Basic Information | |
---|---|
Family ID | F028217 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 192 |
Average Sequence Length | 43 residues |
Representative Sequence | MLAGTLQTWIKRQIAVRQRLERVCTSYLLFLMVVTTKHSL |
Number of Associated Samples | 151 |
Number of Associated Scaffolds | 192 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 98.38 % |
% of genes near scaffold ends (potentially truncated) | 93.23 % |
% of genes from short scaffolds (< 2000 bps) | 90.62 % |
Associated GOLD sequencing projects | 142 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.771 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.312 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.604 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.708 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 192 Family Scaffolds |
---|---|---|
PF01609 | DDE_Tnp_1 | 2.60 |
PF01610 | DDE_Tnp_ISL3 | 2.08 |
PF13546 | DDE_5 | 1.56 |
PF13701 | DDE_Tnp_1_4 | 1.04 |
PF00589 | Phage_integrase | 1.04 |
PF13005 | zf-IS66 | 1.04 |
PF13655 | RVT_N | 1.04 |
PF13358 | DDE_3 | 1.04 |
PF00072 | Response_reg | 0.52 |
PF00496 | SBP_bac_5 | 0.52 |
PF00196 | GerE | 0.52 |
PF00140 | Sigma70_r1_2 | 0.52 |
PF12680 | SnoaL_2 | 0.52 |
PF05598 | DUF772 | 0.52 |
PF13586 | DDE_Tnp_1_2 | 0.52 |
PF02943 | FeThRed_B | 0.52 |
PF13604 | AAA_30 | 0.52 |
PF14279 | HNH_5 | 0.52 |
PF01695 | IstB_IS21 | 0.52 |
PF00296 | Bac_luciferase | 0.52 |
PF13700 | DUF4158 | 0.52 |
PF13683 | rve_3 | 0.52 |
PF00465 | Fe-ADH | 0.52 |
PF07695 | 7TMR-DISM_7TM | 0.52 |
PF09851 | SHOCT | 0.52 |
PF02464 | CinA | 0.52 |
PF00782 | DSPc | 0.52 |
PF05685 | Uma2 | 0.52 |
PF02515 | CoA_transf_3 | 0.52 |
COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
---|---|---|---|
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.60 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.60 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.60 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.60 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.60 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.60 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 2.08 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.52 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.52 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.52 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.52 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.52 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.52 |
COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.52 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.52 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.52 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.52 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.52 |
COG4802 | Ferredoxin-thioredoxin reductase, catalytic subunit | Energy production and conversion [C] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.77 % |
All Organisms | root | All Organisms | 43.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000787|JGI11643J11755_11774321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 2070 | Open in IMG/M |
3300000956|JGI10216J12902_112756048 | Not Available | 603 | Open in IMG/M |
3300001431|F14TB_101276296 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 528 | Open in IMG/M |
3300002912|JGI25386J43895_10186783 | Not Available | 520 | Open in IMG/M |
3300003996|Ga0055467_10197470 | Not Available | 619 | Open in IMG/M |
3300004268|Ga0066398_10068908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 760 | Open in IMG/M |
3300004479|Ga0062595_102501328 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 515 | Open in IMG/M |
3300005172|Ga0066683_10396977 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 853 | Open in IMG/M |
3300005174|Ga0066680_10293150 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1038 | Open in IMG/M |
3300005178|Ga0066688_10820869 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300005186|Ga0066676_10799616 | Not Available | 639 | Open in IMG/M |
3300005186|Ga0066676_10883975 | Not Available | 600 | Open in IMG/M |
3300005295|Ga0065707_10575201 | Not Available | 671 | Open in IMG/M |
3300005332|Ga0066388_102017878 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 1035 | Open in IMG/M |
3300005341|Ga0070691_10885053 | Not Available | 550 | Open in IMG/M |
3300005406|Ga0070703_10454942 | Not Available | 568 | Open in IMG/M |
3300005441|Ga0070700_101385881 | Not Available | 594 | Open in IMG/M |
3300005447|Ga0066689_10883608 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005468|Ga0070707_101069757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
3300005536|Ga0070697_102122554 | Not Available | 503 | Open in IMG/M |
3300005552|Ga0066701_10960279 | Not Available | 506 | Open in IMG/M |
3300005558|Ga0066698_10283293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1147 | Open in IMG/M |
3300005558|Ga0066698_11088282 | Not Available | 506 | Open in IMG/M |
3300005616|Ga0068852_101490720 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 699 | Open in IMG/M |
3300005616|Ga0068852_101753033 | Not Available | 643 | Open in IMG/M |
3300005764|Ga0066903_106584664 | Not Available | 605 | Open in IMG/M |
3300005843|Ga0068860_102587862 | Not Available | 527 | Open in IMG/M |
3300006032|Ga0066696_10725584 | Not Available | 637 | Open in IMG/M |
3300006049|Ga0075417_10691335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 523 | Open in IMG/M |
3300006196|Ga0075422_10548401 | Not Available | 530 | Open in IMG/M |
3300006800|Ga0066660_10945750 | Not Available | 698 | Open in IMG/M |
3300006844|Ga0075428_100663746 | Not Available | 1112 | Open in IMG/M |
3300006844|Ga0075428_102018095 | Not Available | 598 | Open in IMG/M |
3300006845|Ga0075421_100656695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae → Chlorogloeopsis → Chlorogloeopsis fritschii | 1225 | Open in IMG/M |
3300006845|Ga0075421_101692740 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_16_59_8 | 684 | Open in IMG/M |
3300006845|Ga0075421_101737562 | Not Available | 673 | Open in IMG/M |
3300006845|Ga0075421_102466923 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae | 542 | Open in IMG/M |
3300006846|Ga0075430_101496570 | Not Available | 554 | Open in IMG/M |
3300006847|Ga0075431_101752034 | Not Available | 578 | Open in IMG/M |
3300006847|Ga0075431_101816978 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 565 | Open in IMG/M |
3300006853|Ga0075420_100499802 | Not Available | 1050 | Open in IMG/M |
3300006853|Ga0075420_101389006 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 602 | Open in IMG/M |
3300006853|Ga0075420_101695148 | Not Available | 541 | Open in IMG/M |
3300006854|Ga0075425_101822298 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300006854|Ga0075425_101926849 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300006865|Ga0073934_10834852 | Not Available | 523 | Open in IMG/M |
3300006880|Ga0075429_101389499 | Not Available | 611 | Open in IMG/M |
3300006904|Ga0075424_102624238 | Not Available | 527 | Open in IMG/M |
3300006969|Ga0075419_10853021 | Not Available | 655 | Open in IMG/M |
3300006969|Ga0075419_11368507 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 527 | Open in IMG/M |
3300007076|Ga0075435_100684878 | Not Available | 891 | Open in IMG/M |
3300007258|Ga0099793_10155040 | Not Available | 1086 | Open in IMG/M |
3300007265|Ga0099794_10617538 | Not Available | 575 | Open in IMG/M |
3300009088|Ga0099830_11678182 | Not Available | 530 | Open in IMG/M |
3300009089|Ga0099828_11237042 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon ANME-2c ERB4 | 662 | Open in IMG/M |
3300009090|Ga0099827_10842745 | Not Available | 794 | Open in IMG/M |
3300009090|Ga0099827_11028974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Horticoccus → Horticoccus luteus | 715 | Open in IMG/M |
3300009090|Ga0099827_11837817 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300009100|Ga0075418_11187654 | Not Available | 827 | Open in IMG/M |
3300009137|Ga0066709_101487658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 978 | Open in IMG/M |
3300009137|Ga0066709_104620079 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 503 | Open in IMG/M |
3300009147|Ga0114129_10375461 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300009147|Ga0114129_13461559 | Not Available | 506 | Open in IMG/M |
3300009148|Ga0105243_12101621 | Not Available | 600 | Open in IMG/M |
3300009553|Ga0105249_13108506 | Not Available | 533 | Open in IMG/M |
3300009691|Ga0114944_1379554 | Not Available | 594 | Open in IMG/M |
3300009812|Ga0105067_1023710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geomonas | 864 | Open in IMG/M |
3300009817|Ga0105062_1066465 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 678 | Open in IMG/M |
3300009818|Ga0105072_1135925 | Not Available | 511 | Open in IMG/M |
3300009820|Ga0105085_1025427 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1033 | Open in IMG/M |
3300009822|Ga0105066_1174104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300010038|Ga0126315_11026486 | Not Available | 554 | Open in IMG/M |
3300010046|Ga0126384_10238033 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300010046|Ga0126384_10347825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1234 | Open in IMG/M |
3300010048|Ga0126373_12079616 | Not Available | 630 | Open in IMG/M |
3300010166|Ga0126306_11825271 | Not Available | 509 | Open in IMG/M |
3300010304|Ga0134088_10383764 | Not Available | 684 | Open in IMG/M |
3300010359|Ga0126376_10436669 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300010360|Ga0126372_12447841 | Not Available | 573 | Open in IMG/M |
