Basic Information | |
---|---|
Family ID | F028883 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 190 |
Average Sequence Length | 45 residues |
Representative Sequence | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPE |
Number of Associated Samples | 155 |
Number of Associated Scaffolds | 190 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 65.96 % |
% of genes near scaffold ends (potentially truncated) | 96.84 % |
% of genes from short scaffolds (< 2000 bps) | 88.95 % |
Associated GOLD sequencing projects | 148 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.895 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.263 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.737 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.158 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 190 Family Scaffolds |
---|---|---|
PF12680 | SnoaL_2 | 4.21 |
PF13671 | AAA_33 | 3.16 |
PF01636 | APH | 2.63 |
PF13560 | HTH_31 | 2.63 |
PF03259 | Robl_LC7 | 2.11 |
PF01152 | Bac_globin | 1.58 |
PF13551 | HTH_29 | 1.58 |
PF12089 | DUF3566 | 1.58 |
PF00583 | Acetyltransf_1 | 1.05 |
PF05721 | PhyH | 1.05 |
PF00498 | FHA | 1.05 |
PF13358 | DDE_3 | 1.05 |
PF08044 | DUF1707 | 1.05 |
PF17206 | SeqA_N | 1.05 |
PF10056 | DUF2293 | 1.05 |
PF00106 | adh_short | 0.53 |
PF02627 | CMD | 0.53 |
PF00582 | Usp | 0.53 |
PF03795 | YCII | 0.53 |
PF03551 | PadR | 0.53 |
PF13592 | HTH_33 | 0.53 |
PF08281 | Sigma70_r4_2 | 0.53 |
PF05977 | MFS_3 | 0.53 |
PF01163 | RIO1 | 0.53 |
PF03480 | DctP | 0.53 |
PF03050 | DDE_Tnp_IS66 | 0.53 |
PF13186 | SPASM | 0.53 |
PF00027 | cNMP_binding | 0.53 |
PF12401 | FhaA_N | 0.53 |
PF13586 | DDE_Tnp_1_2 | 0.53 |
PF00135 | COesterase | 0.53 |
PF01494 | FAD_binding_3 | 0.53 |
PF00665 | rve | 0.53 |
PF02371 | Transposase_20 | 0.53 |
PF13360 | PQQ_2 | 0.53 |
PF01717 | Meth_synt_2 | 0.53 |
PF02195 | ParBc | 0.53 |
PF00589 | Phage_integrase | 0.53 |
PF00144 | Beta-lactamase | 0.53 |
PF03372 | Exo_endo_phos | 0.53 |
PF01590 | GAF | 0.53 |
PF00239 | Resolvase | 0.53 |
PF03160 | Calx-beta | 0.53 |
PF04909 | Amidohydro_2 | 0.53 |
PF02517 | Rce1-like | 0.53 |
PF12681 | Glyoxalase_2 | 0.53 |
PF12904 | Collagen_bind_2 | 0.53 |
PF11139 | SfLAP | 0.53 |
PF01872 | RibD_C | 0.53 |
PF00753 | Lactamase_B | 0.53 |
PF12697 | Abhydrolase_6 | 0.53 |
PF02861 | Clp_N | 0.53 |
PF01070 | FMN_dh | 0.53 |
PF13442 | Cytochrome_CBB3 | 0.53 |
PF00171 | Aldedh | 0.53 |
PF03925 | SeqA | 0.53 |
PF02770 | Acyl-CoA_dh_M | 0.53 |
COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
---|---|---|---|
COG2018 | Predicted regulator of Ras-like GTPase activity, Roadblock/LC7/MglB family | Signal transduction mechanisms [T] | 2.11 |
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 1.58 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.05 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.05 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.53 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.53 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.53 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.53 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.53 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.53 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.53 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.53 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.53 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.53 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.53 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.53 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.53 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.53 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.53 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.53 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.53 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.53 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.53 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.53 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.53 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.53 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.53 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.53 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.53 |
COG3057 | Negative regulator of replication initiation SeqA | Replication, recombination and repair [L] | 0.53 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.53 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.53 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.53 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.89 % |
Unclassified | root | N/A | 42.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_161291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 994 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0876183 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300000956|JGI10216J12902_102675780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3000 | Open in IMG/M |
3300000956|JGI10216J12902_103038318 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300000956|JGI10216J12902_119410091 | Not Available | 579 | Open in IMG/M |
3300004081|Ga0063454_102040691 | Not Available | 508 | Open in IMG/M |
