NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F028596

Metagenome Family F028596

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028596
Family Type Metagenome
Number of Sequences 191
Average Sequence Length 45 residues
Representative Sequence VRERYRGMGVDVMDMSQAEFAAYVRADYEKWQRVAREGNIVVE
Number of Associated Samples 163
Number of Associated Scaffolds 191

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.76 %
% of genes near scaffold ends (potentially truncated) 91.62 %
% of genes from short scaffolds (< 2000 bps) 93.19 %
Associated GOLD sequencing projects 152
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.335 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.565 % of family members)
Environment Ontology (ENVO) Unclassified
(38.220 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.649 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.03%    β-sheet: 0.00%    Coil/Unstructured: 61.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 191 Family Scaffolds
PF04909Amidohydro_2 23.04
PF03401TctC 8.90
PF08309LVIVD 7.85
PF13379NMT1_2 7.33
PF09084NMT1 3.66
PF00903Glyoxalase 3.14
PF00892EamA 3.14
PF01872RibD_C 2.09
PF02239Cytochrom_D1 1.57
PF09826Beta_propel 1.05
PF00441Acyl-CoA_dh_1 1.05
PF03450CO_deh_flav_C 1.05
PF10543ORF6N 0.52
PF00501AMP-binding 0.52
PF00994MoCF_biosynth 0.52
PF13432TPR_16 0.52
PF00583Acetyltransf_1 0.52
PF01738DLH 0.52
PF01494FAD_binding_3 0.52
PF02668TauD 0.52
PF00355Rieske 0.52
PF00144Beta-lactamase 0.52
PF02784Orn_Arg_deC_N 0.52
PF02896PEP-utilizers_C 0.52
PF13469Sulfotransfer_3 0.52
PF00753Lactamase_B 0.52
PF01839FG-GAP 0.52
PF00462Glutaredoxin 0.52
PF13417GST_N_3 0.52
PF13531SBP_bac_11 0.52
PF03972MmgE_PrpD 0.52
PF01977UbiD 0.52
PF07399Na_H_antiport_3 0.52
PF104171-cysPrx_C 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 191 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 8.90
COG5276Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domainFunction unknown [S] 7.85
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.66
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.66
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 2.09
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 2.09
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.05
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.05
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 0.52
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.52
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.52
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.52
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.52
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 0.52
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.52
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.52
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.52
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.52
COG2367Beta-lactamase class ADefense mechanisms [V] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.34 %
UnclassifiedrootN/A3.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101131401All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales545Open in IMG/M
3300000955|JGI1027J12803_104693841All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales519Open in IMG/M
3300000955|JGI1027J12803_109455230All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300000956|JGI10216J12902_102392689All Organisms → cellular organisms → Bacteria → Proteobacteria987Open in IMG/M
3300000956|JGI10216J12902_104480060All Organisms → cellular organisms → Bacteria → Proteobacteria599Open in IMG/M
3300000956|JGI10216J12902_109843319All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria558Open in IMG/M
3300000956|JGI10216J12902_115188956All Organisms → cellular organisms → Bacteria → Proteobacteria629Open in IMG/M
3300002886|JGI25612J43240_1075738All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300002906|JGI25614J43888_10055956All Organisms → cellular organisms → Bacteria → Proteobacteria1168Open in IMG/M
3300003152|Ga0052254_1110961All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae523Open in IMG/M
3300003319|soilL2_10008915All Organisms → cellular organisms → Bacteria → Proteobacteria1945Open in IMG/M
3300003319|soilL2_10034129All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1305Open in IMG/M
3300004081|Ga0063454_101050112All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300004082|Ga0062384_101421603All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300004114|Ga0062593_101702685All Organisms → cellular organisms → Bacteria → Proteobacteria689Open in IMG/M
3300004157|Ga0062590_101595793All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300004463|Ga0063356_101977224All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium881Open in IMG/M
3300005093|Ga0062594_102953334All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae530Open in IMG/M
3300005169|Ga0066810_10076301All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales703Open in IMG/M
3300005176|Ga0066679_10170317All Organisms → cellular organisms → Bacteria → Proteobacteria1374Open in IMG/M
3300005181|Ga0066678_10461576All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus844Open in IMG/M
3300005332|Ga0066388_108747080All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005345|Ga0070692_11145662All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales551Open in IMG/M
3300005439|Ga0070711_101217169All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium652Open in IMG/M
3300005440|Ga0070705_100659640All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria817Open in IMG/M
3300005446|Ga0066686_10188628Not Available1377Open in IMG/M
3300005456|Ga0070678_101558164All Organisms → cellular organisms → Bacteria → Proteobacteria620Open in IMG/M
3300005468|Ga0070707_100374120All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1384Open in IMG/M
3300005526|Ga0073909_10268156All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax765Open in IMG/M
3300005526|Ga0073909_10666041All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300005543|Ga0070672_101995210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300005544|Ga0070686_101669375All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005545|Ga0070695_100330093All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus1137Open in IMG/M
3300005552|Ga0066701_10871202All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300005566|Ga0066693_10246312All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales707Open in IMG/M
3300005576|Ga0066708_10050151All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2332Open in IMG/M
3300005598|Ga0066706_11335999All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus basilensis541Open in IMG/M
3300005764|Ga0066903_100689420All Organisms → cellular organisms → Bacteria → Proteobacteria1797Open in IMG/M
3300005764|Ga0066903_101102225All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1464Open in IMG/M
3300005843|Ga0068860_102548951All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium531Open in IMG/M
3300005844|Ga0068862_101160280All Organisms → cellular organisms → Bacteria → Proteobacteria770Open in IMG/M
3300006050|Ga0075028_100698128All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
3300006173|Ga0070716_100924198All Organisms → cellular organisms → Bacteria → Proteobacteria685Open in IMG/M
3300006640|Ga0075527_10266334All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria503Open in IMG/M
3300006794|Ga0066658_10691410All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales563Open in IMG/M
3300006797|Ga0066659_11609024All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300006845|Ga0075421_100068969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4466Open in IMG/M
3300006847|Ga0075431_100127944All Organisms → cellular organisms → Bacteria → Proteobacteria2621Open in IMG/M
3300006847|Ga0075431_101204716All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria720Open in IMG/M
3300006853|Ga0075420_100191508All Organisms → cellular organisms → Bacteria → Proteobacteria1787Open in IMG/M
3300006871|Ga0075434_101343101All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium725Open in IMG/M
3300006880|Ga0075429_100190787All Organisms → cellular organisms → Bacteria → Proteobacteria1795Open in IMG/M
3300006954|Ga0079219_11412964All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria623Open in IMG/M
3300009012|Ga0066710_101408804All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1080Open in IMG/M
3300009088|Ga0099830_10746955All Organisms → cellular organisms → Bacteria → Proteobacteria806Open in IMG/M
3300009147|Ga0114129_10946522All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae1088Open in IMG/M
3300009156|Ga0111538_14012018All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300009162|Ga0075423_12008322All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300009167|Ga0113563_12713694All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae599Open in IMG/M
3300009177|Ga0105248_10721923All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1124Open in IMG/M
3300009660|Ga0105854_1391591All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium504Open in IMG/M
3300009805|Ga0105079_1040743All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300010045|Ga0126311_11733013All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae528Open in IMG/M
3300010047|Ga0126382_11199133Not Available680Open in IMG/M
3300010337|Ga0134062_10333998All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae726Open in IMG/M
3300010373|Ga0134128_12494083All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300010400|Ga0134122_11229739All Organisms → cellular organisms → Bacteria → Proteobacteria752Open in IMG/M
3300010401|Ga0134121_11573311All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae676Open in IMG/M
3300010401|Ga0134121_13159539All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae509Open in IMG/M
3300011398|Ga0137348_1041146All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae771Open in IMG/M
3300011405|Ga0137340_1013168All Organisms → cellular organisms → Bacteria → Proteobacteria1496Open in IMG/M
3300011405|Ga0137340_1095677All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300011421|Ga0137462_1004389All Organisms → cellular organisms → Bacteria → Proteobacteria2415Open in IMG/M
3300011436|Ga0137458_1248861All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae541Open in IMG/M
3300011438|Ga0137451_1039934All Organisms → cellular organisms → Bacteria → Proteobacteria1369Open in IMG/M
3300011442|Ga0137437_1198810All Organisms → cellular organisms → Bacteria → Proteobacteria696Open in IMG/M
3300011442|Ga0137437_1344401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium504Open in IMG/M
3300011443|Ga0137457_1316738All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium532Open in IMG/M
3300011444|Ga0137463_1157395All Organisms → cellular organisms → Bacteria → Proteobacteria855Open in IMG/M
3300012041|Ga0137430_1057506Not Available1061Open in IMG/M
3300012041|Ga0137430_1164727All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae640Open in IMG/M
3300012129|Ga0137345_1024241All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012140|Ga0137351_1053404Not Available574Open in IMG/M
3300012143|Ga0137354_1070975All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae554Open in IMG/M
3300012161|Ga0137336_1011847All Organisms → cellular organisms → Bacteria → Proteobacteria1515Open in IMG/M
3300012168|Ga0137357_1088624All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae637Open in IMG/M
3300012173|Ga0137327_1015868All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1517Open in IMG/M
3300012202|Ga0137363_10992456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium713Open in IMG/M
3300012207|Ga0137381_11090290All Organisms → cellular organisms → Bacteria → Proteobacteria687Open in IMG/M
3300012212|Ga0150985_122716063All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2372Open in IMG/M
3300012231|Ga0137465_1064553All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae1088Open in IMG/M
3300012285|Ga0137370_10732649All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium614Open in IMG/M
3300012361|Ga0137360_11445248All Organisms → cellular organisms → Bacteria → Proteobacteria591Open in IMG/M
3300012510|Ga0157316_1073924All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium520Open in IMG/M
3300012519|Ga0157352_1095483All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium520Open in IMG/M
3300012897|Ga0157285_10217459All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300012917|Ga0137395_10101431All Organisms → cellular organisms → Bacteria1912Open in IMG/M
3300012925|Ga0137419_11219873All Organisms → cellular organisms → Bacteria → Proteobacteria630Open in IMG/M
3300012925|Ga0137419_11440254All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium582Open in IMG/M
3300012925|Ga0137419_11462106All Organisms → cellular organisms → Bacteria → Proteobacteria578Open in IMG/M
3300012929|Ga0137404_10956067All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales783Open in IMG/M
3300012930|Ga0137407_10233065All Organisms → cellular organisms → Bacteria → Proteobacteria1663Open in IMG/M
3300012930|Ga0137407_11560361All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae628Open in IMG/M
3300012944|Ga0137410_10178044All Organisms → cellular organisms → Bacteria → Proteobacteria1636Open in IMG/M
3300012957|Ga0164303_10510593All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium772Open in IMG/M
3300012964|Ga0153916_10133545All Organisms → cellular organisms → Bacteria → Proteobacteria2400Open in IMG/M
3300012964|Ga0153916_11116308All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae868Open in IMG/M
3300012971|Ga0126369_12902966All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300012984|Ga0164309_10466643All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium958Open in IMG/M
3300014166|Ga0134079_10369751All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae658Open in IMG/M
3300014745|Ga0157377_11101369All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300014745|Ga0157377_11226185All Organisms → cellular organisms → Bacteria → Proteobacteria582Open in IMG/M
3300014862|Ga0180096_1008949All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae762Open in IMG/M
3300014878|Ga0180065_1116483All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae613Open in IMG/M
3300014880|Ga0180082_1069352All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium768Open in IMG/M
3300015052|Ga0137411_1322839All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1364Open in IMG/M
3300015052|Ga0137411_1375505All Organisms → cellular organisms → Bacteria5177Open in IMG/M
3300015053|Ga0137405_1144244All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1871Open in IMG/M
3300015054|Ga0137420_1204766All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1405Open in IMG/M
3300015201|Ga0173478_10337378All Organisms → cellular organisms → Bacteria → Proteobacteria698Open in IMG/M
3300015245|Ga0137409_10324050All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1349Open in IMG/M
3300017654|Ga0134069_1018669All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2065Open in IMG/M
3300017965|Ga0190266_10054526All Organisms → cellular organisms → Bacteria → Proteobacteria1434Open in IMG/M
3300017965|Ga0190266_11303142All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300018083|Ga0184628_10324136Not Available809Open in IMG/M
3300018083|Ga0184628_10579185All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae570Open in IMG/M
3300018431|Ga0066655_10999197All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae578Open in IMG/M
3300018469|Ga0190270_10925976All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae891Open in IMG/M
3300018469|Ga0190270_11429203All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria739Open in IMG/M
3300018481|Ga0190271_11508640All Organisms → cellular organisms → Bacteria → Proteobacteria789Open in IMG/M
3300018481|Ga0190271_13618913All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria517Open in IMG/M
3300020022|Ga0193733_1040314All Organisms → cellular organisms → Bacteria → Proteobacteria1318Open in IMG/M
3300020215|Ga0196963_10040977All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1940Open in IMG/M
3300021063|Ga0206227_1089277All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium599Open in IMG/M
3300021081|Ga0210379_10444787All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae574Open in IMG/M
3300021602|Ga0194060_10430449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae629Open in IMG/M
3300021602|Ga0194060_10506148All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300024177|Ga0247686_1014358All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium864Open in IMG/M
3300024325|Ga0247678_1066999All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium591Open in IMG/M
3300025888|Ga0209540_10221387All Organisms → cellular organisms → Bacteria → Proteobacteria1111Open in IMG/M
3300025905|Ga0207685_10782970All Organisms → cellular organisms → Bacteria → Proteobacteria524Open in IMG/M
3300025907|Ga0207645_10095054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1919Open in IMG/M
3300025910|Ga0207684_11698458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium509Open in IMG/M
3300025916|Ga0207663_11018439All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium664Open in IMG/M
3300025916|Ga0207663_11211523All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium608Open in IMG/M
3300025917|Ga0207660_10791188All Organisms → cellular organisms → Bacteria → Proteobacteria774Open in IMG/M
3300025933|Ga0207706_11284224All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300025934|Ga0207686_10458315All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium982Open in IMG/M
3300025935|Ga0207709_11657770All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae531Open in IMG/M
3300025945|Ga0207679_11786760All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300025962|Ga0210070_1018206All Organisms → cellular organisms → Bacteria → Proteobacteria807Open in IMG/M
3300026048|Ga0208915_1002244All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae1375Open in IMG/M
3300026118|Ga0207675_102158233All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium573Open in IMG/M
3300026313|Ga0209761_1143821All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1132Open in IMG/M
3300026325|Ga0209152_10344302All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales568Open in IMG/M
3300026326|Ga0209801_1185151All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales851Open in IMG/M
3300026326|Ga0209801_1298055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300026328|Ga0209802_1284793All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales550Open in IMG/M
3300026333|Ga0209158_1296543All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300026342|Ga0209057_1114065All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1037Open in IMG/M
3300026524|Ga0209690_1264112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300026548|Ga0209161_10000484All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria32308Open in IMG/M
3300026551|Ga0209648_10118287All Organisms → cellular organisms → Bacteria → Proteobacteria2143Open in IMG/M
3300027011|Ga0207740_1038517All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium565Open in IMG/M
3300027330|Ga0207777_1096760All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium509Open in IMG/M
3300027573|Ga0208454_1030004All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae1275Open in IMG/M
3300027682|Ga0209971_1031797All Organisms → cellular organisms → Bacteria → Proteobacteria1266Open in IMG/M
3300027821|Ga0209811_10298633All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium620Open in IMG/M
3300027882|Ga0209590_10155764All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1420Open in IMG/M
3300027907|Ga0207428_10872037Not Available637Open in IMG/M
3300028589|Ga0247818_10556696All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium786Open in IMG/M
3300028804|Ga0268298_10198720All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae1094Open in IMG/M
3300028812|Ga0247825_11276370Not Available537Open in IMG/M
3300031198|Ga0307500_10133547All Organisms → cellular organisms → Bacteria → Proteobacteria695Open in IMG/M
3300031366|Ga0307506_10403456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae560Open in IMG/M
3300031562|Ga0310886_10804799All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium592Open in IMG/M
3300031720|Ga0307469_12297255All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae526Open in IMG/M
3300031912|Ga0306921_10422270All Organisms → cellular organisms → Bacteria → Proteobacteria1556Open in IMG/M
3300032002|Ga0307416_103465521All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae528Open in IMG/M
3300032157|Ga0315912_10062656All Organisms → cellular organisms → Bacteria → Proteobacteria2930Open in IMG/M
3300032180|Ga0307471_103658204All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300032180|Ga0307471_104338817All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300032205|Ga0307472_101539864All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYMMa02A651Open in IMG/M
3300032205|Ga0307472_102526158All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300032770|Ga0335085_10451526All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1479Open in IMG/M
3300032892|Ga0335081_10198159All Organisms → cellular organisms → Bacteria2784Open in IMG/M
3300033480|Ga0316620_10063889All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2601Open in IMG/M
3300034149|Ga0364929_0050938All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1256Open in IMG/M
3300034149|Ga0364929_0193378All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae671Open in IMG/M
3300034151|Ga0364935_0232189All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae599Open in IMG/M
3300034354|Ga0364943_0177162All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae777Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.57%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil12.04%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.14%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.09%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.09%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.57%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.57%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.05%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.05%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.05%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.05%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.05%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.05%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.52%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.52%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.52%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.52%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.52%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.52%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.52%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.52%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.52%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.52%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.52%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300003152Freshwater sediment microbial communities from Loktak Lake, IndiaEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009805Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012140Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT690_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012161Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2EnvironmentalOpen in IMG/M
3300012168Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014862Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1DaEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300024177Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025962Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026048Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027011Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028804Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP WeurtEngineeredOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10113140113300000364SoilKSMGVDIMEMSQPEFASYVRADFDKWRKVAKEGNIAVE*
JGI1027J12803_10469384123300000955SoilMGVDIMEMSQPEFASYVRADFDKWRKVAKEGNIAVE*
JGI1027J12803_10945523023300000955SoilSGSLRKAMSGEAVRERYRSMGVDVMDMGQADFATFVRADYEKWRRVAREGNIVVE*
JGI10216J12902_10239268923300000956SoilVEVMDMNQSDFAAYVRADYEKWRKVAREGNIVVE*
JGI10216J12902_10448006023300000956SoilSLRKALTNAAVRERFGGMGVEIMDMPQAEFAAYVRTDYDKWQKVAREGNIVIE*
JGI10216J12902_10984331913300000956SoilFGGMGVEIMDMGQAEFAAYVRADYDKWLKVAREGNIVVE*
JGI10216J12902_11518895623300000956SoilERYRQMGVELIEMSQPEFAAYVREDLAKWQRVAREGNIVVE*
JGI25612J43240_107573823300002886Grasslands SoilVPAAAADRLTAALRRALSNQTVRERYRSMGVDVMDMSRAEFTAYVRADFEKWRTIAREGNIVVE*
JGI25614J43888_1005595623300002906Grasslands SoilLRRALSNETVRERYRSMGVDVMDMSRAEFIAYVRADFEKWRTIAREGNIVVE*
Ga0052254_111096133300003152SedimentLHKAMSRDDVRERYRTMGVDVMDMTQPQFAAYVRADYQKWQKVARDGNISVE*
soilL2_1000891523300003319Sugarcane Root And Bulk SoilVRERYRGMGVEIIEASQADFDVYVRADFEKWRRVAREGNIVVE*
soilL2_1003412913300003319Sugarcane Root And Bulk SoilSVRERYQAMGVEVMDMGQPEFAAYVRADYQKRQKVAREGNISVE*
Ga0063454_10105011213300004081SoilNQTVRTRFHTMGVEVMDMSRAEFAAYVRADYEKWLKLAREANIVIE*
Ga0062384_10142160323300004082Bog Forest SoilEIVRDRFRSMGVDLMDMSQPEFAAYVRADFEKWRQIAREGNISIE*
Ga0062593_10170268533300004114SoilVRERYRSMGVEVMDMGQADFAAFVRADYEKWQRVAREGNIVVE*
Ga0062590_10159579313300004157SoilEKARADEKLRSRYRTLGVEMMDMSRAQFAAYVRDDYEKWVKVAREANISLE*
Ga0063356_10197722413300004463Arabidopsis Thaliana RhizosphereNQLNGALRKALATQAVRERYRQMGVDIMDMSQPQFDAYVRADYRKWQKVARDGHISVD*
Ga0062594_10295333423300005093SoilVRERYRSMGVEIMDLSQAEFSAYVKTDFEKWRQIARERNIVVE*
Ga0066810_1007630123300005169SoilALQVESVRERYRQMGVDLIEMSQPEFAAFVRDDYEKWRRVAREGNIVVE*
Ga0066679_1017031733300005176SoilANPTVRGRFRTMGVEVMDMSRAEFAAYVRADYDKWLKLAREANIVLE*
Ga0066678_1046157623300005181SoilVRERYRGMGVDVMDMSQAEFAAYVRADYEKWQRVAREGNIVVE*
Ga0066388_10874708013300005332Tropical Forest SoilARTNEAVRERYRSMGVELMDLSTADFNAFVRADFEKWRQVARDGNIVVE*
Ga0070692_1114566213300005345Corn, Switchgrass And Miscanthus RhizosphereYRSMGVEVMDMNQSDFGSYVRADYEKWRRVAREGNIVVE*
Ga0070711_10121716923300005439Corn, Switchgrass And Miscanthus RhizosphereERYKSMGVDIMDMSQPDFAAYVRADYDKWRKVAKEGNISVE*
Ga0070705_10065964013300005440Corn, Switchgrass And Miscanthus RhizosphereVRERYRGMGVDVMDMGQADFAAFVRADYEKWRRVAREGNIVVE*
Ga0066686_1018862813300005446SoilRKALANESIRESYRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREGNIVVE*
Ga0070678_10155816423300005456Miscanthus RhizosphereHPTVRERFGGMGVEIMDMGQAEFAAYVRADYDKWQKVAREGNIVVE*
Ga0070707_10037412013300005468Corn, Switchgrass And Miscanthus RhizosphereKKALAVDAVRERYRSMGVEVMDMGQPEFAAYVKTDYEKWRKVAREANIVVE*
Ga0073909_1026815613300005526Surface SoilVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE*
Ga0073909_1066604113300005526Surface SoilALRRALSGETVRERYRSMGAELMDMSRAEFAAYVRADFEKWRTIAREGNIVVE*
Ga0070672_10199521013300005543Miscanthus RhizosphereALTHPTVRERFGGMGVEIMDLGQAEFAAYVRADYDKWRRVAREGNIVVE*
Ga0070686_10166937523300005544Switchgrass RhizosphereKALASDSVRARYRAIGVEVMEMSRAEFSDYVRADVEKWRKVAREANIVVE*
Ga0070695_10033009323300005545Corn, Switchgrass And Miscanthus RhizosphereAAALHKAMSRDDVRGRYRAMGVDVMDMAQGEFSKYVRADYDKWLKVAREGNISVE*
Ga0066701_1087120223300005552SoilPTVRGRFRTMGVEVMDMSRAEFAAYVRADYDKWLKLAREANIVLE*
Ga0066693_1024631213300005566SoilMGVELMDMSQAQFAAYVRADYQKWQKVAREGNISVE*
Ga0066708_1005015113300005576SoilIDKLSAALRKALAVESVRERYRGMGVDVMDMGQAEFAAYVRADYEKWQRVAREGNIVVE*
Ga0066706_1133599913300005598SoilALRKALAVESVRERYRGMGVDVMDMGQAEFVAYVRADYEKWQRVAREGNIVIE*
Ga0066903_10068942013300005764Tropical Forest SoilAVADKLTGALHRALSNETVRERYRSMGVDILDMSRAEFSAYVRADYEKWRTIAREGRIEVE*
Ga0066903_10110222513300005764Tropical Forest SoilMGVELMDLSTADFNAYVRADFEKWRQVARDGNIVIE*
Ga0068860_10254895123300005843Switchgrass RhizosphereERYRGMGVEIMDSSQAEFAAFVRADLDKWRRVAREGNIVVE*
Ga0068862_10116028013300005844Switchgrass RhizosphereGVEVLDMGQADFATFVRADYEKWRRVAREGNIVVE*
Ga0075028_10069812823300006050WatershedsDETVRKHYLSMGVEIMDMSRAEFSAYVRADYEKWRTIAREGNIVVE*
Ga0070716_10092419813300006173Corn, Switchgrass And Miscanthus RhizosphereHRALSNETVRERYRSMGVEIMDMDQAEFAAYVRADLEKWRRVAREGNIVVE*
Ga0075527_1026633413300006640Arctic Peat SoilYHSMGVEIMDMTQAEFAAYVHTDFEKWRQVARDANIVVE*
Ga0066658_1069141023300006794SoilMAIDTVRERFRTMGVEVIDMSREQFAAYVRADYEKWRTVAREANIVIE*
Ga0066659_1160902423300006797SoilRERYRAMGVDVMDMSQAQFAALVREDYAKWLKVARDGNIVID*
Ga0075421_10006896973300006845Populus RhizosphereSLRKAMSGEAVRERYRSMGVEVMDMSQAEFAAYVRSDYEKWRRVAREGNIVVE*
Ga0075431_10012794413300006847Populus RhizosphereVRERFGGMGVEIMDMGQAEFAAYVRADYDKWLKVAREGHIVVE*
Ga0075431_10120471613300006847Populus RhizosphereYRGMGVEIIDMTQAEFASYVRADFEKWRRVAREGNIVVE*
Ga0075420_10019150833300006853Populus RhizosphereTVRERFGGMGVEIMDMGQAEFAAYVRADYDKWLKVAREGHIVVE*
Ga0075434_10134310123300006871Populus RhizosphereKAMSLEPVRERYRGMGVQVMDMTQAEFAAYVRADYDKWLKVARDGNIVVE*
Ga0075429_10019078733300006880Populus RhizosphereMGVEIMDMGQAEFAAYVRADYDKWLKVAREGNIVVE*
Ga0079219_1141296423300006954Agricultural SoilAALRKAMTRDDVRERYRAMGVDVMEMGQPEFAAYVRTDYEKWRKVARDGNIVVE*
Ga0066710_10140880433300009012Grasslands SoilYRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREGNIVVE
Ga0099830_1074695513300009088Vadose Zone SoilYRSMGVDIMDMSRTEFAAYVRADYQKWRTIAREGNIVVE*
Ga0114129_1094652223300009147Populus RhizosphereVRERYRAMGVEVMDMGQAQFAAYVRADYQKWLKVAREGNIVVE*
Ga0111538_1401201813300009156Populus RhizosphereVRERYRSMGVEVMDMNQSDFAAYVRADYEKWRRVAREGNIVVE*
Ga0075423_1200832223300009162Populus RhizosphereALLNPTVRERFGGMGVEIMDMGQAEFAAYVRADYDKWQKVAREGNIVVE*
Ga0113563_1271369423300009167Freshwater WetlandsGVEVMDMSQPEFAAYVKTDFEKWKKIARERNIVVQ*
Ga0105248_1072192333300009177Switchgrass RhizosphereMGVEIIDSSQAEFAAFVRADLEKWRRVAREGNIVVD*
Ga0105854_139159123300009660Permafrost SoilVEIMDMTQAEFAAYVRTDFDKWRQVAREANIVVE*
Ga0105079_104074323300009805Groundwater SandMGVEVMDLSQPAFAAYVKTDYEKWRSVAREGNIVVE*
Ga0126311_1173301313300010045Serpentine SoilNPQVRERYQGMGVEVMDMSQPQFDAYVRADWDKWRKVARDGNIAVE*
Ga0126382_1119913323300010047Tropical Forest SoilLANDGVRERFRSMGVDVADMSQAEFAAYVRADFEKWRTVAREARIVVE*
Ga0134062_1033399823300010337Grasslands SoilERYRAMGVELMDMSQPEFAAYVRADFQKWQKVARDGNISVE*
Ga0134128_1249408313300010373Terrestrial SoilKALATESVRARYRAIGVEVMDMNRADFSDYVRADVEKWRKVAREANIVVE*
Ga0134122_1122973913300010400Terrestrial SoilVEIMDMGQAEFAAYVRADYDKWQRVAREGNIVVE*
Ga0134121_1157331123300010401Terrestrial SoilRYRGMGVEVMDMPQPEFAAYVRQDFEKWKKVARDSNIVVD*
Ga0134121_1315953913300010401Terrestrial SoilKALHAAMARDDVRERYRTMGVEVMDLSQSDFAAFVRTDYQKWQKVAREGNISVE*
Ga0137348_104114613300011398SoilLRKALANDGVRERFRSMGVDIAELSQAEFAAYVRADFEKWRTVAREAGIVVE*
Ga0137340_101316843300011405SoilVRERYRAAGSDVLDMTQMEFAAYVRADFEKWKRVAREGNIVIE*
Ga0137340_109567723300011405SoilVRERFRGMGVEIIDMSPAQFAAYVRADFEKWRRVAREGNITVE*
Ga0137462_100438933300011421SoilMSNESVRERYRAAGSDVLDMTQVEFAAYVRADFEKWKRVAREGNIVIE*
Ga0137458_124886123300011436SoilLAVESVRERYRAMGVEVMDMSQPEFAAYVKTDFEKWRQVARERNIVVE*
