NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028364

Metagenome / Metatranscriptome Family F028364

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028364
Family Type Metagenome / Metatranscriptome
Number of Sequences 192
Average Sequence Length 42 residues
Representative Sequence MATATITPDQNAVVAEIFIAAPPARVFQAISDPSQLPKWW
Number of Associated Samples 167
Number of Associated Scaffolds 192

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.84 %
% of genes near scaffold ends (potentially truncated) 94.79 %
% of genes from short scaffolds (< 2000 bps) 85.42 %
Associated GOLD sequencing projects 159
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.354 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.021 % of family members)
Environment Ontology (ENVO) Unclassified
(21.875 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.792 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.12%    β-sheet: 14.71%    Coil/Unstructured: 66.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 192 Family Scaffolds
PF08327AHSA1 66.67
PF10604Polyketide_cyc2 4.69
PF12840HTH_20 4.69
PF01174SNO 3.12
PF00903Glyoxalase 1.56
PF00919UPF0004 0.52
PF01680SOR_SNZ 0.52
PF13424TPR_12 0.52
PF04072LCM 0.52
PF13738Pyr_redox_3 0.52
PF01596Methyltransf_3 0.52
PF00115COX1 0.52
PF12681Glyoxalase_2 0.52
PF06764DUF1223 0.52
PF01022HTH_5 0.52
PF01850PIN 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 192 Family Scaffolds
COG0118Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisHAmino acid transport and metabolism [E] 3.12
COG0311Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase)Coenzyme transport and metabolism [H] 3.12
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 0.52
COG0621tRNA A37 methylthiotransferase MiaBTranslation, ribosomal structure and biogenesis [J] 0.52
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.52
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.52
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.52
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.52
COG5429Uncharacterized conserved protein, DUF1223 domainFunction unknown [S] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.35 %
UnclassifiedrootN/A3.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_94111All Organisms → cellular organisms → Bacteria → Acidobacteria989Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101243314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300001356|JGI12269J14319_10347152All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300005187|Ga0066675_10937677All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300005434|Ga0070709_10489125All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300005435|Ga0070714_100355948All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300005435|Ga0070714_100475217All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300005437|Ga0070710_10113408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1631Open in IMG/M
3300005526|Ga0073909_10015727All Organisms → cellular organisms → Bacteria2382Open in IMG/M
3300005530|Ga0070679_100158224All Organisms → cellular organisms → Bacteria2240Open in IMG/M
3300005532|Ga0070739_10055590All Organisms → cellular organisms → Bacteria2520Open in IMG/M
3300005534|Ga0070735_10144850All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300005568|Ga0066703_10173473All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300005591|Ga0070761_10052954All Organisms → cellular organisms → Bacteria2286Open in IMG/M
3300005591|Ga0070761_10707218All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005610|Ga0070763_10287953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti900Open in IMG/M
3300005616|Ga0068852_102578828All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300005829|Ga0074479_11151448All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005841|Ga0068863_101747765All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005844|Ga0068862_100246458All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300005873|Ga0075287_1031077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales694Open in IMG/M
3300005995|Ga0066790_10311528All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300006032|Ga0066696_10405746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium890Open in IMG/M
3300006052|Ga0075029_100163075All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300006052|Ga0075029_100699604All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300006059|Ga0075017_100167722All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300006059|Ga0075017_100356351All Organisms → cellular organisms → Bacteria → Acidobacteria1090Open in IMG/M
