NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028954

Metagenome / Metatranscriptome Family F028954

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028954
Family Type Metagenome / Metatranscriptome
Number of Sequences 190
Average Sequence Length 47 residues
Representative Sequence KNPAVMGPGVFITYSYKLEGDTLSLTQQRNQNGPFANPFTLKLVRVE
Number of Associated Samples 142
Number of Associated Scaffolds 189

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.72 %
% of genes near scaffold ends (potentially truncated) 89.47 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 128
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.579 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.421 % of family members)
Environment Ontology (ENVO) Unclassified
(37.895 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(57.895 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 32.00%    Coil/Unstructured: 68.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 189 Family Scaffolds
PF02585PIG-L 10.05
PF07676PD40 3.17
PF00072Response_reg 2.65
PF13360PQQ_2 2.65
PF00498FHA 2.65
PF02566OsmC 2.12
PF00575S1 2.12
PF03551PadR 1.59
PF12681Glyoxalase_2 1.59
PF00106adh_short 1.06
PF02635DrsE 1.06
PF07609DUF1572 1.06
PF08327AHSA1 1.06
PF08241Methyltransf_11 1.06
PF07366SnoaL 1.06
PF00561Abhydrolase_1 1.06
PF01925TauE 0.53
PF00756Esterase 0.53
PF01804Penicil_amidase 0.53
PF00501AMP-binding 0.53
PF00497SBP_bac_3 0.53
PF13421Band_7_1 0.53
PF01436NHL 0.53
PF07728AAA_5 0.53
PF06736TMEM175 0.53
PF13474SnoaL_3 0.53
PF05977MFS_3 0.53
PF13578Methyltransf_24 0.53
PF069833-dmu-9_3-mt 0.53
PF00596Aldolase_II 0.53
PF02698DUF218 0.53
PF06078DUF937 0.53
PF01740STAS 0.53
PF00801PKD 0.53
PF00144Beta-lactamase 0.53
PF01590GAF 0.53
PF01408GFO_IDH_MocA 0.53
PF13414TPR_11 0.53
PF07995GSDH 0.53
PF13460NAD_binding_10 0.53
PF01381HTH_3 0.53
PF03965Penicillinase_R 0.53
PF08002DUF1697 0.53
PF02575YbaB_DNA_bd 0.53
PF04214DUF411 0.53
PF13649Methyltransf_25 0.53
PF02518HATPase_c 0.53
PF00069Pkinase 0.53
PF00753Lactamase_B 0.53
PF04239DUF421 0.53
PF07883Cupin_2 0.53
PF10250O-FucT 0.53
PF12697Abhydrolase_6 0.53
PF01103Omp85 0.53
PF07690MFS_1 0.53
PF01266DAO 0.53
PF08240ADH_N 0.53
PF01663Phosphodiest 0.53
PF00226DnaJ 0.53
PF01425Amidase 0.53
PF13419HAD_2 0.53
PF08808RES 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 189 Family Scaffolds
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 10.05
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.12
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 2.12
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 2.12
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 2.12
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.59
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.59
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.53
COG0718DNA-binding nucleoid-associated protein YbaB/EfbCTranscription [K] 0.53
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.53
COG1434Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 familyCell wall/membrane/envelope biogenesis [M] 0.53
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.53
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.53
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.53
COG2323Uncharacterized membrane protein YcaP, DUF421 familyFunction unknown [S] 0.53
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.53
COG2367Beta-lactamase class ADefense mechanisms [V] 0.53
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.53
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.53
COG2949Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycinCell wall/membrane/envelope biogenesis [M] 0.53
COG3019Uncharacterized metal-binding protein, DUF411 familyFunction unknown [S] 0.53
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.53
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.53
COG3753Uncharacterized conserved protein YidB, DUF937 familyFunction unknown [S] 0.53
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 0.53
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.53
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.58 %
UnclassifiedrootN/A8.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZN2CUW02IJSOMAll Organisms → cellular organisms → Bacteria522Open in IMG/M
2199352025|deepsgr__Contig_135209All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300000891|JGI10214J12806_11335762All Organisms → cellular organisms → Bacteria → Acidobacteria976Open in IMG/M
3300001686|C688J18823_10171551All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300002561|JGI25384J37096_10105129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8975Open in IMG/M
3300003321|soilH1_10230855All Organisms → cellular organisms → Bacteria2179Open in IMG/M
3300003324|soilH2_10118399All Organisms → cellular organisms → Bacteria10725Open in IMG/M
3300004156|Ga0062589_100037058All Organisms → cellular organisms → Bacteria2571Open in IMG/M
