382_117303892	3300010047	Tropical Forest Soil	SRKVLPNQRMKLTWRGGRLKGNESILRAAAAPRSLCAIR*
Ga0126382_123210822	3300010047	Tropical Forest Soil	AVTAGLPNQRMKLTWRGGRSKGNGLILIAAAAPRSLCAIR*
Ga0126370_103840743	3300010358	Tropical Forest Soil	SNQRMKLSWRGGRLKGKESILIAAAAPRSLCAIR*
Ga0126376_100185271	3300010359	Tropical Forest Soil	LPNQRMKLTWRGGRLKEKRSVLIAAAAPRSLCAIR*
Ga0126376_100241646	3300010359	Tropical Forest Soil	MPLANLHMKLSWRGGRSKEKGSIVMAAAAPRSLCAIR*
Ga0126376_106447223	3300010359	Tropical Forest Soil	PNQRMKLSWRGGRLKGKGFVLMAAAALRSLCAIR*
Ga0126376_108276471	3300010359	Tropical Forest Soil	SFTVTFRPVVLPNQRMKLSWRGGRSKGKRSILMAAAAPRSLCAIR*
Ga0126376_108969722	3300010359	Tropical Forest Soil	MSALPNQRMKLPWRGGRLKEKESVLMAAAAPRSLCAIR*
Ga0126376_112093812	3300010359	Tropical Forest Soil	TPPNQRMKLSWRGGRLKGNGFVLMAAAAPRSLCAIR*
Ga0126376_113652811	3300010359	Tropical Forest Soil	PNQRMKLSWRGGRLKGNRSILMAAAAPRSLCAIR*
Ga0126376_115292681	3300010359	Tropical Forest Soil	SMLALPNQRMKLSWRGGRLKGKGSVLIAAAAPRSLCAIR*
Ga0126376_119316552	3300010359	Tropical Forest Soil	MCREALPPNMRMKLSWRGGHSKGNRSVLMVAAAPRSL
Ga0126376_126809031	3300010359	Tropical Forest Soil	MDRIQSVMAVPSNQRMKLSWRGGRLKGNRSILMAAAAPRSLCAIR*
Ga0126372_131522042	3300010360	Tropical Forest Soil	IVSPLANLRMKLSWRGGRLKGNELVLMAAAAPRSLCAIR*
Ga0126378_131909681	3300010361	Tropical Forest Soil	PPNQRMKLAWRGGRLKGNMSILMAAAAPRSLCAIR*
Ga0126377_109373373	3300010362	Tropical Forest Soil	PNLRMKLSWRGGRLKGNSSILIAAAAPRSLCAIR*
Ga0126377_113357691	3300010362	Tropical Forest Soil	MGVLPNQRMKLSWRGGRLKGNRLILLAAAAPRSLCAIR*
Ga0126377_114069161	3300010362	Tropical Forest Soil	LPPNQRMKLSWRGGRLKGNESTLMAAAAPRSLCAIR*
Ga0126377_122628912	3300010362	Tropical Forest Soil	AAPPNQRMKLSWRGSRLKGKDFVLMAAAAPRGLCAIR*
Ga0126377_122849791	3300010362	Tropical Forest Soil	PNQRMKLSWRGGRWKGKESILMAAAAPRSLCAIR*
Ga0126377_123654952	3300010362	Tropical Forest Soil	LPNQRMKLAWRGGRLKGKESVSMAAAAPRSLCAIR*
Ga0126377_136039241	3300010362	Tropical Forest Soil	PNQRMKLSWRGGRLKGNGLILMAAAAPRSLCAIR*
Ga0126379_115315163	3300010366	Tropical Forest Soil	LPNQRMKLSWRGGRLKGKGSILIAAATPRSLCAIR*
Ga0126379_125058211	3300010366	Tropical Forest Soil	PNQRMKLPWRGGRLEGKGSVLIAAAAPRSLCAIR*
Ga0126379_130395331	3300010366	Tropical Forest Soil	EGSEMKQRPNQRMKLTWRGGRLKENGSILMAAAAPRSLCAIR*
Ga0126379_138649611	3300010366	Tropical Forest Soil	LRPNQRMKLPWRGGRLEGKGSVLIAAAAPRSLCAIR*
Ga0126379_138652751	3300010366	Tropical Forest Soil	PPNMRMKLSWRGGRLKGNGLILMAAAAPRSLCAIR*