3300005093|Ga0062594_101129643 | Not Available | 769 | Open in IMG/M |
3300005093|Ga0062594_101517027 | Not Available | 688 | Open in IMG/M |
3300005332|Ga0066388_105863193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
3300005332|Ga0066388_106532710 | Not Available | 588 | Open in IMG/M |
3300005332|Ga0066388_106876149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
3300005338|Ga0068868_101791762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 580 | Open in IMG/M |
3300005341|Ga0070691_10776080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
3300005344|Ga0070661_100268074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1322 | Open in IMG/M |
3300005356|Ga0070674_102135239 | Not Available | 511 | Open in IMG/M |
3300005435|Ga0070714_100421545 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300005435|Ga0070714_101312151 | Not Available | 706 | Open in IMG/M |
3300005436|Ga0070713_100694108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 971 | Open in IMG/M |
3300005436|Ga0070713_101177886 | Not Available | 741 | Open in IMG/M |
3300005436|Ga0070713_102116192 | Not Available | 545 | Open in IMG/M |
3300005436|Ga0070713_102476225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300005437|Ga0070710_10002108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9419 | Open in IMG/M |
3300005437|Ga0070710_10022892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3275 | Open in IMG/M |
3300005439|Ga0070711_100581316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
3300005440|Ga0070705_100137815 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
3300005451|Ga0066681_10974758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
3300005456|Ga0070678_102060947 | Not Available | 540 | Open in IMG/M |
3300005458|Ga0070681_11836771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Calidithermus → Calidithermus timidus | 533 | Open in IMG/M |
3300005466|Ga0070685_11021948 | Not Available | 621 | Open in IMG/M |
3300005518|Ga0070699_101259183 | Not Available | 678 | Open in IMG/M |
3300005524|Ga0070737_10146792 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300005533|Ga0070734_10762072 | Not Available | 550 | Open in IMG/M |
3300005535|Ga0070684_100594379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1029 | Open in IMG/M |
3300005548|Ga0070665_101234924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7 | 758 | Open in IMG/M |
3300005559|Ga0066700_10109459 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300005586|Ga0066691_10748974 | Not Available | 577 | Open in IMG/M |
3300005618|Ga0068864_102725554 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005712|Ga0070764_10506079 | Not Available | 727 | Open in IMG/M |
3300005764|Ga0066903_104297886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
3300005840|Ga0068870_10069322 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
3300006028|Ga0070717_10113038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2318 | Open in IMG/M |
3300006028|Ga0070717_11614350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
3300006028|Ga0070717_11692107 | Not Available | 572 | Open in IMG/M |
3300006059|Ga0075017_100455510 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300006175|Ga0070712_100039167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3243 | Open in IMG/M |
3300006175|Ga0070712_100295001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1310 | Open in IMG/M |
3300006358|Ga0068871_102429300 | Not Available | 500 | Open in IMG/M |
3300006800|Ga0066660_11157621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300006804|Ga0079221_10864012 | Not Available | 658 | Open in IMG/M |
3300006845|Ga0075421_102026418 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300006893|Ga0073928_10865964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 621 | Open in IMG/M |
3300006954|Ga0079219_10047573 | Not Available | 1825 | Open in IMG/M |
3300009012|Ga0066710_104575516 | Not Available | 517 | Open in IMG/M |
3300009094|Ga0111539_11344648 | Not Available | 829 | Open in IMG/M |
3300009100|Ga0075418_12814242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
3300009101|Ga0105247_11151764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
3300009137|Ga0066709_102845304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300009148|Ga0105243_11047053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7 | 821 | Open in IMG/M |
3300009174|Ga0105241_10423439 | Not Available | 1172 | Open in IMG/M |
3300009176|Ga0105242_10267950 | Not Available | 1546 | Open in IMG/M |
3300009686|Ga0123338_10279469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix | 735 | Open in IMG/M |
3300009792|Ga0126374_11811036 | Not Available | 511 | Open in IMG/M |
3300010043|Ga0126380_11600053 | Not Available | 581 | Open in IMG/M |
3300010048|Ga0126373_10055055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3546 | Open in IMG/M |
3300010048|Ga0126373_12356976 | Not Available | 592 | Open in IMG/M |
3300010360|Ga0126372_10185791 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300010360|Ga0126372_10650506 | Not Available | 1020 | Open in IMG/M |
3300010360|Ga0126372_11176330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
3300010360|Ga0126372_12272973 | Not Available | 592 | Open in IMG/M |
3300010361|Ga0126378_10126600 | Not Available | 2568 | Open in IMG/M |
3300010361|Ga0126378_10276593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1778 | Open in IMG/M |
3300010361|Ga0126378_13068414 | Not Available | 532 | Open in IMG/M |
3300010366|Ga0126379_11809093 | Not Available | 715 | Open in IMG/M |
3300010373|Ga0134128_10484434 | Not Available | 1379 | Open in IMG/M |
3300010373|Ga0134128_11167965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 849 | Open in IMG/M |
3300010375|Ga0105239_10158936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2524 | Open in IMG/M |
3300010376|Ga0126381_100141575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 3144 | Open in IMG/M |
3300010396|Ga0134126_10545770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1331 | Open in IMG/M |
3300010401|Ga0134121_11509696 | Not Available | 687 | Open in IMG/M |
3300010880|Ga0126350_11908664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
3300012198|Ga0137364_10593350 | Not Available | 835 | Open in IMG/M |
3300012200|Ga0137382_10221030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1306 | Open in IMG/M |
3300012208|Ga0137376_10441790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1129 | Open in IMG/M |
3300012356|Ga0137371_10078710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2556 | Open in IMG/M |
3300012363|Ga0137390_11609472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300012497|Ga0157319_1016095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
3300012682|Ga0136611_10509633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
3300012922|Ga0137394_11180012 | Not Available | 629 | Open in IMG/M |
3300012930|Ga0137407_12275418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300012951|Ga0164300_10476129 | Not Available | 707 | Open in IMG/M |
3300012958|Ga0164299_10126285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1377 | Open in IMG/M |
3300012960|Ga0164301_10167933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1363 | Open in IMG/M |
3300012961|Ga0164302_10691893 | Not Available | 754 | Open in IMG/M |
3300012985|Ga0164308_10448843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
3300012987|Ga0164307_10518722 | Not Available | 904 | Open in IMG/M |
3300013296|Ga0157374_11388760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
3300013306|Ga0163162_12053812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
3300013306|Ga0163162_12149537 | Not Available | 640 | Open in IMG/M |
3300013307|Ga0157372_10645967 | Not Available | 1232 | Open in IMG/M |
3300013307|Ga0157372_12472186 | Not Available | 596 | Open in IMG/M |
3300014745|Ga0157377_10871328 | Not Available | 670 | Open in IMG/M |
3300014969|Ga0157376_10856690 | Not Available | 924 | Open in IMG/M |
3300014969|Ga0157376_12415631 | Not Available | 565 | Open in IMG/M |
3300015190|Ga0167651_1038657 | Not Available | 1022 | Open in IMG/M |
3300015372|Ga0132256_101834490 | Not Available | 714 | Open in IMG/M |
3300016294|Ga0182041_11316041 | Not Available | 661 | Open in IMG/M |
3300016371|Ga0182034_11483547 | Not Available | 594 | Open in IMG/M |
3300016422|Ga0182039_10852175 | Not Available | 811 | Open in IMG/M |
3300016445|Ga0182038_10725463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
3300017947|Ga0187785_10499736 | Not Available | 606 | Open in IMG/M |
3300018081|Ga0184625_10376644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
3300021080|Ga0210382_10445028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300021405|Ga0210387_11231555 | Not Available | 649 | Open in IMG/M |
3300021432|Ga0210384_11668112 | Not Available | 543 | Open in IMG/M |
3300021475|Ga0210392_10636269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
3300021478|Ga0210402_10888510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300021478|Ga0210402_11450435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
3300021560|Ga0126371_10235323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1941 | Open in IMG/M |
3300021560|Ga0126371_12867361 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300022724|Ga0242665_10404353 | Not Available | 500 | Open in IMG/M |
3300024286|Ga0247687_1015348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7 | 1058 | Open in IMG/M |
3300024310|Ga0247681_1065186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300025885|Ga0207653_10013376 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
3300025906|Ga0207699_10374573 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300025906|Ga0207699_10748936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 717 | Open in IMG/M |
3300025906|Ga0207699_10792824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
3300025913|Ga0207695_10019316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7847 | Open in IMG/M |
3300025915|Ga0207693_10438452 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300025915|Ga0207693_10450160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1006 | Open in IMG/M |
3300025921|Ga0207652_11481146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
3300025928|Ga0207700_11118857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
3300025931|Ga0207644_11557795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
3300025941|Ga0207711_11641445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7 | 586 | Open in IMG/M |
3300026095|Ga0207676_12194372 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300026318|Ga0209471_1278192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
3300026508|Ga0257161_1136745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300027725|Ga0209178_1318258 | Not Available | 576 | Open in IMG/M |
3300027889|Ga0209380_10118212 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300027889|Ga0209380_10160367 | Not Available | 1316 | Open in IMG/M |
3300027915|Ga0209069_10271156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
3300028006|Ga0247717_1042511 | Not Available | 713 | Open in IMG/M |
3300028379|Ga0268266_11136388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7 | 756 | Open in IMG/M |
3300028380|Ga0268265_12662091 | Not Available | 506 | Open in IMG/M |
3300028592|Ga0247822_10357925 | Not Available | 1129 | Open in IMG/M |
3300028828|Ga0307312_10262795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
3300028828|Ga0307312_10629527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 710 | Open in IMG/M |
3300029636|Ga0222749_10555754 | Not Available | 625 | Open in IMG/M |
3300031234|Ga0302325_10410005 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
3300031251|Ga0265327_10288501 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300031543|Ga0318516_10290128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 945 | Open in IMG/M |
3300031546|Ga0318538_10628975 | Not Available | 582 | Open in IMG/M |
3300031564|Ga0318573_10633366 | Not Available | 575 | Open in IMG/M |
3300031572|Ga0318515_10093433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1571 | Open in IMG/M |
3300031640|Ga0318555_10517477 | Not Available | 647 | Open in IMG/M |
3300031671|Ga0307372_10376957 | Not Available | 741 | Open in IMG/M |
3300031681|Ga0318572_10864169 | Not Available | 537 | Open in IMG/M |
3300031708|Ga0310686_109878907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1876 | Open in IMG/M |
3300031708|Ga0310686_114068893 | Not Available | 1339 | Open in IMG/M |
3300031712|Ga0265342_10713981 | Not Available | 500 | Open in IMG/M |
3300031713|Ga0318496_10568704 | Not Available | 626 | Open in IMG/M |
3300031726|Ga0302321_100106650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 2815 | Open in IMG/M |
3300031748|Ga0318492_10761235 | Not Available | 520 | Open in IMG/M |
3300031765|Ga0318554_10055316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2178 | Open in IMG/M |
3300031778|Ga0318498_10496808 | Not Available | 537 | Open in IMG/M |
3300031793|Ga0318548_10366463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
3300031805|Ga0318497_10029555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2728 | Open in IMG/M |
3300031805|Ga0318497_10151545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1269 | Open in IMG/M |
3300031860|Ga0318495_10287136 | Not Available | 733 | Open in IMG/M |
3300031879|Ga0306919_11090383 | Not Available | 609 | Open in IMG/M |
3300031893|Ga0318536_10616407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 542 | Open in IMG/M |
3300031897|Ga0318520_10506974 | Not Available | 745 | Open in IMG/M |
3300031912|Ga0306921_11180023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 854 | Open in IMG/M |
3300031912|Ga0306921_11801131 | Not Available | 658 | Open in IMG/M |
3300031946|Ga0310910_10881823 | Not Available | 702 | Open in IMG/M |
3300031981|Ga0318531_10008583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3739 | Open in IMG/M |
3300032001|Ga0306922_12222659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 528 | Open in IMG/M |
3300032002|Ga0307416_100507780 | Not Available | 1271 | Open in IMG/M |
3300032063|Ga0318504_10571566 | Not Available | 542 | Open in IMG/M |
3300032076|Ga0306924_10264299 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
3300032076|Ga0306924_10458563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1455 | Open in IMG/M |
3300032160|Ga0311301_10203975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3380 | Open in IMG/M |
3300032205|Ga0307472_100281048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1325 | Open in IMG/M |
3300032770|Ga0335085_12408694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300032805|Ga0335078_12137461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 593 | Open in IMG/M |
3300032896|Ga0335075_10951922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 778 | Open in IMG/M |
3300033134|Ga0335073_10052872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 5420 | Open in IMG/M |
3300033134|Ga0335073_11541895 | Not Available | 638 | Open in IMG/M |
3300033158|Ga0335077_11983248 | Not Available | 541 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.74% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.16% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.11% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.11% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.58% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.58% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.58% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.05% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.05% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.05% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.05% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.05% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.05% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.05% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.05% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.53% |
Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.53% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.53% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.53% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.53% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.53% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.53% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.53% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.53% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.53% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.53% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.53% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.53% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028006 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-4-E_N | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_02681920 | 2199352025 | Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEGISPT |
ICChiseqgaiiDRAFT_08761832 | 3300000033 | Soil | VRVPDRSLTELRERGYLVLEGFLGADELAAAREALWLHYPR |
JGI10216J12902_1026757801 | 3300000956 | Soil | MRVPDRCLADLRERGYLLFEGFLEAGELAAAREALWLHYPRP |
JGI10216J12902_1030383182 | 3300000956 | Soil | MRVPDGCVADLRHRGHLVFEDFLEADELAAAQDALWLHYPRPEE |
JGI10216J12902_1194100911 | 3300000956 | Soil | MRVPDRCVADLQQRGYLLFEGFLAADELAAAQEALWLHYPRPEEYF |
Ga0063454_1020406913 | 3300004081 | Soil | MRVPDRCVVELHQLGYLVFEGFLEADELAAAQEALWLHYPRPDQYFADPAAHAWLAA |
Ga0062594_1011296432 | 3300005093 | Soil | MRVPDRCLADLRQRGYLVFEDFLDPDELAAAQEALWLHYPRPEEYFA |
Ga0062594_1015170272 | 3300005093 | Soil | MRVPDHCLAQLRERGYLVLEGFRGTDELAAAQEALWLHYPRPDEYFADLTPYG* |
Ga0066388_1058631932 | 3300005332 | Tropical Forest Soil | MRVPDGCLAELRERGFLVFEDFLGTDELAAAQAALWLHYPRPEEYFADPAAHAWL |
Ga0066388_1065327102 | 3300005332 | Tropical Forest Soil | MRVPDSCVADLRERGYLLFEGFLEAGELAAAREALWLHYPRPE |
Ga0066388_1068761492 | 3300005332 | Tropical Forest Soil | MRVPDGCLVDLRERGYLLFEGFLGADELAAAREALWLHYPRPE |
Ga0068868_1017917621 | 3300005338 | Miscanthus Rhizosphere | MRVPDRCVADLRDQGYLVFEGFLDRDELEAAQEALWLHYPRPEEYFA |
Ga0070691_107760801 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVPDRCLADLREQGYLLFEGFLEADELTAAQEALWLHYPRPEVYFADPAAHAW |
Ga0070661_1002680741 | 3300005344 | Corn Rhizosphere | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPE |
Ga0070674_1021352392 | 3300005356 | Miscanthus Rhizosphere | MRVPDRCLADLCEQGYLVFEGFLNADELAAAQEALWLHYPRPEEYFADPAA |
Ga0070714_1004215453 | 3300005435 | Agricultural Soil | VPDRCLTELRERGYLVFEGFLGAGELAAAQEALWLHFPRP |
Ga0070714_1013121513 | 3300005435 | Agricultural Soil | MRVPDRCVADLRDRGYLIFEGFLGAGELAAAQEALWLHYPRPGEYFADPAAYAWL |
Ga0070713_1006941083 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPR |
Ga0070713_1011778861 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VPERCLTELRERGYLVFEGFLGAGELAAAQEALWLHFPRP |
Ga0070713_1021161922 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPR |
Ga0070713_1024762251 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFP |
Ga0070710_100021081 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFA |
Ga0070710_100228925 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVPDRCVADLREQGYLLFEGFLGADELAAAQEALWLHYPQPEVYFADPAAHAWL |
Ga0070711_1005813161 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPESYFADPAA |
Ga0070705_1001378151 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VADLRERGYLVFEGFLDAEELAEAQEALWLHYPRPEDYFA |
Ga0066681_109747581 | 3300005451 | Soil | MRVPDRCLGDLRERGYLVFEGFLAADELAVAQAALWLRYPRPDEYFAHRAAH |
Ga0070678_1020609471 | 3300005456 | Miscanthus Rhizosphere | MRVPDRCVTDLRERGFLVFEDFLAADELAAAQEALWLHYPRPEEYFADPAAH |
Ga0070681_118367711 | 3300005458 | Corn Rhizosphere | MRVPDRCVADLRDQGYLIFEGFLEADELAAAQDALWLHYPRPEEYFADPAAHAWLA |
Ga0070685_110219482 | 3300005466 | Switchgrass Rhizosphere | MRVPDRCLADLCERGFLVFEGFLDADELAAAQEALWLHYPRPEEYFADPAAH |
Ga0070699_1012591832 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVPDRNLQELREQGFTIVEAFLAPDELEAAQEALWVHYPRPEQYFADRSAHQEYTRS |
Ga0070737_101467922 | 3300005524 | Surface Soil | VRVPERCLTELRQQGFFVFEGFLGTDELAAAQAALWRHYP |
Ga0070734_107620722 | 3300005533 | Surface Soil | MRVPDRCVADLRDRGYLIFEGFLEADELAAAQDALWLHYPRPGEYFADP |
Ga0070684_1005943791 | 3300005535 | Corn Rhizosphere | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFAD |
Ga0070665_1012349242 | 3300005548 | Switchgrass Rhizosphere | VPERCVADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPGEYFADPA |
Ga0066700_101094591 | 3300005559 | Soil | MRVPDRCLADLRELGYLVFEGFLNADELAAAQEALWLHYPRPEEFFADP |
Ga0066691_107489742 | 3300005586 | Soil | MRVPDRCLAELRERGYLVFESFLGADELAGAQKALWLHYPRPEEYF |
Ga0068864_1027255541 | 3300005618 | Switchgrass Rhizosphere | MKVPDRCLADLRERGYLVFEGFLEADELAAAQEALWLHYPQPEEYF |
Ga0070764_105060791 | 3300005712 | Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRP |
Ga0066903_1042978861 | 3300005764 | Tropical Forest Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVY |
Ga0068870_100693221 | 3300005840 | Miscanthus Rhizosphere | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLH |
Ga0070717_101130381 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVPDRCLADLRERGYLLFEGFLEADELATAREALWLHYPRPETYFADPAAHAWLA |
Ga0070717_116143502 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWL |
Ga0070717_116921073 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPRP |
Ga0075017_1004555101 | 3300006059 | Watersheds | MRVPDRCLAELRERGYLVFESFLAAHELAAAQEALWLHYPRPEEYFANPAAHT |
Ga0070712_1000391675 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVPDRCVVDLRDRGYLIFEGFLEADELAAAQDALWLHYPRPEEYFADPAAHAWLAT |
Ga0070712_1002950013 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADP |
Ga0068871_1024293001 | 3300006358 | Miscanthus Rhizosphere | MRVPDRCLADLRQRGYLVFEDFLDPDELAAAQEALWLHYPRPEEYFADPAAH |
Ga0066660_111576213 | 3300006800 | Soil | MRVPDGCLAQLRERGYLVFEGFLGADELAAAQEALWLHYPRPEEYFAD |
Ga0079221_108640121 | 3300006804 | Agricultural Soil | MKVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPESYFADPAA |
Ga0075428_1023161411 | 3300006844 | Populus Rhizosphere | VKVPDRNLHDLREQGFTIVEGFLAPDELKAAQEALWLH |
Ga0075421_1020264182 | 3300006845 | Populus Rhizosphere | VKVPDRNLHDLREQGFTIVEGFLAPDELKAAQEALWLHYPRPEEYFADP |
Ga0073928_108659642 | 3300006893 | Iron-Sulfur Acid Spring | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEV |
Ga0079219_100475731 | 3300006954 | Agricultural Soil | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADP |
Ga0066710_1045755162 | 3300009012 | Grasslands Soil | MRVPDHCLADLREKGYLLFEGFLSPDELSAAQDALWLHYPR |
Ga0111539_113446481 | 3300009094 | Populus Rhizosphere | VKVPDRKVHELRERGFTIVEGFLAPDELEAAREALWLHYPRPEEYF |
Ga0075418_128142421 | 3300009100 | Populus Rhizosphere | VKVPDRNLHDLREQGFTIVEGFLAPDEAEAAQEALWLHYPRPEEYFADPSAHHEYA |
Ga0105247_111517642 | 3300009101 | Switchgrass Rhizosphere | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHF |
Ga0066709_1028453042 | 3300009137 | Grasslands Soil | MRVPDRCVAELQDRGYLVFEGFLEADELAAAQEALWLHYPRPEEYFAD |
Ga0105243_110470531 | 3300009148 | Miscanthus Rhizosphere | VADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPGEYFADPAAYAW |
Ga0105241_104234393 | 3300009174 | Corn Rhizosphere | VPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPR |
Ga0105242_102679501 | 3300009176 | Miscanthus Rhizosphere | VADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPGEYFADPAAYAWLATSQ |
Ga0123338_102794691 | 3300009686 | Glacier Valley | MRIPDAAIDAVREHGYVVVPGFLGARELERAQEALWLHYPKPDEYFADPAAHAKY |
Ga0126374_118110361 | 3300009792 | Tropical Forest Soil | MRVPDRCVTDLRERGYLVFEGFLAGDELAEAQDALWLHYPRPEEYFSDPA |
Ga0126380_116000533 | 3300010043 | Tropical Forest Soil | MRVPDRCLADLRERGYLVFEGFLDADELAAAQEALWLHY |
Ga0126373_100550551 | 3300010048 | Tropical Forest Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALW |
Ga0126373_123569761 | 3300010048 | Tropical Forest Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHAWL |
Ga0126372_101857911 | 3300010360 | Tropical Forest Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQDAL |
Ga0126372_106505061 | 3300010360 | Tropical Forest Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEAL |
Ga0126372_111763301 | 3300010360 | Tropical Forest Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAREAL |
Ga0126372_122729732 | 3300010360 | Tropical Forest Soil | MRVPDPRLADLRERGYLLFEGFLEADELAAAREALWLHYP |
Ga0126378_101266001 | 3300010361 | Tropical Forest Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHY |
Ga0126378_102765934 | 3300010361 | Tropical Forest Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFA |
Ga0126378_130684141 | 3300010361 | Tropical Forest Soil | LTDLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHAWLATDQ |
Ga0126379_118090931 | 3300010366 | Tropical Forest Soil | LADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAH |
Ga0134128_104844342 | 3300010373 | Terrestrial Soil | VPGRCLTELRERGYLVFEGFLGADELAAAQEALWLHF |
Ga0134128_111679651 | 3300010373 | Terrestrial Soil | VRVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPA |
Ga0105239_101589364 | 3300010375 | Corn Rhizosphere | VADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPGEYFADPAAYAWLATS |
Ga0126381_1001415751 | 3300010376 | Tropical Forest Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPE |
Ga0134126_105457701 | 3300010396 | Terrestrial Soil | MRVPDRCVVDLRDRGYLIFEGFLEADELAAAQDALWLHY |
Ga0134121_115096961 | 3300010401 | Terrestrial Soil | VGVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHF |
Ga0126350_119086641 | 3300010880 | Boreal Forest Soil | MRVPDRCLADLRHRGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAH |
Ga0137364_105933501 | 3300012198 | Vadose Zone Soil | MRVPDHCLADLREKGYLLFEGFLSADELAAAQEALWLHYPRPEVYFADPA |
Ga0137382_102210304 | 3300012200 | Vadose Zone Soil | MRVPDHCLADLREKGYLLYEGFLSADELAAAQEALWLHYP |
Ga0137376_104417901 | 3300012208 | Vadose Zone Soil | MRVPDHCLADLREKGYLLYEGFLSADELAAAQEALWLHYPRPEE |
Ga0137371_100787101 | 3300012356 | Vadose Zone Soil | MKVPDRCLADLRERGYLLFEGFLEADELAAAREALWLHYPRP |
Ga0137390_116094722 | 3300012363 | Vadose Zone Soil | MRVPDRCLADLRERGYLVFEGFLGADELAAAQEALWLHYPTPEQYFADPAA |
Ga0157319_10160951 | 3300012497 | Arabidopsis Rhizosphere | VRVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPGEY |
Ga0136611_105096331 | 3300012682 | Polar Desert Sand | MRVPDRCVADLRERGYLVFEGFLEADELIAAKEALWLHYPQ |
Ga0137394_111800121 | 3300012922 | Vadose Zone Soil | LADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEEYFADPAAHAWL |
Ga0137407_122754182 | 3300012930 | Vadose Zone Soil | MRVPDRCLADLRELGYLVFEGFLNADELVAAQEALWLHYPR |
Ga0164300_104761292 | 3300012951 | Soil | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPAAYAWLA |
Ga0164299_101262852 | 3300012958 | Soil | VRVPDRCLTELRERGYLVFEGFLGADELAAAQEAL* |
Ga0164301_101679333 | 3300012960 | Soil | MRVPDRCVADLRKQGYLVVEDFLAADELEAAQEALWLHYPRPDEYFADPA |
Ga0164302_106918931 | 3300012961 | Soil | MRVPDRCVADLRKQGYLVVEDFLAADELEAAQEALWLHYPRP |
Ga0164308_104488433 | 3300012985 | Soil | MRVPDRGVADLREVGALVFEGFLAADELAAAQEALWLHYPRPEEYFADPAAHAWLA |
Ga0164307_105187223 | 3300012987 | Soil | MRVPDLGVADLRQQGYLVVEDFRAADELEAAQEALWLHYP |
Ga0157374_113887601 | 3300013296 | Miscanthus Rhizosphere | MRVPDHCLADLREQGYLLFEGFLEADELAAAQEALWL |
Ga0163162_120538121 | 3300013306 | Switchgrass Rhizosphere | MRVPEHCLSDLRERGFLVCEGFLGRDELAAAQEALWLHDPRPEKYFEDPAAF |
Ga0163162_121495372 | 3300013306 | Switchgrass Rhizosphere | MRVPDRCLADLRQRGYLVFEGFLEADELAAAQEALWLHYPRPEEYFADP |
Ga0157372_106459671 | 3300013307 | Corn Rhizosphere | VRVPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPAAYA |
Ga0157372_124721862 | 3300013307 | Corn Rhizosphere | MKVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRP |
Ga0157377_108713281 | 3300014745 | Miscanthus Rhizosphere | VRVPDRCLTELREQGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPA |
Ga0157376_108566901 | 3300014969 | Miscanthus Rhizosphere | VRVPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFA |
Ga0157376_124156312 | 3300014969 | Miscanthus Rhizosphere | MRVPDRCLADLRQRGYLVFEGFLAADELAAAQEALWLHYPRPEEYFADPAAHA |
Ga0167651_10386572 | 3300015190 | Glacier Forefield Soil | LADLRQRGYLVFEGFLEADELAAAQEALWLHYPRPEE |
Ga0132256_1018344901 | 3300015372 | Arabidopsis Rhizosphere | VKVPDRNLRELRERGFTVVEGFLGRDELTAAQAALWLHYPRPEEYFA |
Ga0182041_113160412 | 3300016294 | Soil | VPEGCLADLRERGYLLFEGFLEADELAAAQEALWL |
Ga0182034_114835472 | 3300016371 | Soil | VPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHY |
Ga0182039_108521751 | 3300016422 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEAYF |
Ga0182038_107254631 | 3300016445 | Soil | VPHGCLADLRERGYLLFEGFLEADALAAAQEALWLHYPRPEAYF |
Ga0187785_104997362 | 3300017947 | Tropical Peatland | VPDRCLADLRERGYLLFEGFLGADELAAAREALWLH |
Ga0184625_103766442 | 3300018081 | Groundwater Sediment | MRVPDRCLADLRERGYMAFEGFLEADEVAAARDAL |
Ga0190265_104135792 | 3300018422 | Soil | VEVPDRNLRDLREQGFTIVEGFLAPDELEAAQEALWVHYPRPEEYF |
Ga0210382_104450282 | 3300021080 | Groundwater Sediment | MLVRVPDRCVTELRERGYFVFEGFLGADELAAAQEALWLHYPRPEEYFADSGAHAW |
Ga0210387_112315551 | 3300021405 | Soil | MRVPDQCLADLRERGYFVFEGFLKADELAAAQEALWTYFP |
Ga0210384_116681122 | 3300021432 | Soil | MRVPDQCVSDLRERGFLVFEGFLGTEELAMAREMLWRHFPRPEEYFA |
Ga0210392_106362692 | 3300021475 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPESYFADPAAHAWLAT |
Ga0210402_108885101 | 3300021478 | Soil | VPDRCLTELRERGYLVFEGFLEADELAAAREALWLHFP |
Ga0210402_114504351 | 3300021478 | Soil | MKVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPESYFADPAAHAWL |
Ga0126371_102353233 | 3300021560 | Tropical Forest Soil | VPDHCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHA |
Ga0126371_128673612 | 3300021560 | Tropical Forest Soil | MRVPDRCVTDLRERGYLVFEGFLAGDELAEAQDALWLHYP |
Ga0242665_104043531 | 3300022724 | Soil | VPNRCLAALRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHAWLAT |
Ga0247687_10153482 | 3300024286 | Soil | VPERCVADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPG |
Ga0247681_10651862 | 3300024310 | Soil | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWL |
Ga0207653_100133761 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRP |
Ga0207699_103745731 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVPDRCLAGLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAA |
Ga0207699_107489362 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLADLRERGYLLFEGFLEADELAAAREALWLHY |
Ga0207699_107928242 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHAW |
Ga0207695_100193167 | 3300025913 | Corn Rhizosphere | MRVPDRCVADLREVGALVFEGFLAADELAAAQEAL |
Ga0207693_104384524 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLH |
Ga0207693_104501603 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYP |
Ga0207652_114811462 | 3300025921 | Corn Rhizosphere | MRVPDRCLADLRERGYLLFEGFLGADELAAAREALWLHYPRPEV |
Ga0207700_111188572 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYP |
Ga0207644_115577952 | 3300025931 | Switchgrass Rhizosphere | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPAA |
Ga0207711_116414451 | 3300025941 | Switchgrass Rhizosphere | VPERCLTELRERGYLVFEGFLGAGELAAAQEALWLHFP |
Ga0207676_121943721 | 3300026095 | Switchgrass Rhizosphere | MKVPDRCLADLRERGYLVFEGFLEADELAAAQEALWLHYPQPEEYFAH |