3300010362|Ga0126377_12636267 | Not Available | 578 | Open in IMG/M |
3300010362|Ga0126377_13549133 | Not Available | 504 | Open in IMG/M |
3300010366|Ga0126379_11082136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 907 | Open in IMG/M |
3300010366|Ga0126379_13552089 | Not Available | 522 | Open in IMG/M |
3300010398|Ga0126383_12909453 | Not Available | 559 | Open in IMG/M |
3300011270|Ga0137391_10743362 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 812 | Open in IMG/M |
3300012096|Ga0137389_11296059 | Not Available | 622 | Open in IMG/M |
3300012096|Ga0137389_11545047 | Not Available | 560 | Open in IMG/M |
3300012189|Ga0137388_10336201 | Not Available | 1390 | Open in IMG/M |
3300012199|Ga0137383_10087494 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
3300012199|Ga0137383_11045795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 593 | Open in IMG/M |
3300012199|Ga0137383_11163773 | Not Available | 556 | Open in IMG/M |
3300012206|Ga0137380_11266917 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 622 | Open in IMG/M |
3300012209|Ga0137379_10127964 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
3300012209|Ga0137379_11813238 | Not Available | 504 | Open in IMG/M |
3300012210|Ga0137378_10182633 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
3300012211|Ga0137377_10703216 | Not Available | 945 | Open in IMG/M |
3300012349|Ga0137387_10256120 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300012349|Ga0137387_10748933 | Not Available | 707 | Open in IMG/M |
3300012351|Ga0137386_10300481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
3300012351|Ga0137386_11147822 | Not Available | 546 | Open in IMG/M |
3300012356|Ga0137371_11266267 | Not Available | 547 | Open in IMG/M |
3300012357|Ga0137384_10891333 | Not Available | 717 | Open in IMG/M |
3300012357|Ga0137384_11544963 | Not Available | 513 | Open in IMG/M |
3300012359|Ga0137385_11375532 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 569 | Open in IMG/M |
3300012359|Ga0137385_11482964 | Not Available | 542 | Open in IMG/M |
3300012362|Ga0137361_10968384 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300012891|Ga0157305_10126219 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 662 | Open in IMG/M |
3300012923|Ga0137359_11776449 | Not Available | 504 | Open in IMG/M |
3300012929|Ga0137404_11037234 | Not Available | 751 | Open in IMG/M |
3300012948|Ga0126375_11401901 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 592 | Open in IMG/M |
3300012960|Ga0164301_11511473 | Not Available | 553 | Open in IMG/M |
3300012972|Ga0134077_10180213 | Not Available | 854 | Open in IMG/M |
3300013306|Ga0163162_12842588 | Not Available | 557 | Open in IMG/M |
3300014310|Ga0075331_1125004 | Not Available | 615 | Open in IMG/M |
3300015053|Ga0137405_1421520 | Not Available | 4496 | Open in IMG/M |
3300016294|Ga0182041_12098154 | Not Available | 527 | Open in IMG/M |
3300016357|Ga0182032_10111744 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1952 | Open in IMG/M |
3300016357|Ga0182032_10945391 | Not Available | 734 | Open in IMG/M |
3300016357|Ga0182032_11034563 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300016357|Ga0182032_11908037 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 520 | Open in IMG/M |
3300016445|Ga0182038_11076742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 714 | Open in IMG/M |
3300017659|Ga0134083_10176113 | Not Available | 875 | Open in IMG/M |
3300017792|Ga0163161_12004531 | Not Available | 515 | Open in IMG/M |
3300017997|Ga0184610_1013989 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
3300017997|Ga0184610_1144565 | Not Available | 778 | Open in IMG/M |
3300018056|Ga0184623_10090394 | Not Available | 1412 | Open in IMG/M |
3300018056|Ga0184623_10467714 | Not Available | 543 | Open in IMG/M |
3300018063|Ga0184637_10710649 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Handelsmanbacteria → Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10 | 548 | Open in IMG/M |
3300018075|Ga0184632_10292406 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300018075|Ga0184632_10466638 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 521 | Open in IMG/M |
3300018078|Ga0184612_10621261 | Not Available | 510 | Open in IMG/M |
3300018468|Ga0066662_10863575 | Not Available | 885 | Open in IMG/M |
3300018468|Ga0066662_11784858 | Not Available | 644 | Open in IMG/M |
3300018468|Ga0066662_12810821 | Not Available | 516 | Open in IMG/M |
3300018481|Ga0190271_13411058 | Not Available | 532 | Open in IMG/M |
3300019249|Ga0184648_1028414 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300019259|Ga0184646_1625342 | Not Available | 521 | Open in IMG/M |
3300021086|Ga0179596_10699194 | Not Available | 513 | Open in IMG/M |
3300025559|Ga0210087_1082838 | Not Available | 634 | Open in IMG/M |
3300025910|Ga0207684_11190523 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 631 | Open in IMG/M |
3300025922|Ga0207646_10823040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
3300025939|Ga0207665_10867824 | Not Available | 715 | Open in IMG/M |
3300026041|Ga0207639_12002517 | Not Available | 540 | Open in IMG/M |
3300026044|Ga0208287_1008496 | Not Available | 939 | Open in IMG/M |
3300026297|Ga0209237_1268139 | Not Available | 523 | Open in IMG/M |
3300026332|Ga0209803_1342376 | Not Available | 517 | Open in IMG/M |
3300026527|Ga0209059_1076478 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Fuerstiella → Fuerstiella marisgermanici | 1426 | Open in IMG/M |
3300027068|Ga0209898_1045829 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 568 | Open in IMG/M |
3300027169|Ga0209897_1007114 | Not Available | 1468 | Open in IMG/M |
3300027209|Ga0209875_1028283 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300027655|Ga0209388_1200045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300027748|Ga0209689_1435336 | Not Available | 502 | Open in IMG/M |
3300027882|Ga0209590_10118822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1604 | Open in IMG/M |
3300027903|Ga0209488_10395762 | Not Available | 1023 | Open in IMG/M |
3300027907|Ga0207428_10427204 | Not Available | 968 | Open in IMG/M |
3300028536|Ga0137415_10157493 | Not Available | 2106 | Open in IMG/M |
3300028878|Ga0307278_10349989 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 651 | Open in IMG/M |
3300028880|Ga0307300_10348855 | Not Available | 510 | Open in IMG/M |
3300031093|Ga0308197_10266215 | Not Available | 616 | Open in IMG/M |
3300031096|Ga0308193_1073550 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 550 | Open in IMG/M |
3300031096|Ga0308193_1094640 | Not Available | 506 | Open in IMG/M |
3300031098|Ga0308191_1024335 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300031099|Ga0308181_1155557 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 538 | Open in IMG/M |
3300031184|Ga0307499_10111629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 761 | Open in IMG/M |
3300031229|Ga0299913_11603786 | Not Available | 602 | Open in IMG/M |
3300031546|Ga0318538_10803979 | Not Available | 511 | Open in IMG/M |
3300031561|Ga0318528_10018032 | All Organisms → cellular organisms → Bacteria | 3336 | Open in IMG/M |
3300031561|Ga0318528_10730954 | Not Available | 529 | Open in IMG/M |
3300031720|Ga0307469_12334638 | Not Available | 522 | Open in IMG/M |
3300031744|Ga0306918_10132382 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
3300031793|Ga0318548_10445793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
3300031793|Ga0318548_10547141 | Not Available | 564 | Open in IMG/M |
3300031795|Ga0318557_10037101 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2000 | Open in IMG/M |
3300031852|Ga0307410_12123137 | Not Available | 502 | Open in IMG/M |
3300031860|Ga0318495_10073070 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1529 | Open in IMG/M |
3300031879|Ga0306919_10072844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2345 | Open in IMG/M |
3300031910|Ga0306923_12311588 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 536 | Open in IMG/M |
3300031946|Ga0310910_10105634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2097 | Open in IMG/M |
3300032126|Ga0307415_100135384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1873 | Open in IMG/M |
3300032180|Ga0307471_100608025 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300032180|Ga0307471_103693879 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 541 | Open in IMG/M |
3300033815|Ga0364946_009191 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300034172|Ga0334913_011916 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
3300034666|Ga0314788_132386 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 592 | Open in IMG/M |
3300034668|Ga0314793_170800 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella serta | 504 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.31% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.69% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.65% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.56% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.04% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.04% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.04% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.04% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.52% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.52% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026044 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J11755_117743211 | 3300000787 | Soil | MQTCTLQTWIARQIRLRRRLENVCTSYLLFLMVVTTK |
JGI10216J12902_1127560482 | 3300000956 | Soil | MPAGTLHTWIKRHIAVRRRLERICTGYLLFLMVATTKHSLKEAARFSGLHP |
F14TB_1012762961 | 3300001431 | Soil | MQARTLQTWIVRRIAIRHRLERVCTSYLLFLMVVTTKHSLEEAARFSGLHK |
JGI25386J43895_101867832 | 3300002912 | Grasslands Soil | MLAGTIQTWITRRIAVRQRLERICTSYLLFLMVVTTKQSLEEAAR |
Ga0055468_103090381 | 3300003993 | Natural And Restored Wetlands | MPTQTLKTWIARRISVRPRLQQVGVTYLLFLMVATQKRSF |
Ga0055467_101974701 | 3300003996 | Natural And Restored Wetlands | MRAQTVQTWIARQLFVRRRLANVCTSYLLFLMVVTTKHSL |
Ga0066398_100689082 | 3300004268 | Tropical Forest Soil | MPAGTLHTWIKRHIAVRRRLERICTGYLLFLMVATTKHSLKEAARFSGLH |
Ga0062595_1025013281 | 3300004479 | Soil | MRARTLQTWIARRIGVRRRLERICTGYLLFLMVVTTKHSLEEAAR |
Ga0066683_103969771 | 3300005172 | Soil | MQARTLQTWIARRIGVRRRLERICTGYLLFLMVVTTKHSLEEAARF |
Ga0066680_102931501 | 3300005174 | Soil | MRAGTLHTWIKRHIAVRQRLERMCTSYLLFVMVATTKHSLKEA |
Ga0066688_108208691 | 3300005178 | Soil | MRARTVQTWIARHILVRLRLENVCTSYLLFLMVATRKHSLEEA |
Ga0066676_107996162 | 3300005186 | Soil | MRAQTVQTWIARHILVRLRLENVCTSYLLFLMVVTTKHSLE |
Ga0066676_108839752 | 3300005186 | Soil | MPTRTLQTWVARHILVRLRLEIVCTSYLLFLMVVTTKHSLEE |
Ga0065707_105752011 | 3300005295 | Switchgrass Rhizosphere | MQTRTLQTWITRRIALRQRLARVCTSYLLFLMVVTQKHSLEEAARFSGLHKSL |
Ga0066388_1020178781 | 3300005332 | Tropical Forest Soil | MRARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARF |
Ga0070691_108850531 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MQACTLQTWIARRIALRQRLARVCTSYLLFLMVVTQTHSLEEAARFSGL |
Ga0070703_104549421 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAQTVQTWIARHILVRRRLEHICTSYLLFVMVVTRKHSLEEAARFS |
Ga0070700_1013858811 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTGTLPTWITRHIAVRQRLGRICTSYLLFLMVVTTKHSLEE |
Ga0066689_108836083 | 3300005447 | Soil | MPAGHLPPWIPRHIAVRRRLERMGTGYLLLLMVVTTKHSLKE |
Ga0070707_1010697571 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAGTLQTWMTRRLSVRQRLERVCTSSLLFLMVVTTKHSLEQAARFSGLH |
Ga0070697_1021225541 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MQARTLHTWIARHIAVRTRLAPVGVSYLLFLMVVTRKHSLEEA |
Ga0066701_109602791 | 3300005552 | Soil | MRAQTVQTWIARHILVRRRLENVCTSYLLFLMVMTRKHSL |
Ga0066698_102832932 | 3300005558 | Soil | MLAGTIQTWITRRIAVRQRLERICTSYLLFLMVVTTK |
Ga0066698_110882821 | 3300005558 | Soil | MLTGTLQTWIKRHIAVRQRLERICPSYLLFLMVVTTKH |
Ga0068852_1014907202 | 3300005616 | Corn Rhizosphere | MRARTLQTWIARRIGVRRRLERICTGYLLFLMVVTTKHSLEE |
Ga0068852_1017530331 | 3300005616 | Corn Rhizosphere | MQACTLQTWIARRIALRQRLARVCTSYLLFLMVVTQKHSLEEAA |
Ga0066903_1065846641 | 3300005764 | Tropical Forest Soil | MLAGPLQTWIKRQIAVRQRLARVCTSYLLFLLVVTTKHSLQEAARF |
Ga0068860_1025878622 | 3300005843 | Switchgrass Rhizosphere | MQARTLQTWIVRRIAIRHRLERVCTSYLLFLMVVTTKHSLEE |
Ga0066696_107255842 | 3300006032 | Soil | MQAHTLHTWIARHIAVRTRLTQVGVSYLLFLMVATRKHSLE |
Ga0075417_106913351 | 3300006049 | Populus Rhizosphere | MRAQTVQTWIARQLFVRRRLANVCTSYLLFLMVVTTK |
Ga0075422_105484012 | 3300006196 | Populus Rhizosphere | MSAGALHTWIKRRLTVRRRLGRICTAYLLFLMVVTTK |
Ga0066660_109457502 | 3300006800 | Soil | MPAGPLHTWITRHIAVRPRLERMCTGYLLFVLVATPKHSP |
Ga0075428_1006637462 | 3300006844 | Populus Rhizosphere | MRTGTLQTWIKRHIAVRQRLERICTSYLLFLMVVTTKHSLE |
Ga0075428_1020180951 | 3300006844 | Populus Rhizosphere | MRAQTVQTWIARHLFVRRRLANVCTSYLLFLMVVTTKHSL |
Ga0075421_1006566951 | 3300006845 | Populus Rhizosphere | MLAGTLQTWIKRHIAVRQRLERMCTSYLLFLMVVTTKHSLQEAARF |
Ga0075421_1016927402 | 3300006845 | Populus Rhizosphere | MWARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARFSGLHK |
Ga0075421_1017375621 | 3300006845 | Populus Rhizosphere | MQTCTLQTWIARQIRLRRRLENVCTSYLLFLMVVT |
Ga0075421_1024669231 | 3300006845 | Populus Rhizosphere | MPAGTLHTWIKRQIAVRQWLERICTSYLLFLMVATTKHS |
Ga0075430_1014965701 | 3300006846 | Populus Rhizosphere | MQARTLHSWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEE |
Ga0075431_1017520341 | 3300006847 | Populus Rhizosphere | MLAGTLQTWIKRHIAVRQRLERMCTSYLLFLMVVTT |
Ga0075431_1018169781 | 3300006847 | Populus Rhizosphere | MQARTLHSWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARF |
Ga0075420_1004998021 | 3300006853 | Populus Rhizosphere | MRAQTVQTWIARHILVRRRLENVCTSYLLFLMVVTRKH |
Ga0075420_1013890061 | 3300006853 | Populus Rhizosphere | MRARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARFSGLHK |
Ga0075420_1016951481 | 3300006853 | Populus Rhizosphere | MLAGTIQTWIKHRIAVRLRLERICTSYLLFLMVVTTKHSL |
Ga0075425_1018222982 | 3300006854 | Populus Rhizosphere | MLAGPLQTWITRQIAVRQRLERICTRYLLFLMVATTKHSLEEAARFSG |
Ga0075425_1019268492 | 3300006854 | Populus Rhizosphere | MRAQIVQTWIARHLLVRRRLTNVCTSYLLFLMVVTRKH |
Ga0073934_108348521 | 3300006865 | Hot Spring Sediment | MRAQTVQTWIARHILVRRRLENVCTSYLLFLMVVTRKHSLEEAARFSGRHKS |
Ga0075429_1013894991 | 3300006880 | Populus Rhizosphere | MRAQTVQTWIARHILVRRRLANVCTSYLLFLMVVTRKHSLE |
Ga0075424_1026242381 | 3300006904 | Populus Rhizosphere | MLAGTLQTWIKRQIAVRQRLERVCTSYLLFLMVVTTKHSL |
Ga0075419_108530212 | 3300006969 | Populus Rhizosphere | MWARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARFSGLHKS |
Ga0075419_113685071 | 3300006969 | Populus Rhizosphere | MQARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARFS |
Ga0075435_1006848781 | 3300007076 | Populus Rhizosphere | MRTGTLQTWIKRHIAVRQRLERICTSYLLFLMVVTTKHSL |
Ga0099793_101550401 | 3300007258 | Vadose Zone Soil | MLTLGRDAMLAGPLQTWIKRQLAVRQRLERVCTSYLLFLMVVTTKHSFQEAAR |
Ga0099794_106175382 | 3300007265 | Vadose Zone Soil | MRAQTVQTWIARHLLVRRRLTNVCTSYLLFLMVVTRKHSLEEAARFS |
Ga0099830_116781821 | 3300009088 | Vadose Zone Soil | MLAGTLHTWIKRHIAVRQRLERIGTSYLLFLMVATTKHSLKEAARFSG |
Ga0099828_112370422 | 3300009089 | Vadose Zone Soil | MLAGTLQTWITRHIAVRQRLERICTSYLLFLMVVTT |
Ga0099827_108427452 | 3300009090 | Vadose Zone Soil | MRAGTLHTWIKRHIAVRQRLERICTSYLLFLMVATTKHSLKEAARFSGL |
Ga0099827_110289741 | 3300009090 | Vadose Zone Soil | MLAGTLQTWIKRPISVRQRLERMCTSSLLFLMVVTTKHSLEEAAR |
Ga0099827_118378171 | 3300009090 | Vadose Zone Soil | MQTRTLQTWIARHIRVRLRLQQVCTSYLLFLMVVTTKHS |
Ga0075418_111876541 | 3300009100 | Populus Rhizosphere | MLAGTLQTWIKRHIAVRQRLERMCTSYLLFLMVVTTKH |
Ga0066709_1014876581 | 3300009137 | Grasslands Soil | MLAGTLQTWIKRHISVRQRLERICTSYLLFLMVVTTKHSLEEAARFS |
Ga0066709_1046200791 | 3300009137 | Grasslands Soil | MLAGTLQTWMTRRISVRQRLERVCTSYLLFLMVVTTKHSLEQAARFSGL |
Ga0114129_103754614 | 3300009147 | Populus Rhizosphere | MLAGTLQTWIKRRISVRQRLERICNSYLLFLMVATTNHSLEEAARFSG |
Ga0114129_134615591 | 3300009147 | Populus Rhizosphere | MRAQTIQTWITRHILVRRRLEHVCMSYLLFLMVVTKRHSL |
Ga0105243_121016211 | 3300009148 | Miscanthus Rhizosphere | MLAGTLHTWIKRHIAVRQRLERMCTSYLLFLMVATTKHSLTEAA |
Ga0105249_131085061 | 3300009553 | Switchgrass Rhizosphere | MRAQTVQTWIARHILVRRRLEHICTSYLLFVMVVTR |
Ga0114944_13795541 | 3300009691 | Thermal Springs | MLAGTLQTWITRHIAVRQRLERMCTSYLLFLMVVTT |
Ga0105067_10237103 | 3300009812 | Groundwater Sand | MPARTLQTWIARRISIRQRLERVCTSYLLFLMVVMQKHSLEE |
Ga0105062_10664652 | 3300009817 | Groundwater Sand | MHPHPLQTWVGRRISVRTRLEQVCMSYLLFLMVVTRKHSLEEA |
Ga0105072_11359251 | 3300009818 | Groundwater Sand | MLAGTLQTWITRRIPVRQRLERVCTSYLLFLMVVTTKHSLEQA |
Ga0105085_10254273 | 3300009820 | Groundwater Sand | MLAGTIPTWIKRRIAVRQRLERMCTSYLLFLMVVTTKHSLEEAA |
Ga0105066_11741042 | 3300009822 | Groundwater Sand | MLTGTLQTWITRHIAVRQRLERMCTSSLLFLMVVTTK |
Ga0126315_110264861 | 3300010038 | Serpentine Soil | MRAQTVQTWIARHILVRRRLENVCTSYLLFLMVVT |
Ga0126384_102380331 | 3300010046 | Tropical Forest Soil | MRAQTVQTWIARHIFVRRRLVNVCTSYLLFLMVVTTKHS |
Ga0126384_103478252 | 3300010046 | Tropical Forest Soil | MPTRTLQTWITRRIALRQRLARVCTSYLLFLMVVTQKHSLEEAARFSG |
Ga0126373_120796161 | 3300010048 | Tropical Forest Soil | MLAGTIQTWITRRIAVRQRLERICTSYLLFLMVATTKHSL |
Ga0126306_118252711 | 3300010166 | Serpentine Soil | MLAGPLQTWIKRQIAVRQRLERVCTSYLLFLMVLPTKHTLQEAPRLPGLHPSL |
Ga0134088_103837641 | 3300010304 | Grasslands Soil | MRARTLQTWIARHILVHRRLGSVCTSYLLFLMVVTTKHSLE |
Ga0126376_104366691 | 3300010359 | Tropical Forest Soil | MPAGPLHTWITRHIAVRRRLERICTGYLLFLMVATTKHSLTEAARFS |
Ga0126372_124478411 | 3300010360 | Tropical Forest Soil | MLAGTIQTWITRRIAVRQRLERICTNYLLFLMVVT |
Ga0126377_126362671 | 3300010362 | Tropical Forest Soil | MPTRTLQTWITRRIALRQRLVRVCTSYLLFLMVVTQKHSLEEAARFSGLHKSL |
Ga0126377_128141371 | 3300010362 | Tropical Forest Soil | MQAQTLKTWIVRRISVRTRLEQACVTYLLFLMVVTQKHSFTQAARFSGLN |
Ga0126377_135491332 | 3300010362 | Tropical Forest Soil | MRARPLQTWIARHSLVRRRLESVCPRSLLFLLVGTTQHALEAAA |
Ga0126379_110821362 | 3300010366 | Tropical Forest Soil | MLTSPLHTWVTRHIAVRPRLARVCTSYLLFLMVATTKHSLTE |
Ga0126379_135520892 | 3300010366 | Tropical Forest Soil | MCAGTLHTWITRHIAVRQRLERMCTSYVLFLMVATTKHSFTEAA |
Ga0126383_129094531 | 3300010398 | Tropical Forest Soil | MSAGALHTWIKRHIAVRWRLGRICTAYLLFLMVATT |
Ga0137391_107433623 | 3300011270 | Vadose Zone Soil | MRARTLQTWIARHILVRRRLESICTSYLLFLMVVTTKHSLEEA |
Ga0137389_112960592 | 3300012096 | Vadose Zone Soil | MLTGTLQTWIKRQIAVRQRLERVCTSYLLFLMVVTTKHSLQEAARFS |
Ga0137389_115450471 | 3300012096 | Vadose Zone Soil | MRAQTVQTWIARHILVRLRLQNVGTSYLLFLMVATRKHALE |
Ga0137388_103362013 | 3300012189 | Vadose Zone Soil | MLAGTLQTWIKRHISVRQRLERICTSYLLFLMVVTTK |
Ga0137383_100874941 | 3300012199 | Vadose Zone Soil | MQARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKH |
Ga0137383_110457952 | 3300012199 | Vadose Zone Soil | MPAGTLHTWIKRHIAVRQRLERICTGYLLFLMVATTKHSLKEAA |
Ga0137383_111637731 | 3300012199 | Vadose Zone Soil | MPARTLQTWVARHILVRLRLEIVCTSYLLFLMVVTTKHSLEEAARFSG |
Ga0137380_112669171 | 3300012206 | Vadose Zone Soil | MLAGTLQTWISRRISVRQRLERVCTSYLLFLMVVTTKHSLEEAAR |
Ga0137379_101279641 | 3300012209 | Vadose Zone Soil | MQARTLHPWIARHIAVRTRLVQVGVSYLLFLMVVTRKHSLEEAARFSGLPK |
Ga0137379_118132381 | 3300012209 | Vadose Zone Soil | MPAGTLHTWIKRHIAVRQRLERICTGYLLFLMVATTKHSLK |
Ga0137378_101826332 | 3300012210 | Vadose Zone Soil | MPARTLHTWIARHIAVRTRLAQVGVSSLLFLMVVTRKHSLEEAARFSG* |
Ga0137377_107032161 | 3300012211 | Vadose Zone Soil | MLAGTLQTGITRRIAVRQRRERMCPSALRLLRVVTTKHAIEEAARFAGRPPS |
Ga0137387_102561201 | 3300012349 | Vadose Zone Soil | MLAGPLQTWITRQIAVRQRLERICTSYLLFLMVATTKHSLEEAARFSGL |
Ga0137387_107489332 | 3300012349 | Vadose Zone Soil | MPAGTLHTWIKRHIAVRQRLERICTGYLLFLMVATT |
Ga0137386_103004811 | 3300012351 | Vadose Zone Soil | MLAGTLQTWIKRHISVRQRLERICTSYLLFLMVVTTKHSL |
Ga0137386_111478222 | 3300012351 | Vadose Zone Soil | MLAGTIQTWITRRIAVRQRLERICTSYLLFLMVVTTKHSL |
Ga0137371_112662671 | 3300012356 | Vadose Zone Soil | MLAGTLQTGITRRIAVRQRRERMCPSALRLLRVVTTKHAIEE |
Ga0137384_108913331 | 3300012357 | Vadose Zone Soil | MQARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTK |
Ga0137384_115449631 | 3300012357 | Vadose Zone Soil | MQTRTVQTWIARQIRLRRRLENVCTNYLLFLMVVTTKHSLENAARFS |
Ga0137368_109921991 | 3300012358 | Vadose Zone Soil | MPAQTIKTWIARHISVRTRLEQVCVNYLLFLMVATQKHSFTQAARFSGLNKSTFCKLLRD |
Ga0137385_101551592 | 3300012359 | Vadose Zone Soil | MPAQAIKTWIARHISVRTRLEQVCVNYLLFLLVATQKHS |
Ga0137385_113755321 | 3300012359 | Vadose Zone Soil | MQARTLQTWIARRIALRPRLARVCTSYLLFLMVVTQKHSLEEAARFSGLHKS |
Ga0137385_114829642 | 3300012359 | Vadose Zone Soil | MPAGTLHTWITRHIAVRQRLERICTGYLLFLMVATTK |
Ga0137361_109683841 | 3300012362 | Vadose Zone Soil | MLAGTLQTWITRHIAVRQRLERICTSYLLFLMVITTKHSLEEAARFSRLH |
Ga0157305_101262192 | 3300012891 | Soil | MLTGTIQTWIQRRIAVRQRLGRICTSYLLFLMVVTT |
Ga0137359_117764491 | 3300012923 | Vadose Zone Soil | MPAGTLHTWITRHIAVRRRLERMCTGYLLFVMVATT |
Ga0137404_110372342 | 3300012929 | Vadose Zone Soil | MPAGTLHTWIKRHIAVRQRLERICTGYLLFLMVATTKHSL |
Ga0126375_114019011 | 3300012948 | Tropical Forest Soil | MLAGPIQTWIKRQIAVRPRLERICTSYLLFLMVTTTKHSLEEAARFSGL |
Ga0164301_115114731 | 3300012960 | Soil | MRARTLQTWIARRIGVRRRLERICTGYLLFLMVVTTK |
Ga0134077_101802133 | 3300012972 | Grasslands Soil | MRAQIVQTWIARHILVRFRLENVCTSYLLFLMVATRKHSLEEA |
Ga0163162_128425881 | 3300013306 | Switchgrass Rhizosphere | MRAQRVQTWIARHIIVRLRLENVCTSYLLFLMVVT |
Ga0075331_11250042 | 3300014310 | Natural And Restored Wetlands | MPDYTLRTWIARQINVRQRLERVCACYLLFLMVVT |
Ga0137405_14215203 | 3300015053 | Vadose Zone Soil | MQARTLQTWIARRIAIRQRLERVCTSYLLFLMVVTQKHSLEEAARFFRPAQIPIL* |
Ga0182041_120981541 | 3300016294 | Soil | MLAGTLQTWVKRHIAVRQRLERICTSYLLFLMVVTTKHSL |
Ga0182032_101117443 | 3300016357 | Soil | MLTGTLHTWVTRHIAVRQRLERVCTSYVLFLMVATTKHSLTEAARFSGLHP |
Ga0182032_109453912 | 3300016357 | Soil | MPTGTLPTWITRHITVRRRLERMCTGSLLFLMVATTKHS |
Ga0182032_110345632 | 3300016357 | Soil | MLAGTIQTWIKRRIAVRQRLGRMCTSYLLFLVGVTT |
Ga0182032_119080371 | 3300016357 | Soil | MRARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARFAGL |
Ga0182038_110767421 | 3300016445 | Soil | MPTRTLQTWITRRIALRQRLARVCTSYLLFLMVVTQKHSLEEAARFSGLHK |
Ga0134083_101761132 | 3300017659 | Grasslands Soil | MQARPLHPWIARHIAVRTRLAQVGVSSLLFLMVVPRKHSL |
Ga0163161_120045311 | 3300017792 | Switchgrass Rhizosphere | MLAGPLQTWIKRQIAVRQRLARVCPSSLLFLLVVTTKHSLQEAAR |
Ga0184610_10139893 | 3300017997 | Groundwater Sediment | MQARTLHTWIARHIAVRTRLAQVGVSYLLFLMVVTRKHSLEEAARFSG |
Ga0184610_11445652 | 3300017997 | Groundwater Sediment | MQARTVHPWIARHIAVRTRLAQVGVSYLLFLMVVT |
Ga0184623_100903942 | 3300018056 | Groundwater Sediment | GAMQARTLHTWIARHIAVRTRLAQVGVSYLLFLMVVTRKHYLEEAARFSG |
Ga0184623_104677141 | 3300018056 | Groundwater Sediment | MQARTLHTWIARHIAVRTRLAQVGVSYLLFLMVVTRKH |
Ga0184637_107106491 | 3300018063 | Groundwater Sediment | MRTGTLQTWIKRHLAVRQRLERMCTSSLLFLMVVTTKHS |
Ga0184632_102924062 | 3300018075 | Groundwater Sediment | MQARTLQTWIARRMAIRQRLERVCTRYLLFLMVVTK |
Ga0184632_104666381 | 3300018075 | Groundwater Sediment | MQARTLHPWIARHIAVRTRLAQVGVSYLLFLMVVTRKHSLEEAARFSGLH |
Ga0184612_106212612 | 3300018078 | Groundwater Sediment | MLTGTLETWIKRHIAVRQRLERMCTSSLLFLMVVTTKHALE |
Ga0066662_108635752 | 3300018468 | Grasslands Soil | MPARTLQTWIARRISIRQRLERVCTSYLLFLMVVMQKHSLEEAARFSG |
Ga0066662_117848582 | 3300018468 | Grasslands Soil | MLAGTLHTWIKRHTAVRQRLERMCTSYLLFLMVATTKHSL |
Ga0066662_128108211 | 3300018468 | Grasslands Soil | MRTPTVQTWIARHILGRRRLENVCTSYLLFLMVVTRKHSLEEA |
Ga0190271_134110581 | 3300018481 | Soil | MQARTLQTWIVRRIAIRHRLERVCTRYLLFLMVVTTQHSLEEAARFSG |
Ga0184648_10284141 | 3300019249 | Groundwater Sediment | MLAGTLPTWLPRHMAVRQRLERICTSSLLFLMVVTTKHALAEAAR |
Ga0184646_16253421 | 3300019259 | Groundwater Sediment | MQARTLHTWIARHIAVRTRLAQVGVSYLLFLMVVTRKHSLEEAA |
Ga0179596_106991941 | 3300021086 | Vadose Zone Soil | MRARTLQTWIARRIGVRRRLERVCTSSLLFLMVVTTKHSL |
Ga0210087_10828382 | 3300025559 | Natural And Restored Wetlands | MRAQTVQTWIARQLFVRRRLANVCTSYLLFLMVVTTKHSLEEAAR |