Ga0126383_101725514	3300010398	Tropical Forest Soil	ALPNQRMKLAWRGGRSKGNRSILIAAAAPRSLCAIR*
Ga0126383_133200211	3300010398	Tropical Forest Soil	MTGQRPTALPNQRMKLSWRGGRLKGNRSVLMAAAAPRSLCAIR
Ga0137463_10666033	3300011444	Soil	QRGLPPNQRLKLSWRGGRLKGKGSILIAAAAPRSLSAIR*
Ga0137463_13543631	3300011444	Soil	PNQRLKLSGCGGRLKGNGSVLIAAAAPRSLSAIR*
Ga0137389_103932471	3300012096	Vadose Zone Soil	TGSIKQPPNQRMKLSWRGGRSKGNGSVLIAAAAPRSLCAIR*
Ga0137379_110486562	3300012209	Vadose Zone Soil	MLEYARSSVNGVLPNQRMKLSWRGGRLKGNTFILLAAAAPRSLCAIR*
Ga0137377_106997471	3300012211	Vadose Zone Soil	STPRPSNQRMKLSWRGGRLKGKGSILIAAAAPRSLCAIR*
Ga0134048_10400323	3300012400	Grasslands Soil	PRPNQRLKLPGRGGRLKGIGSTLIAAAAPRSLSAIR*
Ga0153915_101679981	3300012931	Freshwater Wetlands	QKVQPNMRLKLSGRGGRLKGNGLVLIATAAPRSLSATR*
Ga0153915_105697021	3300012931	Freshwater Wetlands	VARLPNQRLKLSGRGGRLKGNGSVLIAAAAPRSLS
Ga0153915_108008693	3300012931	Freshwater Wetlands	GALMRNKRLPNQRMKLSARGGRSVGKGSFLSAAAAGRSLCASR*
Ga0153915_119579811	3300012931	Freshwater Wetlands	MAQPNQRLKLSGCGGRLKGNGLVLIAAAAPRSLSAIR*
Ga0153915_129726222	3300012931	Freshwater Wetlands	EQRLRPNQRLKLSGCGGRLKGNGLVLIAAAAPRSLSAIR*
Ga0153915_130100011	3300012931	Freshwater Wetlands	VTKVLPNQRLKLSGCGGRLKGNGSVLIAAAAPRSLSA
Ga0153915_131469891	3300012931	Freshwater Wetlands	PSNMRLKLSGRGGRLKGMGFVLIAAAAPRSLSAIR*
Ga0126375_102222291	3300012948	Tropical Forest Soil	RLLPNLRMKLSWRGGRLKGNTSILIAAAAPRSLCAIR*
Ga0126375_107821431	3300012948	Tropical Forest Soil	VTPNMRMKLSWRGGRLKGNMFILMAAAAPRSLCAIR*
Ga0126375_107909833	3300012948	Tropical Forest Soil	PNLRMKLSWRGGRLKGNTSILIAAAAPRSLCAIR*
Ga0126375_108751572	3300012948	Tropical Forest Soil	MRRLLPNMRMKLPWRGGRLKGKGFVLIAAAAPRSLCAIR*
Ga0126375_110029391	3300012948	Tropical Forest Soil	PNQRMKLSWRGGRLKGNESILMAAAAPRSLCAIR*
Ga0126375_119563262	3300012948	Tropical Forest Soil	TGVLPNQRMKLSWRGGRLKGKGSVLMAAAAPRSLCAIR*
Ga0126375_120697951	3300012948	Tropical Forest Soil	WLRPNMRMKLTWRGGRSKRNALILMAAAAPRSLCAIR*
Ga0126369_111364341	3300012971	Tropical Forest Soil	RPNQRMKLSWRGGRLKGKRSIFIAAAAPRSLCAIR*
Ga0187825_100164861	3300017930	Freshwater Sediment	PPNQRMKLSWRGGRLKGKGSVLIAAAAPRSLCAIR
Ga0187825_100864471	3300017930	Freshwater Sediment	ALPNQRMKLAWRGGRSKGNGLVLMAAAAPRSLCAIR
Ga0187825_102441981	3300017930	Freshwater Sediment	MMGMPPNQRMKLSWRGGRLKGKGSIFIAAAAPRSLCAIR
Ga0187825_102516782	3300017930	Freshwater Sediment	MMSQPNQRMKLSWRGGRLKGKGFLLIAAAAPRSLCAIR