3300006086|Ga0075019_10677444All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300006102|Ga0075015_100086384All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300006102|Ga0075015_100281823All Organisms → cellular organisms → Bacteria → Acidobacteria909Open in IMG/M
3300006162|Ga0075030_101033858All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300006174|Ga0075014_100078690All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300006176|Ga0070765_101071871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium761Open in IMG/M
3300006237|Ga0097621_100171093All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300006854|Ga0075425_102313713All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300006893|Ga0073928_10209471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1520Open in IMG/M
3300009521|Ga0116222_1367611All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300009545|Ga0105237_10743835All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300009545|Ga0105237_11709028All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300010043|Ga0126380_10528799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales912Open in IMG/M
3300010046|Ga0126384_10407098All Organisms → cellular organisms → Bacteria → Acidobacteria1150Open in IMG/M
3300010048|Ga0126373_12655215All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010361|Ga0126378_11050234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales917Open in IMG/M
3300010361|Ga0126378_13035871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus535Open in IMG/M
3300010366|Ga0126379_11538121All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300010366|Ga0126379_13436185All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300010371|Ga0134125_12974768All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300010373|Ga0134128_11976629All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300010376|Ga0126381_103326180All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300010379|Ga0136449_102098021All Organisms → cellular organisms → Bacteria → Acidobacteria830Open in IMG/M
3300010877|Ga0126356_10776107All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300011411|Ga0153933_1036279All Organisms → cellular organisms → Bacteria → Proteobacteria1116Open in IMG/M
3300012202|Ga0137363_11446441All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300012205|Ga0137362_10673454All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300012208|Ga0137376_11359611All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300012359|Ga0137385_10869835All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300012918|Ga0137396_10477621All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300012948|Ga0126375_11174689All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300012957|Ga0164303_10640771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300012960|Ga0164301_10179737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1327Open in IMG/M
3300012960|Ga0164301_11632165All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300012961|Ga0164302_11470212All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300012971|Ga0126369_11598378All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300012971|Ga0126369_13236386All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300012977|Ga0134087_10819267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300012984|Ga0164309_10163375All Organisms → cellular organisms → Bacteria → Acidobacteria1495Open in IMG/M
3300013105|Ga0157369_10363826All Organisms → cellular organisms → Bacteria → Proteobacteria1502Open in IMG/M
3300013307|Ga0157372_10910414All Organisms → cellular organisms → Bacteria → Acidobacteria1020Open in IMG/M
3300013308|Ga0157375_13510824All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300014164|Ga0181532_10011799All Organisms → cellular organisms → Bacteria6749Open in IMG/M
3300014164|Ga0181532_10446486All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300016422|Ga0182039_10105125All Organisms → cellular organisms → Bacteria2095Open in IMG/M
3300017823|Ga0187818_10294217All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300017927|Ga0187824_10362822All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300017942|Ga0187808_10382565All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300017943|Ga0187819_10196776All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300017946|Ga0187879_10824256All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300017955|Ga0187817_10176771All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300017955|Ga0187817_10991916All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300017959|Ga0187779_10329582All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300017972|Ga0187781_10719491All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300017975|Ga0187782_11053912All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300017994|Ga0187822_10267151All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300018009|Ga0187884_10174288All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300018037|Ga0187883_10594276All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300018046|Ga0187851_10054692All Organisms → cellular organisms → Bacteria2592Open in IMG/M
3300018047|Ga0187859_10442006All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300018058|Ga0187766_10975069All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300018090|Ga0187770_11505971Not Available548Open in IMG/M
3300018431|Ga0066655_10548604Not Available772Open in IMG/M
3300018468|Ga0066662_12964678All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300020018|Ga0193721_1172717Not Available506Open in IMG/M
3300020069|Ga0197907_10185498All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300020078|Ga0206352_10065936All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300020581|Ga0210399_10529168All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300020581|Ga0210399_10712924All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300021170|Ga0210400_10704214All Organisms → cellular organisms → Bacteria → Acidobacteria830Open in IMG/M
3300021171|Ga0210405_11341483All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300021181|Ga0210388_11400036All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300021401|Ga0210393_11121950All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300021405|Ga0210387_11575164All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300021407|Ga0210383_11614227All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300021445|Ga0182009_10154049All Organisms → cellular organisms → Bacteria → Proteobacteria1093Open in IMG/M
3300021474|Ga0210390_10057393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3206Open in IMG/M
3300021477|Ga0210398_10835644All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300021479|Ga0210410_11660650All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300021560|Ga0126371_10098522All Organisms → cellular organisms → Bacteria → Proteobacteria2907Open in IMG/M
3300021560|Ga0126371_10786339All Organisms → cellular organisms → Bacteria → Acidobacteria1098Open in IMG/M
3300021560|Ga0126371_12188495All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300021860|Ga0213851_1080994All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300022724|Ga0242665_10033784All Organisms → cellular organisms → Bacteria → Acidobacteria1274Open in IMG/M
3300024182|Ga0247669_1067972All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300025446|Ga0208038_1047290All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300025464|Ga0208076_1060356All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300025906|Ga0207699_11456789All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300025914|Ga0207671_11374731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300025915|Ga0207693_11233042Not Available562Open in IMG/M
3300025927|Ga0207687_10028760All Organisms → cellular organisms → Bacteria → Acidobacteria3734Open in IMG/M
3300025928|Ga0207700_10823691All Organisms → cellular organisms → Bacteria → Acidobacteria830Open in IMG/M
3300025928|Ga0207700_11591750All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300025929|Ga0207664_10103973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2351Open in IMG/M
3300025961|Ga0207712_10368588All Organisms → cellular organisms → Bacteria → Acidobacteria1199Open in IMG/M
3300026023|Ga0207677_10716036All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales889Open in IMG/M
3300026316|Ga0209155_1161680All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300026335|Ga0209804_1048510All Organisms → cellular organisms → Bacteria2081Open in IMG/M
3300026530|Ga0209807_1230325All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300026538|Ga0209056_10304475All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1094Open in IMG/M
3300027024|Ga0207819_1047756All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300027117|Ga0209732_1075144All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300027583|Ga0209527_1013907All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300027737|Ga0209038_10012712All Organisms → cellular organisms → Bacteria → Proteobacteria2469Open in IMG/M
3300027821|Ga0209811_10021543All Organisms → cellular organisms → Bacteria → Acidobacteria2113Open in IMG/M
3300027821|Ga0209811_10309774All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300027826|Ga0209060_10543559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus526Open in IMG/M
3300027842|Ga0209580_10152102All Organisms → cellular organisms → Bacteria → Acidobacteria1139Open in IMG/M
3300027869|Ga0209579_10637328All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300027879|Ga0209169_10328729Not Available804Open in IMG/M
3300027898|Ga0209067_10457702All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300027986|Ga0209168_10096809All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300028536|Ga0137415_10070911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3346Open in IMG/M
3300028536|Ga0137415_10627621All Organisms → cellular organisms → Bacteria → Acidobacteria886Open in IMG/M
3300028776|Ga0302303_10312041All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300028795|Ga0302227_10420413All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300028906|Ga0308309_10924313All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300028906|Ga0308309_11020393All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300029907|Ga0311329_10091187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2539Open in IMG/M
3300029985|Ga0302280_1212791All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300030011|Ga0302270_10038661All Organisms → cellular organisms → Bacteria → Acidobacteria3461Open in IMG/M
3300030524|Ga0311357_11149451All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300031247|Ga0265340_10475768All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300031344|Ga0265316_10055006All Organisms → cellular organisms → Bacteria → Acidobacteria3115Open in IMG/M
3300031344|Ga0265316_10992483All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300031573|Ga0310915_10002126All Organisms → cellular organisms → Bacteria10451Open in IMG/M
3300031682|Ga0318560_10721655All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300031708|Ga0310686_104243970All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300031715|Ga0307476_10866863All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300031715|Ga0307476_11124045All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300031718|Ga0307474_10722348All Organisms → cellular organisms → Bacteria → Acidobacteria787Open in IMG/M
3300031719|Ga0306917_10115736All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300031754|Ga0307475_10003227All Organisms → cellular organisms → Bacteria → Acidobacteria9894Open in IMG/M
3300031771|Ga0318546_10007156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5687Open in IMG/M
3300031805|Ga0318497_10502883All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300031831|Ga0318564_10416274All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300031896|Ga0318551_10824448All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300031897|Ga0318520_10144062All Organisms → cellular organisms → Bacteria → Acidobacteria1376Open in IMG/M
3300031939|Ga0308174_10568869All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300031945|Ga0310913_11306581All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300031981|Ga0318531_10516835All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300032039|Ga0318559_10547870All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300032060|Ga0318505_10631121All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300032067|Ga0318524_10051559All Organisms → cellular organisms → Bacteria1961Open in IMG/M
3300032160|Ga0311301_10706301All Organisms → cellular organisms → Bacteria → Acidobacteria1416Open in IMG/M
3300032160|Ga0311301_12742076All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300032180|Ga0307471_100037520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3835Open in IMG/M
3300032180|Ga0307471_101834308All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300032205|Ga0307472_101363690All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300032770|Ga0335085_11529996All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300032783|Ga0335079_10042631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5209Open in IMG/M
3300032828|Ga0335080_10093939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3327Open in IMG/M
3300032892|Ga0335081_10365888All Organisms → cellular organisms → Bacteria1871Open in IMG/M
3300032892|Ga0335081_10586457All Organisms → cellular organisms → Bacteria → Acidobacteria1379Open in IMG/M
3300032892|Ga0335081_11600654All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300032893|Ga0335069_10172466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2660Open in IMG/M
3300032895|Ga0335074_10377013All Organisms → cellular organisms → Bacteria → Acidobacteria1556Open in IMG/M
3300032897|Ga0335071_10099788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2848Open in IMG/M
3300032955|Ga0335076_10334957All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300033004|Ga0335084_11885713All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300033158|Ga0335077_11202191All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300033818|Ga0334804_134634All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300033826|Ga0334847_042858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.02%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.25%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.21%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.60%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.60%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.60%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.56%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.56%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.56%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.04%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.04%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.04%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.04%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.04%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.04%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.52%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.52%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.52%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.52%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.52%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.52%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.52%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011411Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025464Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029985Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1EnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033826Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_016309602199352024SoilMVTTTVTPDQNAVIAEIFIAAPPARVFQAISDPAQLPRWWG
INPhiseqgaiiFebDRAFT_10124331413300000364SoilMATAVITPDQDTILAEIFVAAPPERVFQAISDPAQTSQ
JGI12269J14319_1034715213300001356Peatlands SoilMATVSITPDQDTVLAEIHIAAPPERVFQAITDPRQM
Ga0066675_1093767713300005187SoilMATAQLTPDNDTILAEVFIAAPPDRVFEAIADPKQRAQWW
Ga0070709_1048912513300005434Corn, Switchgrass And Miscanthus RhizosphereMAAAQVTPDHDAVHLEIFVAAPPARVFQAISDPAQSSQWWGQKGLYR
Ga0070714_10035594843300005435Agricultural SoilMATATITPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQSGLYHV
Ga0070714_10047521733300005435Agricultural SoilMAAAQVTPDHDAVHLEIFVAAPPARVFQAISDPAQSSQWWGQK
Ga0070710_1011340843300005437Corn, Switchgrass And Miscanthus RhizosphereMATATITPDQNAVIAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYRVTK
Ga0070699_10102041313300005518Corn, Switchgrass And Miscanthus RhizosphereMATNAVTPDQDAIALEVVIAAPADRVFQAITDPSQLLRWWGQQG
Ga0073909_1001572753300005526Surface SoilMATATITPDQNAVIAEVFIAAPPARVFQAISDPTQL
Ga0070679_10015822413300005530Corn RhizosphereMAIATVTPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQSGLYHVVKSTM
Ga0070739_1005559053300005532Surface SoilMATAVVTPDQDAVIAEIFIAAPPSRVFQAISDPNQIPRWWGQEGLY
Ga0070735_1014485013300005534Surface SoilMATATLTPDNDAILGEIFIAAPPARVFEAITDLKQ
Ga0066703_1017347333300005568SoilMATATITPDQNAVIAEIFIAAPPTRVFQAISDPAQLPKWWGQSGCITS*
Ga0070761_1005295413300005591SoilMATATITPDQNAVIVEIVIAAPPARVFQAISDPTQLPKWWGQSD
Ga0070761_1070721823300005591SoilMATVSITPDQDTVLAEIHIAAPPERVFQAITDPRQMPQ
Ga0070763_1028795333300005610SoilMATATITPDQNAVVAEIFIAAPPARVFQAISDPSQLPKWWGQDGLYH
Ga0068852_10257882823300005616Corn RhizosphereMATAQITPDQDAILAEIFIAAPPVRVFEAIADVNQR
Ga0074479_1115144813300005829Sediment (Intertidal)MATATITPDQDAIHAEIFVAAPPERVFEAITDPTQVPLWWGQTGMY
Ga0068863_10174776533300005841Switchgrass RhizosphereMATSAVTPDNDAVVAEVFIAAPPERVFQAITDPNQMPLWWGQQ
Ga0068862_10024645813300005844Switchgrass RhizosphereMATAAVTPDNDAVLAEVFIAAPPERVFQAITDPKQMPLWWG
Ga0075287_103107713300005873Rice Paddy SoilMATATITPDQNAIVAEIFIAAPPARVFQAISDPAQLPRW
Ga0066790_1031152833300005995SoilMATATITPDQNTVIAEVFIAAPPARVFQAISDPQQMPQ
Ga0066696_1040574613300006032SoilMATTQITPDNNSILAEIFIAAPPDRVFQALTDPQQM
Ga0075029_10016307513300006052WatershedsLATATLTPDQNAVIAEIFIAAPPARVFQAISDPTQLPKWWGQDGLY
Ga0075029_10069960423300006052WatershedsMATSAVTPDNDALVVEVFIAAPPERVFQAITDPNQMPLWWGQQG
Ga0075017_10016772213300006059WatershedsMATATVTPDQDVVRAEIFVAASPERVFEALTDPSQ
Ga0075017_10035635113300006059WatershedsMATATLTPDQNAVITEIFIAAPPARVFQAISDPQQMPQWWGQTG
Ga0075019_1067744413300006086WatershedsMATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLPKWWGQS
Ga0075015_10008638413300006102WatershedsMATAAITPDQNAVIAEVFIAAPPARVFQAISDPAQLPRW
Ga0075015_10028182333300006102WatershedsMATATLTPDQNAVITEIFIAAPPARVFQAISDPQQMPQWWGQTGLY
Ga0075030_10103385813300006162WatershedsMATATITPDQNAVIAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYRVT
Ga0075014_10007869013300006174WatershedsMATATITPDQNTVIAEIFIAAPPARVFQAISDPTQLPRWWGQD
Ga0070765_10107187133300006176SoilMATATLTPDLDTIIAEVFIAAPPTRVFQAISDPAQLPRWWGEDGQYH
Ga0097621_10017109313300006237Miscanthus RhizosphereMATAIVTPDNDAVLAEVFISAPPERVFQAITDPKQMPLWWGQQG
Ga0075425_10231371313300006854Populus RhizosphereMATAAITPDQDVVTAEIFIAAPPERVFQAITDPNQTLKWW
Ga0073928_1020947143300006893Iron-Sulfur Acid SpringMATATITPDQNTVIAEVFIAAPPARVFQAISDPQQMPQWWGQSGVY
Ga0116222_136761123300009521Peatlands SoilVGDFKDQETTMATATITPDKNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLY
Ga0105237_1074383533300009545Corn RhizosphereMATATITPDQNAVIAEVFIAAPPARVFQAISDPAQLPKWWGQSG
Ga0105237_1170902823300009545Corn RhizosphereMATAQITPNNDAILAEIFIAAPPARVFEAITDPQQRMQW
Ga0126380_1052879913300010043Tropical Forest SoilMATSVLTPDQNAVVAEIFIAAPPARVFQAITDPRQVPSWW
Ga0126384_1040709813300010046Tropical Forest SoilMGRNLEFEGDRMATVAVTPDQNTITAEIFIAAPPARVFEAITDPRQMTKWWGQEGLYRV
Ga0126373_1265521523300010048Tropical Forest SoilMAAASITPDHDTILAEVFIAAPPARVFEAITDPKQR
Ga0126378_1105023433300010361Tropical Forest SoilMATATITPDQNTVIAEIFIAAPPGRVFQAISDPSQLPRWWG
Ga0126378_1303587123300010361Tropical Forest SoilMATSVLTPDQNAVVAEIFIAAPPARVFQAISDPAQLP
Ga0126379_1153812133300010366Tropical Forest SoilMATALITPDNDVVVAEILIQAPPARVFEAIADPKQ
Ga0126379_1343618523300010366Tropical Forest SoilMATAQITPDQDAILAEIFIAAPPARVFEAIADVNQ
Ga0134125_1297476823300010371Terrestrial SoilMATATLTPDNDAILAEIFIAAPPARVFEAIADPKQRAQWWGIKAPSGP
Ga0134128_1197662913300010373Terrestrial SoilMATAQVTPNHDSVQVEIFIAAPPARVFQAISDPAQTRQWWGDKGL
Ga0126381_10332618023300010376Tropical Forest SoilMATALITPDNDVVVAEILIAAPPARVFEAIADPKQ
Ga0136449_10209802113300010379Peatlands SoilMATASITPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWW
Ga0126356_1077610723300010877Boreal Forest SoilMATATVTPDQNAVVAEIFIAAPPARVFQAISDPSQLPKWWGQ
Ga0153933_103627913300011411Attine Ant Fungus GardensMATSEITPDQNAVVAEIFIAAPPERVFQAITDPSQTQQW
Ga0137383_1025438833300012199Vadose Zone SoilMTTATTAATARITPDNDSVVAEVFMAAPPERVFQALVDP
Ga0137363_1144644123300012202Vadose Zone SoilMTTNAITPDQDAIALEVQIAAPPGRVFEAITDPTQLLRWWGQQGIY
Ga0137362_1067345413300012205Vadose Zone SoilMNRRDLMATVAITPDQDVVTAEIFIAAPPARVFEAITDPYQMPKWWGH
Ga0137376_1135961123300012208Vadose Zone SoilMATATITPDQNAVLAEIFIAAPPARVYQAISDPTQLPKWWGQDGLYHV
Ga0137385_1086983513300012359Vadose Zone SoilMATAQITPDHDAILAEIFIAAPPVRVFEAITDPKQRAQWWGQK
Ga0137396_1047762133300012918Vadose Zone SoilMATVAITPDQDVVTAEIFIAAPPARVFEAITDPYQMPKWWGQQGMYKI
Ga0126375_1117468913300012948Tropical Forest SoilMATSQIAHDHDTVQVEIFIGAPPARVFQAISDPAQTTQWWGQKGMYRLTKS
Ga0164303_1064077113300012957SoilMATAAVTPDNDAVLAEVFIAAPPERVFQAITDPQQMPLWWGQQGVYCVSEW
Ga0164301_1017973733300012960SoilMATTQITPDNNTVVAEVFIAAPPDRVFDALTDPRQ
Ga0164301_1163216523300012960SoilMATAQITPNNDAILAEIFIAAPPARVFEAITDPQQRM
Ga0164302_1147021213300012961SoilMATATITPDQDLIRAEIHIAAPPERVFAAISDPSQVGQWW
Ga0126369_1159837823300012971Tropical Forest SoilMAITPEQDTVLGEIFIAAPPARVFEAITDPKQIPHWWGQH
Ga0126369_1323638613300012971Tropical Forest SoilMATAAITPDQNAVIADIFIAAPPARVFQAISDPNQLPRWWGQAGL
Ga0134087_1081926733300012977Grasslands SoilMQGAEKMVTATVTPDQNAVVAEVFIAAPPARVFQAI
Ga0164309_1016337543300012984SoilMATAAVTPDNDAVLAEVFIAAPPERVFQAITDPKQMP*
Ga0157369_1036382643300013105Corn RhizosphereMATAQIIQGNDTVEVEIFIAAPPTRVFQAISDPSQTAQWWGQKGLYRVTKAEAE
Ga0157372_1091041443300013307Corn RhizosphereMATAAVTPDNDAVLAEVFIAAPPERVFQAITDPKQMP
Ga0157375_1351082423300013308Miscanthus RhizosphereMATAQITPDQDAILAEIFIAAPPVRVFEAIADVNQRA
Ga0181532_1001179963300014164BogMATATITPDHDTVLAEIFIAAPPERVFQAISDPNQLSQW*
Ga0181532_1044648613300014164BogMATVAITPDQDVVSCEIFIAAPPARVFQAITDPRQLPQWW
Ga0182039_1010512523300016422SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWG
Ga0187818_1029421713300017823Freshwater SedimentMATATITPDKNTVVAEIFIAAPPARVFQAISDPTQLPKWWGQSGLYHVVK
Ga0187824_1036282213300017927Freshwater SedimentMATATITPNQNAVIAEVFIAAPPARVFQAISDPAQL
Ga0187808_1038256513300017942Freshwater SedimentMATSAISPNQDVVVAEIFIAAPPERVFQAITDPNQMPQ
Ga0187819_1019677633300017943Freshwater SedimentMATATITPDQTAVIAEIFIAAPPARVFQAISDPAQVPKWWGQTGLY
Ga0187879_1082425613300017946PeatlandMATVAITPDQDVVTGEIFIAAPPARVFQALTEPNQMPQW
Ga0187817_1017677133300017955Freshwater SedimentMATMAITPDLDAVVGEIFIAAPPARVFEAITDPNQVPR
Ga0187817_1099191623300017955Freshwater SedimentMATAVLTPDQNAVIAEIFIAAPPARVFQALSDPAQLPKWWGQDG
Ga0187779_1032958233300017959Tropical PeatlandMATAVLTPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQDGLYHVTKSTM
Ga0187781_1071949123300017972Tropical PeatlandMATAVLTPDQDAVIAEIFIAAPPARVFQAISDPAQLPRWWGQDGLYHV
Ga0187782_1105391213300017975Tropical PeatlandMATAVLTTDQNAVVAEIFIAAPPARVFQAISDPAQLPKWWGQD
Ga0187822_1026715123300017994Freshwater SedimentMATATITPDQNTIIAEIFIAAPPARVFQAISDPAQLPKWWG
Ga0187884_1017428833300018009PeatlandMATVAITPDQDVVSCEIFIAAPPARVFQAITDPRQLPQ
Ga0187883_1059427623300018037PeatlandMATNAITSDQDMVTAEIFIAAPPERVFQAMTDPAETS
Ga0187851_1005469213300018046PeatlandMAMSKAIITPDQDAIIAEIDIAAPPSRVFASVNQRCSCSGS
Ga0187859_1044200613300018047PeatlandMATTAITPDQDAIVGEIFIAAPPARVFQAITDPSQLPLWWGARGL
Ga0187766_1097506913300018058Tropical PeatlandMATATITPDQNAVVAEIFIAAPPARVFEAITDPAQ
Ga0187770_1150597113300018090Tropical PeatlandMATMATMAINAEQDAVFGEVFITAPPARVFEALTDPNQVPRWW
Ga0066655_1054860423300018431Grasslands SoilMATAQVTPDNDVVTAEIFIAAPPARVFAAITDPTQTATRRG
Ga0066662_1296467823300018468Grasslands SoilMATAHLTPDNDAGQVETFVAAPPSRVFQAISDPAQTTQWWGQKGLYRV
Ga0193721_117271723300020018SoilMATAQITPDKDTVVAEILVAAPPARVFEAISDPKQT
Ga0197907_1018549813300020069Corn, Switchgrass And Miscanthus RhizosphereMATATITPDNDTVIAEIFVAAPQERVFQAITDPAQS
Ga0206352_1006593623300020078Corn, Switchgrass And Miscanthus RhizosphereMATAQITPDQDAILAEIFIAAPPARVFEAIADVNQH
Ga0210399_1052916813300020581SoilMATATIAPDQTAVIAEIFIAAPPARVFQAISDPAQ
Ga0210399_1071292423300020581SoilMATSSITPDQNAVIAEIFIAAPPARVFQAISDPMQLPRWW
Ga0210400_1070421413300021170SoilMATIEVTPDQDVITGEIFIAAPPERVFQAISDPNQMPQW
Ga0210405_1134148323300021171SoilMATNAITSDQDVVTAEIFIAAPPERVFQAMTDPAQT
Ga0210388_1140003613300021181SoilMATATITPDHDTILAEIFIAAPPERVFQAISDPAQ
Ga0210393_1112195013300021401SoilMATATITPDQDTILAEVFIAAPPARVFEAIADPKQRAQWWGV
Ga0210387_1157516413300021405SoilMATITVTPDQDAVLAEIYIAAPRERVFQAISDPTQL
Ga0210383_1161422713300021407SoilMATATITPDQNAVVAEIFIAAPPARVFQAISDPTH
Ga0182009_1015404913300021445SoilMAIATITPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQSGLYRVIKSTMDV
Ga0210390_1005739313300021474SoilMATATITPDQNAVVAEIFIAAPPARVFQAISDPNQLPK
Ga0210398_1083564423300021477SoilMTTASILPEQDTVVVEIFIAAPPERVYQAITDPAQTVK
Ga0210410_1166065023300021479SoilMATATISPDQNAVVAEIFIAAPPARVFQAISDPAQLPKWWGRSDLYRITNSTAD
Ga0126371_1009852253300021560Tropical Forest SoilMASAAITPDNDAIVAEVFIAAPPARVFEAIVDRRGAPNGGA
Ga0126371_1078633933300021560Tropical Forest SoilMATSVLTPDQNAVVAEIFIAAPPARVFQAISDPAQLPKWWGQDGLYH
Ga0126371_1218849513300021560Tropical Forest SoilMATASITPDHDTILAEVFIAAPPARVFEAITDLKQRARWWGIKPSGS
Ga0213851_108099413300021860WatershedsMATATITPDQNAVIAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYRVIKSTIDL
Ga0242665_1003378413300022724SoilMATATITPDQNAVTAEIFIAAPPARVFQAISDPTQLP
Ga0247669_106797213300024182SoilMATAQITPDTDAILAEIFIAAPPARVFEAIADVKQRAQ
Ga0208038_104729013300025446PeatlandMATISISPDQDTVLAEIHIAAPPERVFQAITDPRQM
Ga0208076_106035623300025464Arctic Peat SoilMATATITPDQNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLYH
Ga0207699_1145678913300025906Corn, Switchgrass And Miscanthus RhizosphereMATAQITPDTDAILAEIFIAAPPARVFEAIADPKQRSSWWG
Ga0207671_1137473123300025914Corn RhizosphereMSTLAITPDQDAIFGEIFIAAPPERVYQAITDPLQLLQWW
Ga0207693_1123304233300025915Corn, Switchgrass And Miscanthus RhizosphereMATAQITPDQDAILAEIFIAAPPARVFEAIADVNQRAQWWG
Ga0207687_1002876083300025927Miscanthus RhizosphereMATTQITPDQDTILAEIFIAAPPTRVFEAIADVKQ
Ga0207700_1082369133300025928Corn, Switchgrass And Miscanthus RhizosphereMATAQITPDQDAVHVEIFVAAPPARVFEAISDPAQSSQWWGQKGLYRVTKVEAD
Ga0207700_1159175023300025928Corn, Switchgrass And Miscanthus RhizosphereMATATITPDQNAVIAEVFIAAPPARVFQAISDPAQLPKWWGQSGLYHVIKSTMD
Ga0207664_1010397353300025929Agricultural SoilMAAAQVTPDNDAVHLEIFVAAPPARVFQAISDPAQSSQWWGQK
Ga0207712_1036858833300025961Switchgrass RhizosphereMATTQITPDQDTILAEIFIAAPPTRVFEAIADVKQRAQW
Ga0207677_1071603633300026023Miscanthus RhizosphereMATAQITPDQDAILAEIFIAAPPVRVFEAIADVNQ
Ga0209155_116168013300026316SoilMATATITPDQNAVIAEIFIAAPPARVFQAISDPAQ
Ga0209804_104851033300026335SoilMANIAVTPDQDTIEAEIFIAAPPERVFQALTDPNQMPR
Ga0209807_123032523300026530SoilMERIVDSATAQLTPDHDTILAEVFIAAPPARVFEAITDP
Ga0209056_1030447513300026538SoilMATAQITPDQDAILAEIFIAAPPARVFEAIADATQR
Ga0207819_104775613300027024Tropical Forest SoilMATATITPDQNAVLAEIFIAAPPARVFQAISDPTQLPKWWGQSGLYHVTK
Ga0209732_107514413300027117Forest SoilMATVAITPDQDVITGEIFIAAPPARVFQAITDPDQ
Ga0209527_101390743300027583Forest SoilMATVAITPEQNIVTGEIFIAAPPARVFQAITDPIQMPCWWGARDMYHIKEWKADV
Ga0209038_1001271263300027737Bog Forest SoilMTTASILPDQDTVVVQIFIAAPPERVFQAITDPVQTVQWW
Ga0209811_1002154313300027821Surface SoilMATATITPDQNAVIAEVFIAAPPARVFQAISDPTQLPRWW
Ga0209811_1030977423300027821Surface SoilMATTQITPDNNTVVAEVFIAAPPDRVFDALTDPRQMT
Ga0209060_1054355923300027826Surface SoilMATATVTPDHNAVLAEIFIAAPPARVFQAISDPAQLPRWWGQDGL
Ga0209580_1015210213300027842Surface SoilMATATITPDQNAVVAEIFIAAPPARVFEAISDPNQLPKWWGQEGLYQVTKSIMDV
Ga0209579_1063732823300027869Surface SoilMATATVTPDNDAVLAEVFIAAPPERVFQAITDPKQMPLWW
Ga0209169_1032872913300027879SoilMATANVTAAVNPAQDAVLAEVFIAAPPARVFEAITDPSQVPR
Ga0209067_1045770223300027898WatershedsMATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLPKWWGQSD
Ga0209168_1009680943300027986Surface SoilMATAVITPENVVIAEIFIAAPPARVFQAISDPNQLPKWWGQDGLYHI
Ga0137415_1007091183300028536Vadose Zone SoilMATSAVTPDNDAVVAEVFIAAPPERVFQAITDPKQ
Ga0137415_1062762133300028536Vadose Zone SoilMATVAITPDQDVVTAEIFIAAPPARVFEAITDPYQMPKW
Ga0302303_1031204123300028776PalsaMATATITPDQDTVLAEIFIAAPPERVFQAISLPEQ
Ga0302227_1042041313300028795PalsaMATATITPDQNTVIAEIFIAAPPARVFEAITDPEQ
Ga0308309_1092431333300028906SoilMATATITPDQNTVIAEVFIAAPPARVFQAISDPQQMPQWWGQSGVYT
Ga0308309_1102039313300028906SoilMATVAITPDQDVITGEIFIAAPPARVFQAITDPDQM
Ga0311329_1009118763300029907BogMATASISPDQDVITGEIFIAAPPARVFQAITDPNQMPRW
Ga0302280_121279113300029985FenMATTSVTPDQETVVGEVFIAAPPARVFEAITDASQIPRWW
Ga0302270_1003866113300030011BogMATTSVTPDQETVVGEVFIAAPPARVFEAITDASQIP
Ga0311357_1114945113300030524PalsaMATAVISPDHDTVVAEMFIAAPPERVFQAISDPNQL
Ga0265340_1047576823300031247RhizosphereMATATITPDQTAVIAEIFIAAPPARVFQAISDPTQLPKWWGQTG
Ga0265316_1005500613300031344RhizosphereMATATITPDRNAVVAEIFIAAPPARVFQAISDPTQLPKWWGQEGLYHVTKS
Ga0265316_1099248323300031344RhizosphereMATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLLKWWGQT
Ga0310915_1000212613300031573SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKGMYQVTRSEADF
Ga0318560_1072165513300031682SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKGM
Ga0310686_10424397013300031708SoilMATNAISSDQDVVTAEIFIAAPPERVFQAMTDPAET
Ga0307476_1086686313300031715Hardwood Forest SoilMATATITPDQNAVTAEIFIAAPPARVFQAISDPTQ
Ga0307476_1112404513300031715Hardwood Forest SoilMATTSITPQQDTVLAEIFIAAPPERVFRAITDPQQMSNW
Ga0307474_1072234813300031718Hardwood Forest SoilVATAQVTPDNDVVVAEIFIAAPPARVFQAITDPKQASQWWGQKG
Ga0306917_1011573643300031719SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPSQTPLWWGQ
Ga0307475_1000322713300031754Hardwood Forest SoilMATIALTPDHDIINAEIFVAAPPERVFQALTDPSQMP
Ga0318546_1000715693300031771SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQK
Ga0318497_1050288323300031805SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLW
Ga0318564_1041627423300031831SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKG
Ga0318551_1082444823300031896SoilMATAAITPDQNAVIADVFIAAPPARVFQAISDPKQIPRWWGQDGLYRVTQSTADV
Ga0318520_1014406213300031897SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKGMYQ
Ga0308174_1056886933300031939SoilMATAQITPDNDAVLAEVLVAAPPARVFEAITDPRQ
Ga0310913_1130658123300031945SoilMATAAITPDQDTVVAEIFISAPPERVFEAITDPKQMPLW
Ga0318531_1051683523300031981SoilMATAAITPDQDTVVAEIFISAPPERVFEAITDPKQMPLWWGQK
Ga0318559_1054787023300032039SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPSQTPL
Ga0318505_1063112123300032060SoilMATATITPDQNAVIAEVFIAAPPARVFQAISDPAQLPR
Ga0318524_1005155943300032067SoilMATIAITPDQNVIEAEIFVAAPRERVFQALTDPTQTPLWWGQKGMYQVTR
Ga0311301_1070630133300032160Peatlands SoilMATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLYHVTKSTM
Ga0311301_1274207613300032160Peatlands SoilMATATITPDRNAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLYHVTKS
Ga0307471_10003752073300032180Hardwood Forest SoilMASATITPDQNAVIAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYRVTKST
Ga0307471_10183430813300032180Hardwood Forest SoilMATVTITPDQNTIFAEIFIAAPPARVFEAITDLNQMPQWWGQHGIHRITEWKADLR
Ga0307472_10136369013300032205Hardwood Forest SoilMATLAVTPDHDTIEAEIFVAAPPERVFQALTDPAQ
Ga0335085_1152999623300032770SoilMATATITPDQTAVIAEIFIAAPPARVFQAISDPAQLPKWWGQTGLYHVTK
Ga0335079_1004263113300032783SoilMATATITPDQETVLAEIFIAAPPERVFEAISDPNQL
Ga0335080_1009393913300032828SoilMATATITPDQNAVIAEVFIAAPPARVFQAISDPAQLPKWWG
Ga0335081_1036588853300032892SoilMATATVTPDQNTVIAEVFIAAPPARVFQAISDPTQLPRWWGQSGLYHVTKS
Ga0335081_1058645743300032892SoilMATASISPDQDVIYAEVFIAAPPERVFQAITDPEQ
Ga0335081_1160065423300032892SoilMATATITPDQNAVVAEIFIAAPPARVFQAISDPQQLP
Ga0335069_1017246653300032893SoilMATATITPDQDAVVAEIFIAAPPARVFQAISDPTQLPRWWGQDGLYHVTKSIMD
Ga0335074_1037701323300032895SoilMATASLTPDQDAIEAEIFIAAPPARVFEAITDPKQRAHGGE
Ga0335071_1009978813300032897SoilMATATVTPDQNTVIAEVFIAAPPARVFQAISDPTQLPRWWGQSG
Ga0335076_1033495743300032955SoilMAALAIAVTPTQDEVVGEVFIAAPPARVFAAITDPAQVP
Ga0335084_1188571323300033004SoilMATMAVTPDQDVVSGEIFIAAPPARVFEAITDPNQVLRWW
Ga0335077_1120219133300033158SoilMATSAVSLDQDVVTAEIFIAAPPERVFQAITDPKRPPQ
Ga0334804_134634_3_1163300033818SoilMATVAITPDQNTVVGEIFIAAPPARVFEALTDPSQMPR
Ga0334847_042858_404_5233300033826SoilMATATITPDQNAVVAEIFIAAPPARVFQAISDPSQLPKWW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.