Ga0207684_111905232 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTRTLQTWIARHIRVRLRLQQVCTSSLLFLMVVT |
Ga0207646_108230401 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAGTLQTWMTRRLSVRQRLERVCTSSLLFLMVVTTKHSLEQAARFSGLHTSL |
Ga0207665_108678241 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAGTLQTWIKRQIAVRQRLERVCTSYLLFLMVVTTKHSLQEAARFSGL |
Ga0207639_120025171 | 3300026041 | Corn Rhizosphere | MQACTLQTWIARRIALRQRLARVCTSYLLFLMENI |
Ga0208287_10084961 | 3300026044 | Natural And Restored Wetlands | MPAQTLQTWIARHTSVRLRLERVCTTYLLFLMVATTTKHSLE |
Ga0209237_12681392 | 3300026297 | Grasslands Soil | MLAGTIQTWITRRIAVRQRLERICTSYLLFLMVVTTKQSLEEAARF |
Ga0209803_13423761 | 3300026332 | Soil | MRTGTLHTWIKRHIAVRQRLERICTSYLLFLMVATTKHSLKEAARFSGL |
Ga0257157_10063513 | 3300026496 | Soil | MPAQTIKTWIARHISVRTRLEQVCVNSLLFLMVATQ |
Ga0209059_10764783 | 3300026527 | Soil | MLTGTLQTWIKRQIAVRQRLERVCTSYLLFLMVVTTKHSLQEAAR |
Ga0209898_10458291 | 3300027068 | Groundwater Sand | MHPHPLQTWVGRRIAVRTRLAQVCLSYLLFLMVVTRKHSLEEAARFS |
Ga0209897_10071141 | 3300027169 | Groundwater Sand | MPARTLQTWIARRLSIRQRLERVCTSYLLFLMVVMQKHSLED |
Ga0209875_10282831 | 3300027209 | Groundwater Sand | TWIARHIAVRTRLAQVGVSYLLFLMVVTRKHSLEEAARFSG |
Ga0214468_11622151 | 3300027647 | Soil | MQAQTFKTWIARRIAVPTRLQQVCVNYLLFLMVATRKHSFT |
Ga0209388_12000451 | 3300027655 | Vadose Zone Soil | MPARTLQTWVARHILVRLRLEIVCTSYLLFLMVVTTKHSL |
Ga0209689_14353361 | 3300027748 | Soil | MRARTLQTWIARHILVHRRLGSVCTSYLLFLMVVTTKHSLEEA |
Ga0209590_101188221 | 3300027882 | Vadose Zone Soil | MQARTLQTWIARRIAIRQRLERVCTSYLLFLMVVTQKHSLEEAARFSG |
Ga0209488_103957621 | 3300027903 | Vadose Zone Soil | MPAGTLHTWIKRHIAVRQRLERICTGYLLFLMVATTKHSLKEA |
Ga0207428_104272042 | 3300027907 | Populus Rhizosphere | MQTCTLQTWIARQIRLRRRLENVCTSYLLFLMVVTTKHALDNAARSSALHKSQ |
Ga0209857_10284931 | 3300027957 | Groundwater Sand | MPAQTLKTWITRHLSVRTRLEPICVTYLLFLMVTTPKHSFTQAARFSG |
Ga0137415_101574931 | 3300028536 | Vadose Zone Soil | MRARTLQTWIARRIGVRRRLERICTGYLLFLMVVTTKHSLEEAA |
Ga0307278_103499892 | 3300028878 | Soil | MQARTLHTWIARHIAVRTRLAQVGVSYLLFLMVVTRKHSLEEAARFAG |
Ga0307300_103488551 | 3300028880 | Soil | MQTRTLQTWIARRITIRHRLERVCTSYLLFLMVMTQKHSLEEAAR |
Ga0308197_102662151 | 3300031093 | Soil | MLAGPLQTWIKRQIAVRQRLERVCTSYLLFLMVVTTKH |
Ga0308193_10735501 | 3300031096 | Soil | MRARTLQTWIARRIGVRRRLERICTGYLLFLMVVTTKHSLEEAARFS |
Ga0308193_10946401 | 3300031096 | Soil | MQTRTLQTWIARRITIRHRLERVCTSYLLFLMVMTQKHSLEEAA |
Ga0308191_10243351 | 3300031098 | Soil | MRVQTVQTWIARHILVRLRLENVCTSYLLFLMVATRKHSLEEAARFSG |
Ga0308181_11555572 | 3300031099 | Soil | MQARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEE |
Ga0307499_101116291 | 3300031184 | Soil | MLAGTLQTWITRQIAVRQRLERICTSYLLFLMVATTKHSLEEASRFSGRH |
Ga0299913_116037861 | 3300031229 | Soil | MPAHTLSRWIARRIAVRNRLKQVCVSYLLFLMAVTQKHSLEEAA |
Ga0318538_108039792 | 3300031546 | Soil | MRALTVQTWIARHIAVRRRLEHICMSYLLFVMVVTTKH |
Ga0318528_100180324 | 3300031561 | Soil | MLTGTLHTWVTRHIAVRQRLERVCTSYVLFLMVATTKHSL |
Ga0318528_107309541 | 3300031561 | Soil | MLTGTLHTWVKRHIAVRQRLERVCTSYVLFLMVATTKHSLKEAARFS |
Ga0307469_123346381 | 3300031720 | Hardwood Forest Soil | MLAGTLHTWIKRHIAVRQRLERICTGYLLFLMVATTKHALKEAARFSGL |
Ga0306918_101323821 | 3300031744 | Soil | MPTRTLQTWITRRIALRQRLARVCTSYLLFLMVVTQKHSLEEAAR |
Ga0318548_104457932 | 3300031793 | Soil | MRALTVQTWIARHIAVRRRLEHICMSYLLFVMVVTTKHSLE |
Ga0318548_105471412 | 3300031793 | Soil | MLAGTLPTWIKRQIAVRQRLERICTSYLLFLMVATTKHSLKEA |
Ga0318557_100371013 | 3300031795 | Soil | MLTGTLHTWVKRHIAVRQRLERVCTSYVLFLMVATTKHSLTEAARFSGLHPS |
Ga0307410_121231372 | 3300031852 | Rhizosphere | MLAGTIQAWIKRRVAVRQRLERICTSYLLFLMVVTTRYSIEEA |
Ga0318495_100730703 | 3300031860 | Soil | MLTGTLHTWVTRHIAVRQRLERVCTSYVLFLMVATTKHSLTEAARF |
Ga0306919_100728441 | 3300031879 | Soil | MLAGPIQTWIKRRIAVRQRLERICTSYLLFLMVTTTKHSLEEAARFSGL |
Ga0306923_123115881 | 3300031910 | Soil | MRARTLQTWIARRIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARFAG |
Ga0310910_101056342 | 3300031946 | Soil | MLAGPIQTWIKRRIAVRQRLERICTSYLLFLMVTTTKH |
Ga0307415_1001353841 | 3300032126 | Rhizosphere | MSAGALHTWIKRHITVRQRLGRICTAYLLFLLVATSKHSLKEAARFS |
Ga0307471_1006080253 | 3300032180 | Hardwood Forest Soil | MSAYALHTWVARRISVRKRLTQVCVSYLLFLMVVTRKHSLEEAA |
Ga0307471_1036938791 | 3300032180 | Hardwood Forest Soil | MQARTLHSWIARHIGVRRRLERVCTSYLLFLMVVTTKHSLEEAARFSGR |
Ga0364946_009191_1302_1454 | 3300033815 | Sediment | MLAGTLQTWITRHIAVRQRLERICTSYLLFLMVVTTKHSLEVRQVALKRK |
Ga0334913_011916_1_111 | 3300034172 | Sub-Biocrust Soil | MQTRTVQTWIARQIRLRRRLENVCTSYLLFLMVVTTK |
Ga0314788_132386_289_459 | 3300034666 | Soil | VPDYTLRTWIARHIQVRQRLERVCTAYLLFLMVVTTKHTLEEAALIFRSACVNLDF |
Ga0314793_170800_1_141 | 3300034668 | Soil | MPDYTLRTWIARHIQVRQRLERVCTAYLLFLMVVTTKHTLEEAARFS |
⦗Top⦘ |