Ga0187821_101825661	3300017936	Freshwater Sediment	LPNQRMKLSWRGGRLKGKGSIVMAAAAPRSLCAIR
Ga0187821_104682891	3300017936	Freshwater Sediment	SLAPNMRMKLSWCGGRLKRKGSVLMAAAAPRSLCAIR
Ga0187778_107988771	3300017961	Tropical Peatland	MPKVLPNQRMKLAWRGGRLKGNRLILMAAAAPRSLCAIR
Ga0187778_111060762	3300017961	Tropical Peatland	MIGLPNQRMKLPWRGGRLKGKELFLMAAAAPRILCAIR
Ga0187777_107934991	3300017974	Tropical Peatland	LGAGLMPNMRMKLAWRGGRLKGNGSVLMAAAAPRSLCAIR
Ga0187822_101245361	3300017994	Freshwater Sediment	MGICATAAALPNQRMKLSWRGGRLKGKGSVLMAAAAPRSLCAIR
Ga0187822_101245363	3300017994	Freshwater Sediment	FCSRLRPNQRMKLSWRGGRLKGNGFILIAAAAPRSLCAIR
Ga0187822_102157781	3300017994	Freshwater Sediment	RMKLSWRGGRLKGNGLFLMAAAAPRSLCAIRYAAPPV
Ga0187822_103622242	3300017994	Freshwater Sediment	MAGQLALPNQRMKLSWRGGRLKGIGSILIAAAAPRSLC
Ga0184637_107804362	3300018063	Groundwater Sediment	LPNQRLKLSGCGGRLKGNGSVLIAAAAPRSLSAIR
Ga0187773_107289412	3300018064	Tropical Peatland	MMRRNDAGALPNQRMKLSWRGGRLKENESILMAAAAPRSLCAIR
Ga0187894_101889431	3300019360	Microbial Mat On Rocks	TMLRPNQRMKLSARGGRLKRKGSFVVAAATGCSLCAFR
Ga0187894_102994302	3300019360	Microbial Mat On Rocks	APSNQRMKLSWRGGRLKGNGSILMAAAAPRSLCAIR
Ga0187892_100957964	3300019458	Bio-Ooze	RDKRQPPNMRMKLSWRGGRSKGNGLILMAAAAPRSLCAIR
Ga0187892_102216173	3300019458	Bio-Ooze	YAAVQPNQRMKLTWRGGRSKGNWSILMAAAAPRSLCAIR
Ga0187893_100955552	3300019487	Microbial Mat On Rocks	VRSAESLPNQRMKLTARGGRLKRNWSFWSAAATDCSLCAIR
Ga0187893_101914621	3300019487	Microbial Mat On Rocks	MRMKLSWRGGRSKGNGLILMAAAAPRSLCAIRYAEHGQND
Ga0247677_10108293	3300024245	Soil	LSLRRPPNMRMKLSWRGGRLEGKGSILMAAAAPRSLCAIR
Ga0247677_10184421	3300024245	Soil	KDASSGMAEPPNQRMKLSWRGGRLKGNGSVLIAAAAPRSLCAIR
Ga0247680_10215261	3300024246	Soil	AQVALPNQRMKLSWRGGRLKRKGSVSMAAAAPRSLCAIR
Ga0247676_100045610	3300024249	Soil	VTHVVSVPLVRPNQRMKLSWRGGRLKGKGSLLIAAAAPRSLCAIR
Ga0247676_10204391	3300024249	Soil	TLPNQRMKLSWRGGRLKGKESVLMAAAAPRSLCAIR
Ga0247660_10247403	3300024317	Soil	LRRPPNMRMKLSWRGGRLEGKGSILMAAAAPRSLCAIR
Ga0247660_10247953	3300024317	Soil	MKEGCLPNQRMKLSWRGGRLKGNGSVLMAAAAPRSLCAIR
Ga0247660_10294853	3300024317	Soil	KVGPPNQRMKLSWRGGRLKGKGSLLMAAAAPRSLCAIR
Ga0247660_10356721	3300024317	Soil	HQGQRPNQRMKLSWCGGRLKGNGSILIAAAAPRSLCAIR
Ga0247678_10049951	3300024325	Soil	MMRALPNQRMKLSWRGGRLKGNGSVLMAAAAPRSLCAIR
Ga0207684_112709772	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MIGPLPNQRMKLPWRGGHLKGKGSILIAAAAPRSLC