Ga0137451_103993433300011438SoilLSSALRKAMSNESVRERYRAAGSDVLDMTQVEFSAYVRADFEKWKRVAREGNIVIE*
Ga0137437_119881013300011442SoilLKKALANDTVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE*
Ga0137437_134440123300011442SoilMDIMDMGQAEFTAHVRADYEKWRRVAREGNVLLE*
Ga0137457_131673823300011443SoilERYKSMGVDVMDMSQPEFAAYVRTDFDKWRKVAKEGNIAVE*
Ga0137463_115739523300011444SoilYRSMGVEVMDLSRADFAAYVRVDYEKWKRIAREGNIVVE*
Ga0137430_105750613300012041SoilSVREKYRGMGVEVMDMSQPDFAAYVKTDFEKWRKVARDANIVVE*
Ga0137430_116472723300012041SoilLSSSLRKALLNDAVRERYRQMGVELIETSQAEFAAYVRDDFDKWRRVAREGNIVVE*
Ga0137345_102424123300012129SoilLANETVRERYRGMGVEIIDASQAEFAAYVRTDFEKWRRVAREGNITVE*
Ga0137351_105340423300012140SoilFRGMGVEIIDMGQAEFAAYVRADYEKWLKVAREGNIVVE*
Ga0137354_107097523300012143SoilQVDAVREKYRSMGVEIMDLSQAGFAAYVKTDYEKWRLVAREANIVVE*
Ga0137336_101184713300012161SoilDKLYVALRRALSSETVRERYRSMGVDVMDMNRVEFAAYVRADFEKWRAIAREGNIVVD*
Ga0137357_108862423300012168SoilVRERYRSMGVEVMDMSQPEFAAYVKTDFEKWRKVAREANIVVE*
Ga0137327_101586823300012173SoilMGVEIIELAQPEFAAYVRADYEKWLKVAREGNIVVE*
Ga0137363_1099245623300012202Vadose Zone SoilVEVMDMTRAEFAAYVRADFEKWLKLAREGNIVIE*
Ga0137381_1109029023300012207Vadose Zone SoilRYRSMGVDVMDMGRAEFAAYVRADFEKWRIIAREGNIVVE*
Ga0150985_12271606313300012212Avena Fatua RhizosphereALANDTVRERYRGMAVEIVDSSEAEFAAFVRADLEKWRRVAREGNIVVE*
Ga0137465_106455313300012231SoilRYRAMGVEIMDMGQAEFAAYVRADFEKWKRVAREGNIVIE*
Ga0137370_1073264923300012285Vadose Zone SoilSAALRKALAVESVRARYRGMGVDVMDMGRAEFVAYVRADYEKWLKVAREGNIVVE*
Ga0137360_1144524823300012361Vadose Zone SoilGALRRALSDETVRERYRSMGVELMDMSRAEFAAYVRADYEKWRTIARESNIVVE*
Ga0157316_107392413300012510Arabidopsis RhizosphereMGVEIIDSSQVEFDAFVRADYEKWRRVAREGNIVVE*
Ga0157352_109548323300012519Unplanted SoilSSSLKRALANETVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE*
Ga0157285_1021745913300012897SoilRQMGVELIEMSQPEFAAYVRDDFDKWRRVAREGNIVVE*
Ga0137395_1010143113300012917Vadose Zone SoilTVRERYRSMGVDVMDLSRAEFAAYVRADFEKWRTIAREGNIVVE*
Ga0137419_1121987313300012925Vadose Zone SoilETVRERYRSMGVDIMDMSRAEFAAYVRADFEKWRTIAREGNIVVE*
Ga0137419_1144025423300012925Vadose Zone SoilRVGGDVIDMGQAEFASYVRADYEKLQRVAREGNIVVE*
Ga0137419_1146210613300012925Vadose Zone SoilSNQTVRERYRSMGVDVMDMSRAEFTAYVRADFEKWRSIARDGNIVVE*
Ga0137404_1095606733300012929Vadose Zone SoilESYRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREANIVVE*
Ga0137407_1023306513300012930Vadose Zone SoilTGALRRALSDETVRKHYLSMGVEIMDMSRAEFSAYVRADYEKWRTIAREGNIVVE*
Ga0137407_1156036113300012930Vadose Zone SoilKALGNEQVKERYRSMGVEIMDMGQPEFAAYVRTDLEKWRKVAREGNIVVE*
Ga0137410_1017804413300012944Vadose Zone SoilERYRSMGVDIMDMSRTEFSAYVRADYEKWRIIAREGDIVVE*
Ga0164303_1051059323300012957SoilASSLKKALANDTVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE*
Ga0153916_1013354543300012964Freshwater WetlandsVRERYRKMGVDVMDMSASDFAAYVREDYEKWRHIAREANIVIE*
Ga0153916_1111630823300012964Freshwater WetlandsRERYRKMGVDVMDMNASDFAAYVRADYEKWRGVARAENIVIE*
Ga0126369_1290296613300012971Tropical Forest SoilMGVDVMDMSRDEFTEYVRADYEKWRNIARDGNIVVE*
Ga0164309_1046664313300012984SoilRYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE*
Ga0134079_1036975123300014166Grasslands SoilPDVRERYRIMGVDVMDMSQPEFAAFVRTDFQKWQKVARDGNISVE*
Ga0157377_1110136913300014745Miscanthus RhizosphereGAALRKAMAGEAVRERYRSMGVEVMDMNQSDFGSYVRADYEKWRRVAREGNIVVE*
Ga0157377_1122618513300014745Miscanthus RhizosphereAALRKGLTNATVRERFGGMGVEIMDMGQAEFAAYVRADYDKWQRVAREGNIVVE*
Ga0180096_100894923300014862SoilAALKNAMSNEGVRERYRAMGVEIMDMGQAEFAAYVRADLEKWKRVAREGNIVIE*
Ga0180065_111648313300014878SoilERYRAAGSDVLDMTQMEFAAYVRADFEKWKRVAREGNIVIE*
Ga0180082_106935223300014880SoilALATDAVRERYKSMGVDVMDMSQPEFAAYVRTDFDKWRKVAKEGNIAVE*
Ga0137411_132283933300015052Vadose Zone SoilVRERYRSMGVDIMDMSRTEFSAYVRADYEKWRIIARQGDIVVE*
Ga0137411_137550583300015052Vadose Zone SoilMGVEVIDMSQPEFAAYVRTDFRKWQKVARDGNISVE*
Ga0137405_114424413300015053Vadose Zone SoilPWAWTSMDMSQPQFAAYVRADFQKWQKVARDGNISVE*
Ga0137420_120476613300015054Vadose Zone SoilVGGDVIDMGRAEFVAYVRADYEKWQRVAREGNIVVE*
Ga0173478_1033737813300015201SoilGEAVRERYRSMGVDVMDMAQADFAAFVRADYEKWRRVAREGNIVVE*
Ga0137409_1032405013300015245Vadose Zone SoilAADKLYVALRRALSNETVRERYRSMGVEVMDMNRAEFAAYVRADFEKWRTIAREGNIVVE
Ga0134069_101866953300017654Grasslands SoilVGGDEIDMGQAEFAAYVRADYEKWQRVAREGNIVVE
Ga0190266_1005452633300017965SoilAVESVREKYRAMGVEVMEMSQPEFTAYVKTDYEKWRKVARDGNIVVE
Ga0190266_1130314213300017965SoilLSASLRKAMSGEAVRERYRSMGVEVMDMGQGDFAAFVRADYEKWQRVAREGNIVVE
Ga0184628_1032413633300018083Groundwater SedimentGVDIMEMSQPEFASYVRLDYDKWRRVAKEGNIAVE
Ga0184628_1057918523300018083Groundwater SedimentAMAVEAVRERYRGMGVQVMDMTQAEFAAYVRADYDKWLKVARDGNIVVE
Ga0066655_1099919713300018431Grasslands SoilAALRKALAVESVRERYRGMGVDVMDMGRAEFAAYVRADYEKWQRVAREGNIVVE
Ga0190270_1092597613300018469SoilFGGMGVEIMDMPQPQFAAYVRTDYDKWQKVAREGNIVIE
Ga0190270_1142920313300018469SoilHGALRQALTHEAVRTRYRDMGVEIMDIGRTEFADYVRADYDKWLKVAREGNIVVD
Ga0190271_1150864013300018481SoilAVRERFRGMGVELMDMSQPEFTAFVRADFEKWKRVAREGNIVVE
Ga0190271_1361891333300018481SoilGVEVMDMAQPEFSAYVRADHEKWRRVAREGNIVVE
Ga0193733_104031413300020022SoilKLYAALRRALSNETVRERYRSMGVDIMDMSRAEFAAYVRADFEKWRTIAREGNIVVE
Ga0196963_1004097713300020215SoilALAAASVKERFQGMGVEIIEMGQAEFASYVRTDFDKWRKVAREGNIVVE
Ga0206227_108927723300021063Deep Subsurface SedimentAVREKYRGMGVEVMDMGQAEFAAFVKTDFEKWRQVAREANIVVE