3300004156|Ga0062589_100243254All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300004156|Ga0062589_102128083All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300004157|Ga0062590_101663489All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium648Open in IMG/M
3300004157|Ga0062590_103001090All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300004463|Ga0063356_101979233All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300004463|Ga0063356_104722752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300004480|Ga0062592_100827312All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300004643|Ga0062591_100027332All Organisms → cellular organisms → Bacteria → Acidobacteria2907Open in IMG/M
3300004643|Ga0062591_100270015All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300005093|Ga0062594_102478308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium569Open in IMG/M
3300005093|Ga0062594_102512928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300005330|Ga0070690_100572451All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300005331|Ga0070670_100049687All Organisms → cellular organisms → Bacteria → Acidobacteria3606Open in IMG/M
3300005340|Ga0070689_101040330All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300005343|Ga0070687_100579421All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300005347|Ga0070668_102268519Not Available502Open in IMG/M
3300005353|Ga0070669_102008312All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005444|Ga0070694_101660160All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300005444|Ga0070694_101957126All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005455|Ga0070663_101397065All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300005455|Ga0070663_101414875All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005457|Ga0070662_100642060All Organisms → cellular organisms → Bacteria → Proteobacteria895Open in IMG/M
3300005467|Ga0070706_100929466All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300005529|Ga0070741_11192955Not Available642Open in IMG/M
3300005539|Ga0068853_101242107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300005545|Ga0070695_101471249All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005547|Ga0070693_101094615All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005577|Ga0068857_100625376All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300005617|Ga0068859_101233843All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300005617|Ga0068859_102490804All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300005719|Ga0068861_100694813All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300005719|Ga0068861_100694813All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300005719|Ga0068861_100893298All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300005719|Ga0068861_102158706All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300005764|Ga0066903_100182696All Organisms → cellular organisms → Bacteria3096Open in IMG/M
3300005764|Ga0066903_100195415All Organisms → cellular organisms → Bacteria3015Open in IMG/M
3300005764|Ga0066903_100729862All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300005764|Ga0066903_102554365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300005764|Ga0066903_106234110All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005764|Ga0066903_107664846All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300005841|Ga0068863_100106808All Organisms → cellular organisms → Bacteria → Acidobacteria2664Open in IMG/M
3300005841|Ga0068863_101341602All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300005843|Ga0068860_100369713All Organisms → cellular organisms → Bacteria → Acidobacteria1414Open in IMG/M
3300005843|Ga0068860_102123167All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005844|Ga0068862_102154431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300006049|Ga0075417_10569308All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium574Open in IMG/M
3300006163|Ga0070715_10317323All Organisms → cellular organisms → Bacteria → Proteobacteria840Open in IMG/M
3300006196|Ga0075422_10131072All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300006196|Ga0075422_10399061All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300006852|Ga0075433_10970196All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300006852|Ga0075433_11421919Not Available600Open in IMG/M
3300006854|Ga0075425_100620388All Organisms → cellular organisms → Bacteria → Acidobacteria1243Open in IMG/M
3300006881|Ga0068865_101263822All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300006903|Ga0075426_10114429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1937Open in IMG/M
3300006903|Ga0075426_11294159All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300006903|Ga0075426_11439698All Organisms → cellular organisms → Bacteria → Proteobacteria524Open in IMG/M