Ga0207646_100599006	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MITQGLALPNQRMKLSWSGGRLKGNWSLLMAAAAPRSLCAIR
Ga0209382_101119401	3300027909	Populus Rhizosphere	MRLHDPKPDTALPNQRLKLSGCGGRLKGNGSLLIAAAAPRSLSAIR
Ga0209885_10278582	3300027950	Groundwater Sand	LIGTQQVPPNQRLKLAGRGGRLKGNGSFLIAAAAPRSLSAIR
Ga0209853_10074916	3300027961	Groundwater Sand	MALPNKRMKLSWRGGRLKGNGSVLIAAAAPRSLCAIR
Ga0247675_10302561	3300028072	Soil	HGLPNQRMKLSWRDGRLKGNGSILMAAAAPRSLCAIR
Ga0307282_103207652	3300028784	Soil	GLPNQRMKLSARGGRSIGNWIPLCAAAAGRSLCAIR
Ga0307281_102246441	3300028803	Soil	QMTPPSNQRLKLSGRGGRLKGNGSLLIAAAAPRSLSAIR
Ga0247727_102973053	3300031576	Biofilm	GSGTVMPNQRMKLAARGGRLIGNRSVLSVAAAGRSLCAIR
Ga0310813_110949301	3300031716	Soil	MEEALAVAVLPNQRMKLSWRGGRSKGKGSLLMAAAAPRSL
Ga0310813_119867521	3300031716	Soil	LPTLALLLAALPNQRMKLSWRGGRVKGKGSVLMAAAAPRSL
Ga0307469_123493942	3300031720	Hardwood Forest Soil	MKPMARPPNQRMKLSWRGGRLQGNGSIVMAAAAPRS
Ga0307472_1027010282	3300032205	Hardwood Forest Soil	QPPNQRMNLSWRGGRLKGKGSILMAAAAPRSLSAIR
Ga0335082_100490583	3300032782	Soil	MAMTSALPNLRLKLSWRGGRLEWNLLFMNAAAAPRSLSAFR
Ga0310810_1003253112	3300033412	Soil	VTGRVPNQRMKLAWRGGRLREKGSILIAAAAPRSLCAIR
Ga0310810_100325317	3300033412	Soil	MPLPNQRMKLSWRGGRLKGYGSIVMAAAAPRSLCAIR
Ga0310810_101574741	3300033412	Soil	VRAPANLRMKLAPRGGRTKGKESILMAAAAGRSLCAIR
Ga0326726_100109101	3300033433	Peat Soil	LSNQRLKLSGRGGRLKGKGFLLIAAAAPRSLSAIR
Ga0326726_1001091013	3300033433	Peat Soil	VIDKGAPSNLRLELAGRGGRLKGRGSLLIAAAAPRSLSATR
Ga0326726_100500403	3300033433	Peat Soil	MEPGKRPNQRLKLSGCGGRLKGNTSILIAAAAPRSLSATR
Ga0326726_107537001	3300033433	Peat Soil	IDKGAPSNMRLKLSGRGGRLKGNSLFLMAAAAPRSLSAIR
Ga0326726_109911223	3300033433	Peat Soil	MQPRVPNQRLKLTGRGGRLKGNELVLIAAAAPRSLSA
Ga0314864_0125663_518_640	3300033805	Peatland	VTDRLAPNMRMKLAWRGGRLKGNGAILMAAAAPRSLCAIR
Ga0364924_003517_2_118	3300033811	Sediment	GPALPNKRLKLSGCGGRLKGNGSVLIAAAAPRSLTAFR
Ga0364924_079363_1_114	3300033811	Sediment	EALPNQRMKLSACGGRSVGNRSVSTAAAAGRSLTAFR
Ga0326723_0010760_2007_2132	3300034090	Peat Soil	MIDKGAPSNLRLELAGRGGRLKGRGSLLIAAAAPRSLSATR
Ga0326723_0067955_1396_1518	3300034090	Peat Soil	TAPVVLPNQRLKLSGCGGRLKGKRSVLIAAAAPRSLSAIR
Ga0326723_0162847_873_980	3300034090	Peat Soil	LPNQRLKLSGCGGHLKGNRLVLIAAAAPRSLSAIR
Ga0364940_0127763_3_119	3300034164	Sediment	WKEPPNQRMKLSARGGRSLRNRSFLSAAAAGRSLCAIR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F029361

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences