NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028017

Metagenome / Metatranscriptome Family F028017

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028017
Family Type Metagenome / Metatranscriptome
Number of Sequences 193
Average Sequence Length 41 residues
Representative Sequence YLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Number of Associated Samples 143
Number of Associated Scaffolds 193

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.75 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.373 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.399 % of family members)
Environment Ontology (ENVO) Unclassified
(26.943 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.596 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.88%    β-sheet: 22.06%    Coil/Unstructured: 72.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 193 Family Scaffolds
PF13302Acetyltransf_3 7.77
PF01636APH 2.07
PF07883Cupin_2 2.07
PF01098FTSW_RODA_SPOVE 2.07
PF07366SnoaL 2.07
PF00211Guanylate_cyc 1.55
PF04828GFA 1.55
PF06736TMEM175 1.04
PF12802MarR_2 1.04
PF00571CBS 1.04
PF00892EamA 1.04
PF14333DUF4389 1.04
PF01965DJ-1_PfpI 1.04
PF02518HATPase_c 1.04
PF02687FtsX 1.04
PF00368HMG-CoA_red 1.04
PF10604Polyketide_cyc2 1.04
PF00561Abhydrolase_1 1.04
PF00072Response_reg 0.52
PF00106adh_short 0.52
PF00756Esterase 0.52
PF13091PLDc_2 0.52
PF13561adh_short_C2 0.52
PF00293NUDIX 0.52
PF03551PadR 0.52
PF08281Sigma70_r4_2 0.52
PF00583Acetyltransf_1 0.52
PF08220HTH_DeoR 0.52
PF14022DUF4238 0.52
PF03681Obsolete Pfam Family 0.52
PF12680SnoaL_2 0.52
PF01019G_glu_transpept 0.52
PF00903Glyoxalase 0.52
PF13602ADH_zinc_N_2 0.52
PF03050DDE_Tnp_IS66 0.52
PF01209Ubie_methyltran 0.52
PF13189Cytidylate_kin2 0.52
PF03176MMPL 0.52
PF12146Hydrolase_4 0.52
PF03992ABM 0.52
PF01230HIT 0.52
PF00589Phage_integrase 0.52
PF10947DUF2628 0.52
PF01521Fe-S_biosyn 0.52
PF00248Aldo_ket_red 0.52
PF01061ABC2_membrane 0.52
PF13460NAD_binding_10 0.52
PF13673Acetyltransf_10 0.52
PF13649Methyltransf_25 0.52
PF01709Transcrip_reg 0.52
PF01872RibD_C 0.52
PF02746MR_MLE_N 0.52
PF12697Abhydrolase_6 0.52
PF08240ADH_N 0.52
PF07690MFS_1 0.52
PF00441Acyl-CoA_dh_1 0.52
PF01544CorA 0.52
PF13669Glyoxalase_4 0.52
PF00884Sulfatase 0.52
PF01047MarR 0.52
PF08530PepX_C 0.52
PF07040DUF1326 0.52
PF03466LysR_substrate 0.52
PF03807F420_oxidored 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 193 Family Scaffolds
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 2.07
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.55
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.55
COG1257Hydroxymethylglutaryl-CoA reductaseLipid transport and metabolism [I] 1.04
COG3548Uncharacterized membrane proteinFunction unknown [S] 1.04
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.04
COG0217Transcriptional and/or translational regulatory protein YebC/TACO1Translation, ribosomal structure and biogenesis [J] 0.52
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.52
COG0316Fe-S cluster assembly iron-binding protein IscAPosttranslational modification, protein turnover, chaperones [O] 0.52
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.52
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.52
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.52
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.52
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.52
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.52
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.52
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.52
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.52
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.52
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.52
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.52
COG3436TransposaseMobilome: prophages, transposons [X] 0.52
COG4841Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF familyFunction unknown [S] 0.52
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.89 %
UnclassifiedrootN/A3.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002G4KX2All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300004479|Ga0062595_100089732All Organisms → cellular organisms → Bacteria1591Open in IMG/M
3300004479|Ga0062595_101633256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300005184|Ga0066671_10028218All Organisms → cellular organisms → Bacteria2596Open in IMG/M
3300005329|Ga0070683_100910949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium843Open in IMG/M
3300005331|Ga0070670_100232192All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300005332|Ga0066388_102258771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes983Open in IMG/M
3300005337|Ga0070682_100128036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1714Open in IMG/M
3300005435|Ga0070714_100172817All Organisms → cellular organisms → Bacteria1962Open in IMG/M
3300005435|Ga0070714_100899164All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300005454|Ga0066687_10186623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1123Open in IMG/M
3300005526|Ga0073909_10459783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300005529|Ga0070741_11224269All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005530|Ga0070679_101770816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300005530|Ga0070679_101987131All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005536|Ga0070697_101099662All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300005540|Ga0066697_10435224All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300005549|Ga0070704_101702545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300005552|Ga0066701_10510235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300005561|Ga0066699_10644644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300005561|Ga0066699_11231553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300005569|Ga0066705_10568146All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005577|Ga0068857_100641949All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300005764|Ga0066903_101149843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1436Open in IMG/M