Ga0209471_12781922 | 3300026318 | Soil | MRAPDRCLAELRERGYLVFESFLGADELAAAQEALWLHYPRPEEYFANPA |
Ga0257161_11367452 | 3300026508 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPESY |
Ga0209178_13182581 | 3300027725 | Agricultural Soil | VRGMKVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPESY |
Ga0209380_101182122 | 3300027889 | Soil | MRVPDRCLMDLRERGYFVFEGFLGADELAAAQEALWLHYPRPEEYFANPAAHAWLANS |
Ga0209380_101603671 | 3300027889 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADP |
Ga0209069_102711561 | 3300027915 | Watersheds | MRVPDRCVADLRESGYLVFEGFLDADELAAAQEALWLHYPRPEEY |
Ga0247717_10425111 | 3300028006 | Soil | MRVPDRYLAGLREQGYLVFEGFLAADELAAAQESLWFHYPRPHE |
Ga0268266_111363882 | 3300028379 | Switchgrass Rhizosphere | VPERCLTELRERGYLVFEGFLGAGELAAAQEALWLHFPRPGEYFADPAA |
Ga0268265_126620912 | 3300028380 | Switchgrass Rhizosphere | MRVPDRCLADLRERGYLVFEGFLEADELAAAQEALWLHY |
Ga0247822_103579252 | 3300028592 | Soil | MRVPDRCLADLRDRGFLVFEGFLGADELAAAQEALWLHYPRPEEYF |
Ga0307312_102627951 | 3300028828 | Soil | MRVPDRCLAGLRERGYLLLEGFLEADELAAAQEALW |
Ga0307312_106295271 | 3300028828 | Soil | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPGEYFADPAAY |
Ga0222749_105557541 | 3300029636 | Soil | MRVPDRCVADLRQRGYLVFEGFLDADELAAAQEALWLHYPRPEEYFADPAAH |
Ga0302325_104100051 | 3300031234 | Palsa | MRVPDQCLADLRERGYLVFEGFLAADELAAAQRALWSHFPRPEEYFAD |
Ga0265327_102885012 | 3300031251 | Rhizosphere | MRPGQLASMRMPDRCVAELRERGYLVFEGFLGTDELAAAQEALWLH |
Ga0318516_102901282 | 3300031543 | Soil | VPDGCLADLREQGYLLFEGFLGADELAAGSAATGLPGPRPEAYF |
Ga0318538_106289751 | 3300031546 | Soil | VPDGCLADLRERGYLLFEGFLEADELAAAQEALWLH |
Ga0318573_106333661 | 3300031564 | Soil | VPDGCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPA |
Ga0318515_100934331 | 3300031572 | Soil | MRVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHY |
Ga0318555_105174772 | 3300031640 | Soil | VPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHYP |
Ga0307372_103769571 | 3300031671 | Soil | MLVKVPDRCLTDLRERGYLIFEGFLAANELAAAREALWLHYPP |
Ga0318572_108641691 | 3300031681 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPA |
Ga0310686_1098789073 | 3300031708 | Soil | MRVPDRRVVDLRDRGYLIFEGFLEADELAAAQDALWLHYPRPEEYF |
Ga0310686_1140688931 | 3300031708 | Soil | VSELRERGFLVCEGFLGTKELEAAQEALWLRYPGPEEYFSDPTTHASL |
Ga0265342_107139811 | 3300031712 | Rhizosphere | MRPGQLASMRMPDRCVAELRERGYLVFEGFLGTDELAAAQEALWLHYPRPEE |
Ga0318496_105687041 | 3300031713 | Soil | VPDGCLADLREQGYLLFEGFLGADELAAAQEALWLHYPRPEAYF |
Ga0302321_1001066501 | 3300031726 | Fen | MRVPDRCLADLRQQGYLVFEGFLEADELAAAQEALWFHYPRPGEYFADP |
Ga0318492_107612351 | 3300031748 | Soil | VPEGCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEV |
Ga0318554_100553161 | 3300031765 | Soil | MRVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEAY |
Ga0318498_104968081 | 3300031778 | Soil | VPDRCLADLRERGYLLFEGFLGADELAAAQEALWLHYPR |
Ga0318548_103664633 | 3300031793 | Soil | VPDGCLADLRERGYLLFEGFLEADELAAAQEALWLHYP |
Ga0318497_100295551 | 3300031805 | Soil | VPDGCLADLREQGYLLFEGFLGADELAAAQEALWLHYPR |
Ga0318497_101515451 | 3300031805 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEAY |
Ga0318495_102871361 | 3300031860 | Soil | VPDGCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEAYF |
Ga0306919_110903831 | 3300031879 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHY |
Ga0318536_106164072 | 3300031893 | Soil | MRVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPEVY |
Ga0318520_105069741 | 3300031897 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAGSAATGLP |
Ga0306921_111800233 | 3300031912 | Soil | MRVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPEVYFADPA |
Ga0306921_118011311 | 3300031912 | Soil | VPDGCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVY |
Ga0310910_108818232 | 3300031946 | Soil | VPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEA |
Ga0318531_100085837 | 3300031981 | Soil | MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLH |
Ga0306922_122226592 | 3300032001 | Soil | MRVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPEVYFAD |
Ga0307416_1005077801 | 3300032002 | Rhizosphere | MRVPDRCVRDLRERGFLVFEGFLEADELAAAQEALWLHYPRPEEYFADPA |
Ga0318504_105715661 | 3300032063 | Soil | VPDGCLADLREQGYLLFEGFLGADELAAAQEALWLHYPRPARQPRGN |
Ga0306924_102642991 | 3300032076 | Soil | MRVPDGCLADLRERGYLLFEGFLEADELAAAREAL |
Ga0306924_104585631 | 3300032076 | Soil | MRVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHYP |
Ga0311301_102039756 | 3300032160 | Peatlands Soil | MRVPDAALEEIRERGFTIVEGFLDADELRAAQDALWLHYPKPEEYFADPAGHARYA |
Ga0307472_1002810482 | 3300032205 | Hardwood Forest Soil | VPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPAAYAW |
Ga0335085_124086941 | 3300032770 | Soil | MRVPDGCLTDLREQGYLLFEGFLEAGELAAARDAL |
Ga0335078_121374611 | 3300032805 | Soil | MRVPDRCLADLREQGYLLFEGFLGADELAAAREALWL |
Ga0335075_109519222 | 3300032896 | Soil | MRVPDRCVVDLRDRGYLIFEGFLEADELAAAQDALWLHYPRPEEYFADPAAHAWL |
Ga0335073_100528721 | 3300033134 | Soil | VPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPE |
Ga0335073_115418951 | 3300033134 | Soil | MRVPDRCVADLRDRGYLIFEGFLEADELAAAQDALWLHYPRPEEYFADPAAHA |
Ga0335077_119832481 | 3300033158 | Soil | VPDRCLADLREQGYLLFEGFLGADELAAAQEALWLHY |
⦗Top⦘ |