Ga0210379_1044478713300021081Groundwater SedimentRAMGVEIMDMGQAEFAAYVRADFEKWKRVAREGNIVIE
Ga0194060_1043044913300021602Anoxic Zone FreshwaterESVRERYRGMGVEIMDMTQSDFAAYVRTDYEKWRSVARDANIVVE
Ga0194060_1050614823300021602Anoxic Zone FreshwaterSIRERYRSLGVEMMDMSGAEFAAFVRTDAERWRKVAREANIVVE
Ga0247686_101435813300024177SoilERYRGMGVEIMDSSQAEFAAFVRADLDKWRRVAREGNIVVE
Ga0247678_106699923300024325SoilRERYRSMGVEIIDSSQAEFAAFVRADYEKWRRVAREGNIVVE
Ga0209540_1022138713300025888Arctic Peat SoilVRARYHTMGVEIMDMTQAEFAAYVHTDFEKWRQVARDANIVVE
Ga0207685_1078297023300025905Corn, Switchgrass And Miscanthus RhizosphereEAVRERYRSMGVDIMDMSRTEFSVYVRADYEKWRIIARQGDIVVE
Ga0207645_1009505433300025907Miscanthus RhizosphereLEKLSVSLGEALTHPTVRERFGGMGVEIMDMGQSEFAAYVRADFDKWRKVAREGNIVVE
Ga0207684_1169845813300025910Corn, Switchgrass And Miscanthus RhizosphereGGDVIDMGQAEFAAYVRADYEKWQRVAREGSIVVE
Ga0207663_1101843923300025916Corn, Switchgrass And Miscanthus RhizosphereRERYKSMGVDIMDMSQPDFAAYVRADYDKWRKVAKEGNISVE
Ga0207663_1121152323300025916Corn, Switchgrass And Miscanthus RhizosphereERYRSMGVEIIDSSQAEFAAFVRADLEKWRRVAREGNIVVD
Ga0207660_1079118813300025917Corn RhizosphereAMSSEAVRERYRSMGVEVMDMTQPEFAAYVRADHDKWRRVAREGNIVVE
Ga0207706_1128422423300025933Corn RhizosphereMSSEAVRERYRSMGVEVMDMTQPEFAAYVRADHDKWRRVAREGNIVVE
Ga0207686_1045831523300025934Miscanthus RhizosphereTVRERFGGMGVEIMDMGQSEFAAYVRADFDKWRKVAREGNIVVE
Ga0207709_1165777023300025935Miscanthus RhizosphereADEGTRGRYLTLGVEMMDMSRAQFAAFVRADYEKWVKVAREANISLE
Ga0207679_1178676023300025945Corn RhizosphereYRQMGVDIMDMSQPQFDAYVRADYRKWQKVARDGHISVD
Ga0210070_101820613300025962Natural And Restored WetlandsANNTVRERFRSMGVEVMDMSQAEFSAYVLADLQKWRQIAREGNIVIE
Ga0208915_100224413300026048Natural And Restored WetlandsLAMGVQVMDMSQAEFAAYVRADYEKWLKVAREGNIVVE
Ga0207675_10215823323300026118Switchgrass RhizosphereEAVRERYRGMGVQVMEMTQAEFAAYVRADYDKWLKVARDGNIVVE
Ga0209761_114382113300026313Grasslands SoilLRKALANESIRESYRRVGGDVIDMGQAEFVAYVRADYEKWQRVAREGNIVVE
Ga0209152_1034430213300026325SoilRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREGNIVVE
Ga0209801_118515133300026326SoilALRKALAVESVRERYRGMGVDVMDMSQAEFAAYVRADYEKWQRVAREGNIVVE
Ga0209801_129805513300026326SoilRYRAMGVEVIDLGQQEFASYVRADYQKWLKVARESNIVIE
Ga0209802_128479333300026328SoilGSVRESYRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREGNIIVE
Ga0209158_129654323300026333SoilYRSMGVDILDMSRAEFTAYVRADFEKWRTIAREGNIVVE
Ga0209057_111406533300026342SoilLAVESVRERYRGMGVDVMDMSQAEFAAYVRADYEKWQRVAREGNIVVE
Ga0209690_126411223300026524SoilGVEVMDLGQAQFAAYVRADYEKWLKVAREGNIVIE
Ga0209161_1000048413300026548SoilLRKALAVESVRERYRGMGVDVMDMGQAEFAAYVRADYEKWQRVAREGNIVVE
Ga0209648_1011828733300026551Grasslands SoilMGVDIMDMSRAEFTAYVRADFEKWRTIAREGNIVVE
Ga0207740_103851713300027011Tropical Forest SoilGVELRDMTQQEFAAYVRADYGKWRTVARDGNITID
Ga0207777_109676023300027330Tropical Forest SoilQAVKKALADRLVRERYLAMGVELRDMTQQEFAAYVRADYGKWRTVARDGNITID
Ga0208454_103000433300027573SoilLQVESVRERYRQMGVELIEMSQPEFAAYVRDDLAKWQRVAREGNIVVE
Ga0209971_103179743300027682Arabidopsis Thaliana RhizosphereRLSASLRKAMSGEAVRERYRSMGVEVMDMAQAEFAAYVRADYEKWRRVAREGNIVVD
Ga0209811_1029863313300027821Surface SoilYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE
Ga0209590_1015576413300027882Vadose Zone SoilDRYRSMGVDVMDMSQAEFAAYVRADFEKWRSIAREGNIVVD
Ga0207428_1087203713300027907Populus RhizosphereGGMGVEIMDMGQAEFAAYVRADYDKWQKVAREGNIVVE
Ga0247818_1055669623300028589SoilRKGLTNATVRERFGGMGVEIMDMGQAEFAAYVRADYDKWLKVAREGNIVVE
Ga0268298_1019872023300028804Activated SludgeAVREKYAGMGVEVMDMAQPVFADYVRADYEKWRQVAKDAGIVVE
Ga0247825_1127637013300028812SoilGVEIMDMGQSEFAAYVHADFEKWRKVAREGGIVVE
Ga0307500_1013354713300031198SoilSVSLRKALVNPTVRERFGGMGVEIMDMGQAEFAAYVRADYDKWQRVAHEGNIVVE
Ga0307506_1040345623300031366SoilDVRSRYRAMGVDVMQMSQPQFAAYVRTDYQKWQKVARDGNISVE
Ga0310886_1080479923300031562SoilEAVREKYRSMGVEVMDMSQADFAAYVKTDFEKWRLVAKERNIVVE
Ga0307469_1229725523300031720Hardwood Forest SoilERDRAMGAEISDMGQAEFDAYVRADLDKWRRVAREANIVIE
Ga0306921_1042227013300031912SoilGVDIMDMGRAEFSAYVRADYEKWRTIAREGHIEVE
Ga0307416_10346552113300032002RhizosphereMDSVRERYRSMGVDILEMSQPDFAAYVRNDYEKWRKVAREGNIVVE
Ga0315912_1006265613300032157SoilRAMGVEIMDMGQAQFAAYVHTDFEKWQRVARQGNIVIE
Ga0307471_10365820423300032180Hardwood Forest SoilRYRSMGVEIMDMSRAEFAAYVRADFEKWRTIAREGNIVVE
Ga0307471_10433881713300032180Hardwood Forest SoilEPVRERYRSMGVEVMDMSQSDFAAYVRTDYEKWRRVARDGNIVVE
Ga0307472_10153986413300032205Hardwood Forest SoilERYRGMGVQVMDMTQAAFAAYVRTDYDKWLKVARDGNIVVE
Ga0307472_10252615823300032205Hardwood Forest SoilKLTGALRRALSEETVRERYRSMGVELMDMSRAEFAAYVRADYEKWRTIAREGNIVVE
Ga0335085_1045152613300032770SoilKALQDHTVRERYQAMGVELIETSQPEFAAYVRADYEKWKRVAREGNIVVD
Ga0335081_1019815913300032892SoilGVEEMDMNPSEFAAFVRADYEKWRAIARDGNIVVD
Ga0316620_1006388933300033480SoilMGVEVMDMNQAEFAAFVRADFEKWRRVARDANIVIE
Ga0364929_0050938_3_1403300034149SedimentDTVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE
Ga0364929_0193378_40_1863300034149SedimentMAIEAVRERYRGMGVQVMDMTQAEFAAYVRADYDKWLKVARDGNIVVE
Ga0364935_0232189_14_1453300034151SedimentVRERYRAAGSDVLDMTQMEFAAYVRADFEKWKRVAREGNIVIE
Ga0364943_0177162_628_7743300034354SedimentLQVESVRERYRQMGVELIEMSQPEFAAYVRDDLEKWRRVAREGNIVVE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.