3300005764|Ga0066903_104680846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300005764|Ga0066903_105521713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium666Open in IMG/M
3300006031|Ga0066651_10506575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300006032|Ga0066696_10558186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300006058|Ga0075432_10253740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300006163|Ga0070715_10007085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3843Open in IMG/M
3300006163|Ga0070715_10496878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales697Open in IMG/M
3300006175|Ga0070712_100136177All Organisms → cellular organisms → Bacteria1868Open in IMG/M
3300006175|Ga0070712_101919365All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006579|Ga0074054_12180644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300006606|Ga0074062_12997004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales546Open in IMG/M
3300006791|Ga0066653_10638573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300006797|Ga0066659_11197133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300006806|Ga0079220_10061887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1810Open in IMG/M
3300006806|Ga0079220_10761169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300006806|Ga0079220_11691648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300006854|Ga0075425_100178069All Organisms → cellular organisms → Bacteria2441Open in IMG/M
3300006854|Ga0075425_100926759All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300006854|Ga0075425_101514087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300006854|Ga0075425_103058637All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006904|Ga0075424_102862847All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300009012|Ga0066710_100538395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1765Open in IMG/M
3300009038|Ga0099829_11106603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300009092|Ga0105250_10226392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae794Open in IMG/M
3300009093|Ga0105240_11423711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300009094|Ga0111539_10884791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300009098|Ga0105245_11475730All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300009101|Ga0105247_10396524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium982Open in IMG/M
3300009137|Ga0066709_100265923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae2307Open in IMG/M
3300009137|Ga0066709_103638727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300009147|Ga0114129_12327552All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300009148|Ga0105243_11550160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300009148|Ga0105243_12026190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300009156|Ga0111538_12140895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300009162|Ga0075423_10155562All Organisms → cellular organisms → Bacteria2400Open in IMG/M
3300009162|Ga0075423_10999345All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300009176|Ga0105242_12262652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300009545|Ga0105237_11282236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium739Open in IMG/M
3300009553|Ga0105249_12719755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300010136|Ga0127447_1177988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300010322|Ga0134084_10452633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300010326|Ga0134065_10335983All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300010358|Ga0126370_12556789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300010359|Ga0126376_11674278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300010360|Ga0126372_12400824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300010366|Ga0126379_10733146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1084Open in IMG/M
3300010366|Ga0126379_11526847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300010366|Ga0126379_13546696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300010371|Ga0134125_12698547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300010373|Ga0134128_10132581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2822Open in IMG/M
3300010373|Ga0134128_10158989All Organisms → cellular organisms → Bacteria2553Open in IMG/M
3300010373|Ga0134128_11091820All Organisms → cellular organisms → Bacteria → Terrabacteria group881Open in IMG/M
3300010375|Ga0105239_10719114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1142Open in IMG/M
3300010375|Ga0105239_11187445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium879Open in IMG/M
3300010396|Ga0134126_10481773All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300010396|Ga0134126_10671028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1180Open in IMG/M
3300010396|Ga0134126_11511979Not Available740Open in IMG/M
3300010398|Ga0126383_12934416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300010398|Ga0126383_13580619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300010399|Ga0134127_11209238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia823Open in IMG/M
3300010403|Ga0134123_10223853All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300011119|Ga0105246_10662051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium910Open in IMG/M