3300006914|Ga0075436_100881161All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300006914|Ga0075436_101092290All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300006953|Ga0074063_13195357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1374Open in IMG/M
3300009098|Ga0105245_11340206All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300009137|Ga0066709_101338532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300009147|Ga0114129_12840189All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300009148|Ga0105243_11426763All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300009148|Ga0105243_11949881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300009156|Ga0111538_11599114All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300009156|Ga0111538_14094555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium503Open in IMG/M
3300009162|Ga0075423_12356045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300009176|Ga0105242_11867321All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300009177|Ga0105248_12402057All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300009553|Ga0105249_13482735All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300010044|Ga0126310_10438026All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300010046|Ga0126384_12409426All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300010362|Ga0126377_13562371All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300010366|Ga0126379_12543738All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300010376|Ga0126381_102974107All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300010397|Ga0134124_11151134All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300010397|Ga0134124_12913526Not Available522Open in IMG/M
3300010398|Ga0126383_10853662Not Available995Open in IMG/M
3300010399|Ga0134127_11912418All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300010400|Ga0134122_13262094All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010400|Ga0134122_13313253All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300010401|Ga0134121_11930827All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300010401|Ga0134121_12211719All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300010401|Ga0134121_12523334All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300010403|Ga0134123_13286559All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300011438|Ga0137451_1247914Not Available561Open in IMG/M
3300012096|Ga0137389_10402944All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1168Open in IMG/M
3300012166|Ga0137350_1099927All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300012212|Ga0150985_105359044All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300012232|Ga0137435_1021003All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300012469|Ga0150984_110768491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300012469|Ga0150984_116027371All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300012469|Ga0150984_117008657All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300012683|Ga0137398_10581896All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300012912|Ga0157306_10273684All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300012948|Ga0126375_10827096All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300012957|Ga0164303_10222491All Organisms → cellular organisms → Bacteria → Acidobacteria1061Open in IMG/M
3300012960|Ga0164301_10306308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1072Open in IMG/M
3300012971|Ga0126369_10747922All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300012988|Ga0164306_11995157All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300013297|Ga0157378_11339698All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300013308|Ga0157375_11498093All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300013308|Ga0157375_12239155All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300013308|Ga0157375_12407970All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Cellvibrio → unclassified Cellvibrio → Cellvibrio sp.628Open in IMG/M
3300014880|Ga0180082_1096939All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300014968|Ga0157379_10409770All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis1247Open in IMG/M
3300015371|Ga0132258_10219317All Organisms → cellular organisms → Bacteria4627Open in IMG/M
3300015371|Ga0132258_12356863All Organisms → cellular organisms → Bacteria → Proteobacteria1334Open in IMG/M
3300015372|Ga0132256_100334953All Organisms → cellular organisms → Bacteria → Acidobacteria1605Open in IMG/M
3300015372|Ga0132256_100602219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1213Open in IMG/M
3300015372|Ga0132256_102554492All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300015373|Ga0132257_100338443All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300015373|Ga0132257_102474453All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300015374|Ga0132255_103540240All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300016270|Ga0182036_11666935All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300017656|Ga0134112_10303835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300017792|Ga0163161_11065454All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300018060|Ga0187765_11279903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300018429|Ga0190272_10522978All Organisms → cellular organisms → Bacteria → Acidobacteria1015Open in IMG/M
3300018429|Ga0190272_13216681All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300018469|Ga0190270_13129767All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300018476|Ga0190274_13617263All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300019377|Ga0190264_11371334All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300020022|Ga0193733_1197873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300022899|Ga0247795_1020387All Organisms → cellular organisms → Bacteria → Acidobacteria1069Open in IMG/M
3300025899|Ga0207642_10870240All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300025900|Ga0207710_10547922All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300025903|Ga0207680_10258962All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300025907|Ga0207645_10639447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300025908|Ga0207643_10604628All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300025924|Ga0207694_10781134Not Available807Open in IMG/M
3300025925|Ga0207650_10587312All Organisms → cellular organisms → Bacteria → Acidobacteria936Open in IMG/M
3300025926|Ga0207659_11475111Not Available582Open in IMG/M
3300025927|Ga0207687_10764643All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300025930|Ga0207701_10873266All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300025933|Ga0207706_10658751All Organisms → cellular organisms → Bacteria → Proteobacteria896Open in IMG/M
3300025936|Ga0207670_10848180All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300025941|Ga0207711_11500758All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300025960|Ga0207651_11626464All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300025961|Ga0207712_10509028Not Available1030Open in IMG/M
3300025972|Ga0207668_11047924All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300025986|Ga0207658_10368151All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300026075|Ga0207708_11599180All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300026078|Ga0207702_12112178All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300026088|Ga0207641_11565340All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium661Open in IMG/M
3300026089|Ga0207648_10555563All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300026089|Ga0207648_11756592All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300026118|Ga0207675_100152849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2198Open in IMG/M
3300026118|Ga0207675_102561935All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300026121|Ga0207683_10880878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300027873|Ga0209814_10219833All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300027915|Ga0209069_10729953All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300028381|Ga0268264_10159125All Organisms → cellular organisms → Bacteria → Acidobacteria2033Open in IMG/M
3300028381|Ga0268264_12256371All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300031226|Ga0307497_10035872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1652Open in IMG/M
3300031547|Ga0310887_10063507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1709Open in IMG/M
3300031547|Ga0310887_10211405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1061Open in IMG/M
3300031562|Ga0310886_10086895All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300031858|Ga0310892_11277652All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031908|Ga0310900_10559226All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300031940|Ga0310901_10020364All Organisms → cellular organisms → Bacteria → Acidobacteria1913Open in IMG/M
3300031943|Ga0310885_10173998All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300031943|Ga0310885_10604137All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300031944|Ga0310884_10039944All Organisms → cellular organisms → Bacteria2045Open in IMG/M
3300031954|Ga0306926_11846049All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300032012|Ga0310902_11188934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300032013|Ga0310906_11100191All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300032017|Ga0310899_10168312All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300032044|Ga0318558_10227711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium914Open in IMG/M
3300032075|Ga0310890_10943745All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300032089|Ga0318525_10361461All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300032089|Ga0318525_10721584All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300032179|Ga0310889_10245489All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300033412|Ga0310810_10100303All Organisms → cellular organisms → Bacteria3453Open in IMG/M
3300034149|Ga0364929_0223438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300034820|Ga0373959_0006524Not Available1939Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere8.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.26%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.21%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.63%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.11%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.11%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.58%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.05%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.05%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.05%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.05%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.53%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.53%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.53%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.53%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.53%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.53%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_032776002170459003Grass SoilASKNPAVMGPGVFITYAYKLDGDTLSLTQQRNQNGPFANPFTLKLVRVE
deepsgr_021916702199352025SoilMRPIASKNPAVMGPRVFITYSYKMDGTTLSLTQQRNQDGPFANPFTLKLVRVE
JGI10214J12806_1133576213300000891SoilTVRPIAAKNPAVMGPGVFITYSYKLEGDTIWVTQQRNQNGPFPNPVTFKSVRVE*
C688J18823_1017155113300001686SoilKNPAVMGPGVFIVYAYKLDGDTLSLTQQRNQNGPFEHPFTLKLVRVE*
JGI25384J37096_1010512933300002561Grasslands SoilGVFITYAYRLDGDTLSLTQQRNQNGPFAAPFTLKLMRVE*
soilH1_1023085513300003321Sugarcane Root And Bulk SoilITMRPIASKNPAVMGPGVFITYAYKLDGATLSLTQHHNQNGPYANPFTLKLTRVE*
soilH2_1011839913300003324Sugarcane Root And Bulk SoilMGAGVYITYAFKLEGDTLLLTQQRNQNGPYPNPLTLKLVRVE*
Ga0062589_10003705813300004156SoilGPGVFITYTYTLEGDTLSLTQQRNQNGPFPSPFTLKLTRVE*
Ga0062589_10024325433300004156SoilASKNPAVMGEGVFITYAYKLEGDTLSLTQQRNQNGPFANPFSLKFVRAE*
Ga0062589_10212808323300004156SoilASKNPAIMGPGVFISYSFKIDGNTLTMTQERNQAGPFPSPFTIKAVRVE*
Ga0062590_10166348913300004157SoilSEITMRPIAAKSPAAMVSGAFIVYFYKLDGDTIWLTQQKNQNGPFANPFSLKLVRVE*
Ga0062590_10300109013300004157SoilKNPAVMGPGVFITYAYKLEGDTLSLTQQRNQTGPFANPFSFKAVRVE*
Ga0063356_10197923323300004463Arabidopsis Thaliana RhizosphereTMRPIASKNPAVMGAGVFITYSYKLEGDTLSLTQQRNQSGPFANPFTLKLVRVE*
Ga0063356_10472275223300004463Arabidopsis Thaliana RhizosphereGVVTMRPIASKNPAVMGQGVFITYAYKLDGDTLSLTQQRNQNGLFANPFALKLVRVE*
Ga0062592_10082731213300004480SoilAVMGPGIFVVYQYKVDGNTLTITQQRNQSGPFPNPFTLRLVRVE*
Ga0062591_10002733243300004643SoilGLVTMRPIASKNPAVMGPGVFITYSYKLDGTTLSLTQQRNQNGPFPNPFTLKLVRVE*
Ga0062591_10027001523300004643SoilPIASKNPAVMGEGVFITYAYKLEGDTLSLTQQRNQNGPFANPFSLKFVRAE*
Ga0062594_10247830813300005093SoilPGVFIAYTYTLEGDTLTLTQQRNQNGPYASPFTLKLTRVE*
Ga0062594_10251292813300005093SoilKNPAVMGQGVFITYAYKLDGDTLSLTQQRNQNGLFANPFALKLVRVE*
Ga0070690_10057245133300005330Switchgrass RhizosphereAVMGPGVFITYAYRLDGDTLSLTQRSNQNGPFANPFVLKLMRVE*
Ga0070670_10004968743300005331Switchgrass RhizosphereFITYSYKLEGNTLVITQQRNQNGSFSNPFSLKLVRVESR*
Ga0070666_1133703523300005335Switchgrass RhizospherePAVMGSGVFITYTYKLDGDTIWVTQQRNQHGPFANPVTIKAVRIE*
Ga0070689_10104033013300005340Switchgrass RhizosphereNLITMRPIASKNPAVMGPGVFITYSFKLEGDTLLLTQQRNQNGPFANPFSFKAVRVE*
Ga0070687_10057942113300005343Switchgrass RhizosphereNVITMRPIASKNPAVMGPGVFITYSYTLDGDTLSLTQQRNQNGPFPSPFTLKLTRVE*
Ga0070668_10226851913300005347Switchgrass RhizosphereITMRPIAAKNPAVMGPGVFISYSYKLDGDTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0070669_10200831223300005353Switchgrass RhizosphereYEVAGEVITMRPVATKNPAAMRPGAFITYSYKLDGNTMWVTEQKNQDGPVVNPITIKAVRVE*
Ga0070694_10166016023300005444Corn, Switchgrass And Miscanthus RhizosphereKNPAVMGPGVFITYSYKLDGNTMWVTQQRNQNGPFANPVTVKVVRVE*
Ga0070694_10195712613300005444Corn, Switchgrass And Miscanthus RhizosphereAVMGPGVFITYSYKLDGNTMWVTQQRNQDGPFANPVTVKVVRVE*
Ga0070663_10139706513300005455Corn RhizosphereVMGPGVFITYAYKVDGKTLSLTQERNQSGPFPNPFTLKLVRVE*
Ga0070663_10141487513300005455Corn RhizosphereMMRPIAAKNPAAMAPGAFIAYSYKQDGDTVWVTQQRNQNGPFANPVTIKAVRVN*
Ga0070662_10064206023300005457Corn RhizosphereDGLITMRPIASKNPAVMGPGVFISYSYKLGGDTLSLTQQRNQNGPFTNPFTLKFVRIE*
Ga0070706_10092946613300005467Corn, Switchgrass And Miscanthus RhizospherePIAAKNPAVMGPGVFMTYSYKLDGDTMWVTQQRNQNGPFTNPVTVKIVRVE*
Ga0070741_1119295523300005529Surface SoilRPIASKNPAVMGEGVFITYSYKLDGNTLSLTQQRNQRGAFPSPFTLKLVRVE*
Ga0068853_10124210723300005539Corn RhizospherePAVMGPGVFITYSYTLDGDTLTLTQQRNANGPFPNPFTLKLVRVE*
Ga0070695_10147124923300005545Corn, Switchgrass And Miscanthus RhizosphereSGVFITYSYRLDGDTMWVTQQRNQNGPFAHPVTIKVVRIE*
Ga0070693_10109461523300005547Corn, Switchgrass And Miscanthus RhizosphereVMGPGVFITYSYKLDGDAMWVTQQRNQSGPFANPVTVKVVRVE*
Ga0070665_10140149423300005548Switchgrass RhizosphereGVFITYTYKLDGDTIWVTQQRNQHGPFANPVTIKAVRIE*
Ga0068857_10062537613300005577Corn RhizosphereGVFITYTYTVEGDTLSLTQQRNQNGPFPAPFALKLTRVE*
Ga0068859_10123384323300005617Switchgrass RhizosphereGVFITYSYKLDGDTIWVTQQRNEHGPFANPVTIKAVRIE*
Ga0068859_10249080423300005617Switchgrass RhizosphereTMRPIASKNPAVMGPGVFITYSFKLEGDTLSLTQQRNQNGPFPNPFSFKAVRVE*
Ga0068861_10069481313300005719Switchgrass RhizosphereMGPGVFITYSYTLDGDTLSLTQQRNQNGPFPCPFTLKLTRVE*
Ga0068861_10069481333300005719Switchgrass RhizosphereVITMRPIASKNPAVMGPGVFITYSYTLDGDTLSLTQQRNQNGPFPSPFTLKLTRVE*
Ga0068861_10089329823300005719Switchgrass RhizosphereKNPAVMGPGVFITYTYTQEGDTLSLTQQRNQNGPYTSPFTLKLTRVE*
Ga0068861_10215870613300005719Switchgrass RhizosphereITYTYKLDGDTLSLTQQRNQAGPFTNPFSLKLVRVE*
Ga0066903_10018269673300005764Tropical Forest SoilITMRPIASKNPAVMGPGVFITYSYKLDGNTLTLTQQRNQNGPFANPFSLELVRVE*
Ga0066903_10019541513300005764Tropical Forest SoilMRPIASKNPAVMGPGVFITYAYKLEGDTLSLTQQRNQNGPFANPFTLRLTRVE*
Ga0066903_10072986213300005764Tropical Forest SoilMGPGVFITYSYKLEGDTLSLTQVRNQNGPFSSPFTLKLTRVE*
Ga0066903_10255436513300005764Tropical Forest SoilGVFITYAYTLEGTTLSLKQQRNQNGPFPNPFTLKLVRVE*
Ga0066903_10623411023300005764Tropical Forest SoilLITMRPIASKNPAVMGSGVFITYAYKLDGDTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0066903_10766484623300005764Tropical Forest SoilVTMRPVASKNPAVMGPGIFITYSYKLDGNTLLLTQQRNQSGPFANPFTLKLVRVE*
Ga0068863_10010680833300005841Switchgrass RhizospherePIASKNPAVMGPGVFITYSYKLEGDTLSLTQQRNQNGPFPNPFSFKAVRVE*
Ga0068863_10134160213300005841Switchgrass RhizosphereIASKNPAVMGPGVFITYSYKLDGTTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0068860_10036971313300005843Switchgrass RhizosphereSKNPAVMGPGVFISYSYKLDGDTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0068860_10212316713300005843Switchgrass RhizosphereGLVTMRPIASKNPAVMGPRVFITYSYKMDATTLSLTQQRNQDGPFANPFTLKLVRVE*
Ga0068862_10215443123300005844Switchgrass RhizosphereASKNPAVMGPGVFLTYSYKLDGDTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0075417_1056930823300006049Populus RhizosphereAVMGPGVFITYSYKLELDTLVITQQRNQNGPFNNPFSLKLVRVESR*
Ga0070715_1031732323300006163Corn, Switchgrass And Miscanthus RhizosphereITMRPIASKNPAVMGSGVFITYAYTLEGDTLSLTQQRNQNGPIANPFTLKLTRVE*
Ga0075422_1013107213300006196Populus RhizosphereNLITMRPIASKNPAVMGPGVFLTYTYTLEGDTLSLTQQRNQNGPFPSPFTLKLTRVE*
Ga0075422_1039906123300006196Populus RhizosphereSKNPAVMGPGVFITYSLKREGDTMWVTQQRNQNGPFANPFTIKVVRIE*
Ga0075433_1097019633300006852Populus RhizosphereVMGPGVFITYTYTLEGDTLSLTQQRNQNGPFPSPFMLKLTRVE*
Ga0075433_1142191923300006852Populus RhizosphereAVMGPGVFITYSYTLDGDTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0075425_10062038813300006854Populus RhizosphereLITMRPIASKNPAVMGPGVFITYSYKLDGDTLSLTQQRNQNAPFANPFTLKLVRVE*
Ga0068865_10126382223300006881Miscanthus RhizospherePGVFITYAYKLEGDTLSLTQQRNQTGPFANPFSFKAVRVE*
Ga0075426_1011442913300006903Populus RhizosphereSKNPAVMGPGVFITYAYKLDGNTLSLTQQRNQNGPFANPFTLKLARLE*
Ga0075426_1129415923300006903Populus RhizosphereYSYKLDGDTLSLTQQRNQNGPFANPFTLRLVRVE*
Ga0075426_1143969823300006903Populus RhizosphereMRPIASKNPAVMGPGVFITYSYKLEGDSLSLTQDRNQNGPFANPFTLRLTRVE*
Ga0075436_10088116123300006914Populus RhizosphereTYGYKLEGRTLSLTQQRNQNGPFPNPFTLKLERVE*
Ga0075436_10109229023300006914Populus RhizosphereGSGVFITYAYKLDGDTLSLTQQRNQNGPFATPFTLKLVRVE*
Ga0074063_1319535713300006953SoilSKNPAVMGPGVFITYSYKLEGDTLQLTQQRNQAGPFANPFTLKLVRVE*
Ga0105245_1134020623300009098Miscanthus RhizosphereVMGPGVFITYSYKLDADTLSLTQQRNQNGPFPNPFTLKLVRVE*
Ga0066709_10133853223300009137Grasslands SoilMGPGVFITYAYKLDGDTLSLTQQRNQNGAFANPFTLKLVRVE*
Ga0114129_1284018913300009147Populus RhizosphereVAKNPAVMGPGVFITYSYKREGDTMWVTQQRNQAGPFANPATFKLVRVE*
Ga0105243_1142676313300009148Miscanthus RhizosphereTMRPIASKNPAVMGAGVFITYTYTVEGDTLSLTQQRNQNGPFASPFALKLTRVE*
Ga0105243_1194988113300009148Miscanthus RhizosphereNPAVMGQGVFITYSYKLDGNTLSLTQQRNQNGLFANPFALKLVRVE*
Ga0111538_1159911433300009156Populus RhizosphereVMGPGVFLTYTYTLEGDTLSLTQQRNQNGPFPSPFTLKLTRVE*
Ga0111538_1409455523300009156Populus RhizosphereVYITYSYKLELDTLVITQQRNQNGPFNNPFSLKLVRVESR*
Ga0075423_1235604523300009162Populus RhizosphereASKNPAVMGQGVFITYSYKLDGNTLSLTQQRNQNGLFANPFALKLVRVE*
Ga0105242_1186732113300009176Miscanthus RhizosphereMRPIAAKNPAVMGPGVFITYSYKLDGDTMWVTQERNQNGPFANPVTIKVVRVE*
Ga0105248_1240205713300009177Switchgrass RhizosphereYAYKLDGNTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0105249_1348273513300009553Switchgrass RhizosphereAAKSPAAIQPRSLITYNYRQDGDTVWVTQKRNQNGPFANPITIKAVRIE*
Ga0126310_1043802613300010044Serpentine SoilVMGPGVFITYAYKLDGDTLTLTQQRNQNGPFANPFALKLMRIE*
Ga0126384_1240942613300010046Tropical Forest SoilTMRPIASKNPAVMGPGVFITYSYKLEGDSLSLTQQRNQNGPFPNPFTLRLTRVE*
Ga0126377_1198269223300010362Tropical Forest SoilYSFKRDGNTIWVTQVRNQNGPFVNPVTIKAVRVE*
Ga0126377_1356237113300010362Tropical Forest SoilKNPAVMGPGVFITYSYKLEGDTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0126379_1254373813300010366Tropical Forest SoilGVFIVYSYKLEGDKLLLTQQRNQNGPFPYPFKLQLVRVE*
Ga0126381_10297410713300010376Tropical Forest SoilKNPAVMGSGVFIVYSYKLEGDKLLLTQQRNQSGPFTYPFTLRLVRVE*
Ga0134124_1115113423300010397Terrestrial SoilGLVTMRPIASKTPAVMGPGVFITYSYTLHGTTLSLTQQRNQNGPFPNPFTLKLVRVE*
Ga0134124_1291352613300010397Terrestrial SoilPIASKNPAVMGPGVYITYAYKLEGDTLWLTQQRNQNGPFPAPFSFKAIRVE*
Ga0126383_1085366223300010398Tropical Forest SoilPIASKNPAIMGPGIFITYSYTLDGDTLSLTQQRNQNGAFPNPFTLKLVRVE*
Ga0134127_1191241813300010399Terrestrial SoilTYSYKLDGDTLSLTQQRNQNGPFANPFTLKLVRIE*
Ga0134122_1326209423300010400Terrestrial SoilTMRPVAAKNPAAMVPGAFITYSYELDGNTIWLTQQKNQDGPFANPVTIKAVRVE*
Ga0134122_1331325313300010400Terrestrial SoilNPAVMGQGVFITYSYTLDGNTMWVTQQRNQNGPFANPVTVKAVRIE*
Ga0134121_1193082723300010401Terrestrial SoilITMRPIASKNPAVMGPGVFITYTYELDGDTIRVTQQRNEHGPFANPVTIKAVRIE*
Ga0134121_1221171933300010401Terrestrial SoilITYAYKVEGNTLSLTQQRNQNGPFPNPFTLKLVRVE*
Ga0134121_1252333423300010401Terrestrial SoilTMRPIASKNPAVMGPGVFITYSYHLDGDTLSLTQQRNQNGPFANPFSLKLLRVE*
Ga0134123_1328655913300010403Terrestrial SoilPAIMGAGVFITYTYKLDGDTLSLTQQRNQAGPFANPFSLKLVRVE*
Ga0137451_124791413300011438SoilYSYRLDGDTIWLTQQRNQNGPFANPVTVKAVRIER*
Ga0137389_1040294423300012096Vadose Zone SoilMRPIASKNPAVMGPGVFITYSYKLDGDTLSLTQQRNQNGPFATPFTLKLVRVE*
Ga0137350_109992713300012166SoilITMRPIAAKNPAAMGPGAFITYSYKLDGNTMWVTQQRSQNGPFANPVTVKVVRVE*
Ga0150985_10535904433300012212Avena Fatua RhizosphereVFITYAYKLDGDTLSLTQQRNQNGAFASPFTLKLVRVE*
Ga0137435_102100313300012232SoilPIAAKNPAAMGPGAFITYSYKLDGNTMWVTQQQNQNGPFANPVTVKVVRVE*
Ga0150984_11076849123300012469Avena Fatua RhizospherePGIFITYSYKVDGNNLLLTQQRNQSGPFANPFTLKLVRVE*
Ga0150984_11602737123300012469Avena Fatua RhizospherePIAAKNPAVMGSGVFITYSYKVDGDTIWVTQQRNQNGPFANPVTIKAVRIE*
Ga0150984_11700865723300012469Avena Fatua RhizosphereMRPIASKNPAVMGPGVFVAYGYKLEGNTLSLTQQRNQNGPFPNPFTLKLERVE*
Ga0137398_1058189613300012683Vadose Zone SoilIASKNPAVMGPGVFITYAYKLDGDTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0157306_1027368413300012912SoilNTITMRPIASKNPAIMGPGVVITYSFKTEGKTMWVTQVRNQTGPFPNPFTAKLVRVE*
Ga0126375_1082709623300012948Tropical Forest SoilIASKNPAVMGPGVFITYSYKLEGNTLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0164303_1022249123300012957SoilSKNPAVMGPGVFITYSYTLDRDTLSLTQQRNQTGPFANPFTLKLVRVE*
Ga0164301_1030630813300012960SoilAFIAYSYKQDGDTVWVTQQRNQNGPFPNPFTIKAVRVN*
Ga0126369_1074792213300012971Tropical Forest SoilMRPIASKNPAVMGAGIFITYAYKIDGNTLSITQQRNQNGPFPNPFTLKLVRVE*
Ga0164306_1199515723300012988SoilDGGLVTMRPIASKNPAIMGPGVFITSAYTLEGDTLTLTQQRNQNGPIATPFTLKLTRVE*
Ga0157378_1133969823300013297Miscanthus RhizosphereSKNPAVMGPGVFITYAYRLDGDTLSLTQQRNQNGPFVNPFTLKLTRVE*
Ga0157375_1111397113300013308Miscanthus RhizosphereFITYTYELDGDTIRVTQQRNEHGPFANPVTIKAVRIE*
Ga0157375_1149809333300013308Miscanthus RhizosphereNLITMRPIASKNPAVMGPGVFITYTYTLEGDTLSLTQQRNQNGPYASPFTLKLTRVE*
Ga0157375_1223915513300013308Miscanthus RhizosphereMGPGVFITYAYKVDGKTLSLTQERNQSGPFPNPFTLKLVRVE*
Ga0157375_1240797023300013308Miscanthus RhizosphereVFITYSYKLDGDTMWVTQQRNQDGPFPNPVTVKVVRVE*
Ga0163163_1220634033300014325Switchgrass RhizosphereFITYSYKLDGNTIWVTQQRNQQGPFANPVTIKAVRVE*
Ga0180082_109693923300014880SoilDRVTMRPVASKNPAVMGAGVVITYSYKIEGNTLSITQVQNQSGPFANPFTTKSVRVE*
Ga0157379_1040977013300014968Switchgrass RhizosphereHRVTMRPIAAKNPAVMGPGVFITYSYKLDGDTMWVTQQRNQDGPFPNPVTVKVVRVE*
Ga0132258_1021931743300015371Arabidopsis RhizosphereSKNPAVMGPSVFITYAYKLDGSTLSLTQQRNQNGPFPAPFTLKLVRVE*
Ga0132258_1235686313300015371Arabidopsis RhizosphereSKNPAVMGPGVFITYSYKLEGDTLSLTQQRNQSGTFPNPFTLKLTRVE*
Ga0132256_10033495343300015372Arabidopsis RhizosphereVMGPGVFITYSYKLDGNKLSLTQQRNQNGPFANPFTLKLVRVE*
Ga0132256_10060221913300015372Arabidopsis RhizosphereTGENLITMRTIAAKNPAAMAPGAFIAYSYKQNGDTVWVTQQRNQNGPFPNPFTIKAVRVN
Ga0132256_10255449223300015372Arabidopsis RhizosphereDGSITMRPIASKNPAVMGPSVFITYAYKLDGSTLSLTQQRNQNGPFPAPFTLKLVRVE*
Ga0132257_10033844353300015373Arabidopsis RhizospherePAVMGPGVFLTYTYTLEGDTLSLTQQRNQNGPFASPFTLKLTRVE*
Ga0132257_10247445313300015373Arabidopsis RhizosphereGVFITYSYRLDGDTLSLTQQRNQNGPFANPFSLKLLRVE*
Ga0132255_10007077963300015374Arabidopsis RhizosphereVYTVFSYKLEGNTIQVTTVRDQNGPIPVPVTIKAVRVE*
Ga0132255_10354024013300015374Arabidopsis RhizosphereKNPAVMGPGVFITYSYKLEGDTLLLTQQRNQNGPFANPFTLKLIRVE*
Ga0182036_1166693513300016270SoilPIASKNPAVMGPGVFIAYAYKLDGDVLSLTQQRNQTGPFTNPFSLKLVRVE
Ga0134112_1030383523300017656Grasslands SoilKNPAVMGPGVFITYAYKLDGDTLSLTQERNRNGAFANPFTLKLVRVE
Ga0163161_1106545423300017792Switchgrass RhizosphereFITYSYKLEGDSLTLTQVRNQSGPYANPFLLKLVRVE
Ga0187765_1127990313300018060Tropical PeatlandASKNPAIMGPGVFITYTYKLEGNTLSLTQVRNQNGPFPNPFALKLVRVE
Ga0190272_1052297833300018429SoilAVMGPGVFIAYTYRLDGDTIWVTQQRNQHGPFANPVTIKAVRIE
Ga0190272_1321668113300018429SoilITMRPLAAKNPAAMLPGAFITYSYRLDGDTIWVTQQRNQQGPFANPVTIKAVRIE
Ga0190270_1312976713300018469SoilPIAAKNPAVMGPGVFITYSYKLDGDTMWVTQERNQNGPFANPFTIKVVRVE
Ga0190274_1361726323300018476SoilMGPGVFITYSYKLDGDTMWVTQQRNQNGPFANPVTVKVVRVE
Ga0190264_1137133423300019377SoilFITYSYKLDGDTMWVTQEKNQNGPFTNPVTAKVVRVNDGF
Ga0193733_119787323300020022SoilPGSVTMRPIASKNPAVMGAGVFITYSYKLDGDTLSLTQERNQSGPFANPFSLKLVRVE
Ga0247795_102038723300022899SoilPGVFITYSYKLDGTTLSLTQQRNQNGPFPNPFTLKLVRVE
Ga0207642_1087024023300025899Miscanthus RhizosphereASKNPAVMGPGVFITYSYKVEGDTLSLTQQRNQSGTFPNPFTLKLTRVE
Ga0207710_1054792223300025900Switchgrass RhizosphereFIVYSYKLDGDTLSFTQVRNQSGPFPNPFTAKLVRIE
Ga0207680_1025896213300025903Switchgrass RhizosphereSYKLEGNTLVITQQRNQNGSFSNPFSLKLVRVESR
Ga0207645_1063944723300025907Miscanthus RhizospherePIASKNPAVMGQGVFITYSYKLDGNTLSLTQQRNQNGLFANPFALKLVRVE
Ga0207643_1060462813300025908Miscanthus RhizosphereGVFITYSYKLDGDTIWVTQQRNEHGPFANPVTIKAVRIE
Ga0207694_1078113413300025924Corn RhizospherePNVITMRPLAAKNPAAMVPGAFITYSYRLDGDTIWLTQQRNQNGPFANPVTIKAVRIER
Ga0207650_1058731233300025925Switchgrass RhizosphereMGPGVFITYSFKLEGDTLSLTQQRNQSGPFANPFSFKAVRVE
Ga0207659_1147511123300025926Miscanthus RhizosphereMRPIASKNPAVMGPGVFITYAYTLDGDTLSLTQQRNQNGPFANPFILKLVRVE
Ga0207687_1076464313300025927Miscanthus RhizosphereIASKNPAVMGPRVFITYSYKMDATTLSLTQQRNQDGPFANPFTLKLVRVE
Ga0207701_1087326613300025930Corn, Switchgrass And Miscanthus RhizosphereQPGSLITYNYRLDGDTVWVTQKRNQNGPFANPITIKAVRVE
Ga0207706_1065875123300025933Corn RhizosphereDGLITMRPIASKNPAVMGPGVFISYSYKLGGDTLSLTQQRNQNGPFTNPFTLKFVRIE
Ga0207670_1084818023300025936Switchgrass RhizosphereMRPIASKNPAVMGEGVFITYAYKLEGDTLSLTQQRNQNGPFANPFSLKFVRAE
Ga0207711_1150075823300025941Switchgrass RhizosphereGVFTTYSYKLDGDTMFVTQERNQNGPFANPVTIKVVRVE
Ga0207651_1162646423300025960Switchgrass RhizospherePGVFITYSYKLEGDTLSLTQQRNQNGPFPNPFSFKAVRVE
Ga0207712_1050902813300025961Switchgrass RhizospherePIASKNPAVMGPGVFITYAYTLDGDTLSLTQQRNQNGPFANPVTIKAVRIER
Ga0207668_1104792423300025972Switchgrass RhizosphereSYTLEGNTLVITQQRNQNGSFSNPFSLKLVRVESR
Ga0207658_1036815133300025986Switchgrass RhizosphereMGPGVFITYSYKLEGNTLVITQQRNQNGSFSNPFSLKLVRVESR
Ga0207708_1159918023300026075Corn, Switchgrass And Miscanthus RhizosphereMRPIAAKNPAAMVPGAFITYSFKLEGDTIWVTQQRNQNGPFANPVTIKAVRIE
Ga0207702_1211217813300026078Corn RhizosphereITYTYKLDGDTLSLTQERNQNGPFKNPFSLKLTRVE
Ga0207641_1156534033300026088Switchgrass RhizosphereMGPGVFITYAYKLDGDTLSLTQQRNQNGPFPNPFTFKLVRAE
Ga0207648_1055556323300026089Miscanthus RhizosphereMRPIATKNPAAMAPGAFIAYSYKQDGDTVWVTQQRNQNGPFPNPFTIKAVRVN
Ga0207648_1175659213300026089Miscanthus RhizosphereVMGPGVFITYTYTLEGDTLSLTQQRNQNGPFPSPFTLKLTRVE
Ga0207675_10015284933300026118Switchgrass RhizosphereRVTMRPIAAKNPAVMGPGVFITYSYKLDGDTMFVTQERNQNGPFANPVTIKVVRVE
Ga0207675_10256193523300026118Switchgrass RhizosphereTMRPIASKNPAVMGPGVFITYTYTQEGDTLSLTQQRNQNGPYTSPFTLKLTRVE
Ga0207683_1088087823300026121Miscanthus RhizosphereAYSYKQDGDTVWVTQQRNQNGPFANPVTIKAVRVN
Ga0209814_1021983323300027873Populus RhizosphereMKLFITYSLKREGDTMWVTQQRNQNGPFANPFTIKVVRIE
Ga0209069_1072995313300027915WatershedsTYAYKLDGDTLSLTQQRNQNGPFASPFTLKLVRVE
Ga0268264_1015912513300028381Switchgrass RhizosphereFITYAYKLEGDTLSLTQQRNQTGPFANPFSFKAVRVE
Ga0268264_1225637123300028381Switchgrass RhizosphereGLVTMRPIASKNPAVMGPRVFITYSYKMDATTLSLTQQRNQDGPFANPFTLKLVRVE
Ga0307497_1003587223300031226SoilMRPLAAKNPAAMVPGAFITYSYRLDGDTIWLTQQRNQDGPFANPVTIKAVRIER
Ga0310887_1006350733300031547SoilRMTMRPIAAKNPAVMGPGVFITYSYKLEGNTMWVTQQRNEKGPFANPVTIKAVRVE
Ga0310887_1021140523300031547SoilPGVFITYAYRLDGDTLSLTQQRNQNGPFANPFTLKLVRVE
Ga0310886_1008689513300031562SoilPAAMAPGAFIAYTYRLEGQILWVTHQRNQAGALPNPATIKLVRVE
Ga0310892_1127765223300031858SoilAKNPAVMGPGVFITYSYKREGDTMWVTQQRNQDGPFANPATFKVVRVE
Ga0310900_1055922623300031908SoilRPIASKNPAVMGPGVFITYAYKLDGNTLSLTQQRNQNGPFANPFTLKLVRVE
Ga0310901_1002036423300031940SoilKNPAVMGPGVFITYAYKLDGNTLSLTQQRNQNGPFANPFTLKLVRVE
Ga0310885_1017399823300031943SoilTGNVITMRPIAAKNPEAMAPGAFITYTFRLEGQILWVTHQRNQAGALPNPATIKLVRVE
Ga0310885_1060413713300031943SoilFITYAYKLDGNTLSLTQQRNQNGPFANPFTLKLVRVE
Ga0310884_1003994413300031944SoilPIASKNPAVMGQGVFITYAYKLDGDTLSLTQQRNQNGPFANPFSLKFVRAE
Ga0306926_1184604913300031954SoilNPAVMGPGVFITYAYKLEGDTLSLKQQRNQNGPFPNPFTLKLIRVE
Ga0310902_1118893413300032012SoilTYAYKLDGDTLSLTQQRNQNGLFANPFALKLVRVE
Ga0310906_1110019113300032013SoilIASKNPAVMGPGVFITYSYALNGDTLSVTQQRNEKAPFANPVTFKLVRVE
Ga0310899_1016831213300032017SoilSKNPAVMGQGIFITYAYKLEGDTLSLTQQRNQNGPFANPFSLKFVRAE
Ga0318558_1022771123300032044SoilVASKNPAVMGPGVFITYAYKLDGNNLFLTQQRNQSGPFANPFTLKLVRVE
Ga0310890_1094374513300032075SoilMRPIAAKNPAAMGPGAFIAYSYKLDGNTMWVTQLRNQNGPFANPVTVKVVRVE
Ga0318525_1036146113300032089SoilKNPAVMGSGIFITYAYKLEGDTLSLTQQRNQNGPFANPFTLKLVRVE
Ga0318525_1072158413300032089SoilPGVFIAYAYKLDGDVLSLTQQRNQTGPFTNPFSLRLVRVE
Ga0310889_1024548923300032179SoilMRPIASKNPAVMGPGVFITYAYKLDGDTLALTQQRNQTGPFANPFALKLVRVE
Ga0310810_1010030353300033412SoilMRPIAAKNPAVMGSGVFIVYSYTLEGDRLLLTQQRNQNGPFTNPFTLRLVRVE
Ga0364929_0223438_476_6043300034149SedimentMAAGAFIVYSYKLDGDTLSITQVRNQTGPFPNPFTVKMARIE
Ga0373959_0006524_1792_19203300034820Rhizosphere SoilMGPGVFITYAYRLEGDTLSLTQRRNQNGPFANPFTLKFVRVE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.