3300011119|Ga0105246_12588890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300012198|Ga0137364_10603545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium827Open in IMG/M
3300012200|Ga0137382_10213265All Organisms → Viruses → Predicted Viral1330Open in IMG/M
3300012208|Ga0137376_10190848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1771Open in IMG/M
3300012211|Ga0137377_11158951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300012211|Ga0137377_11553056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300012285|Ga0137370_10537314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300012285|Ga0137370_10683212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300012349|Ga0137387_10217091All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300012349|Ga0137387_10734124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300012896|Ga0157303_10158639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300012911|Ga0157301_10293488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300012943|Ga0164241_10705822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300012958|Ga0164299_11056294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300012958|Ga0164299_11358741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300012961|Ga0164302_10339336All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300012971|Ga0126369_10526135All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300012975|Ga0134110_10389688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300012984|Ga0164309_10203996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1362Open in IMG/M
3300012984|Ga0164309_10307010All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300012984|Ga0164309_10679995All Organisms → cellular organisms → Bacteria → Terrabacteria group814Open in IMG/M
3300012984|Ga0164309_10714177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium797Open in IMG/M
3300012985|Ga0164308_12012794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300012987|Ga0164307_10411202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1000Open in IMG/M
3300012987|Ga0164307_10469962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides guangzhouensis943Open in IMG/M
3300013104|Ga0157370_11377631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus635Open in IMG/M
3300013105|Ga0157369_10450098All Organisms → cellular organisms → Bacteria → Terrabacteria group1333Open in IMG/M
3300013296|Ga0157374_11369586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300013297|Ga0157378_13262209All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300013307|Ga0157372_10489529All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300013307|Ga0157372_11826451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300014150|Ga0134081_10097300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium924Open in IMG/M
3300014150|Ga0134081_10283984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300014325|Ga0163163_10351842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1529Open in IMG/M
3300014325|Ga0163163_10376665All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300014325|Ga0163163_12794210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300014968|Ga0157379_12380093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300015077|Ga0173483_10307730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia779Open in IMG/M
3300015077|Ga0173483_10310661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300015356|Ga0134073_10195424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300015371|Ga0132258_10806899All Organisms → cellular organisms → Bacteria2366Open in IMG/M
3300015372|Ga0132256_102699764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300015373|Ga0132257_100140148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2825Open in IMG/M
3300015373|Ga0132257_100258654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2081Open in IMG/M
3300015373|Ga0132257_101903393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300015374|Ga0132255_100291191All Organisms → cellular organisms → Bacteria2347Open in IMG/M
3300015374|Ga0132255_101705242All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300015374|Ga0132255_102616400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14771Open in IMG/M
3300017966|Ga0187776_10335502Not Available993Open in IMG/M
3300018032|Ga0187788_10504433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300018064|Ga0187773_11017175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300018433|Ga0066667_10205069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1453Open in IMG/M
3300018433|Ga0066667_10808464Not Available798Open in IMG/M
3300018433|Ga0066667_10956391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium738Open in IMG/M
3300018468|Ga0066662_12139234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300018482|Ga0066669_11243701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300019767|Ga0190267_10059590All Organisms → cellular organisms → Bacteria → Terrabacteria group1351Open in IMG/M
3300025898|Ga0207692_10585636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300025899|Ga0207642_10134406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1295Open in IMG/M
3300025904|Ga0207647_10676439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300025905|Ga0207685_10011874All Organisms → cellular organisms → Bacteria2638Open in IMG/M
3300025910|Ga0207684_10592702All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300025915|Ga0207693_10387647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1092Open in IMG/M
3300025915|Ga0207693_10799285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300025916|Ga0207663_11497145All Organisms → cellular organisms → Bacteria → Terrabacteria group543Open in IMG/M
3300025919|Ga0207657_10710016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300025922|Ga0207646_10205069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1781Open in IMG/M
3300025923|Ga0207681_11084012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300025927|Ga0207687_10287238All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300025927|Ga0207687_11070446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300025927|Ga0207687_11872130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium513Open in IMG/M
3300025929|Ga0207664_10625997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium967Open in IMG/M
3300025939|Ga0207665_11464234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300025944|Ga0207661_10316784Not Available1401Open in IMG/M
3300025960|Ga0207651_10938210Not Available772Open in IMG/M
3300025972|Ga0207668_10450577All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300026078|Ga0207702_12124029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300026121|Ga0207683_11833842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300026295|Ga0209234_1043381All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300026532|Ga0209160_1340892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300026542|Ga0209805_1290464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300026548|Ga0209161_10486281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium545Open in IMG/M
3300027465|Ga0207626_102677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300027821|Ga0209811_10010630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2957Open in IMG/M
3300027842|Ga0209580_10203345All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300028790|Ga0307283_10045066Not Available1034Open in IMG/M
3300031184|Ga0307499_10161394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta665Open in IMG/M
3300031544|Ga0318534_10408885All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300031682|Ga0318560_10695294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300031716|Ga0310813_11492652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus629Open in IMG/M
3300031716|Ga0310813_11803585All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300031716|Ga0310813_12320050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300031765|Ga0318554_10262703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium983Open in IMG/M
3300031778|Ga0318498_10486849All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300031832|Ga0318499_10419661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300031847|Ga0310907_10313420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300031858|Ga0310892_10355308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium941Open in IMG/M
3300031879|Ga0306919_11533661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300031890|Ga0306925_10508599All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300031938|Ga0308175_100160428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2168Open in IMG/M
3300031939|Ga0308174_11557620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300031939|Ga0308174_11692002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300031944|Ga0310884_10470366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300032075|Ga0310890_10345239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300032180|Ga0307471_103326309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300033412|Ga0310810_11448557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300034268|Ga0372943_0159256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1378Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.25%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.18%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.11%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.59%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.04%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.04%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010136Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027465Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_100728502170459003Grass SoilFGCYLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0062595_10008973213300004479SoilLRSQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPAHI*
Ga0062595_10163325613300004479SoilYLRSQPRGMIVLTLNGSKVDEITFFADPALVGRFGLPEHI*
Ga0066671_1002821863300005184SoilPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070683_10091094923300005329Corn RhizosphereFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI*
Ga0070670_10023219213300005331Switchgrass RhizosphereLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066388_10225877143300005332Tropical Forest SoilAFGCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPAHI*
Ga0070682_10012803613300005337Corn RhizosphereGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070714_10017281723300005435Agricultural SoilFGCYLRSQPWGMMVLALSGSKVDEITLFVDPALPSRFGLPEHI*
Ga0070714_10089916413300005435Agricultural SoilYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066687_1018662313300005454SoilYYLRSQPRGMMVLTLSGSKVDEITYFADPALPGRFGLPEYI*
Ga0073909_1045978313300005526Surface SoilLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI*
Ga0070741_1122426923300005529Surface SoilAQPWGMIVLTLSGRKVDEMTFFADPALPVRFGLPEHI*
Ga0070679_10177081633300005530Corn RhizosphereAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFDLPEHI*
Ga0070679_10198713123300005530Corn RhizosphereFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070697_10109966223300005536Corn, Switchgrass And Miscanthus RhizosphereRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHIQPTRMGST*
Ga0066697_1043522413300005540SoilYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070704_10170254513300005549Corn, Switchgrass And Miscanthus RhizosphereAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066701_1051023513300005552SoilSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066699_1064464423300005561SoilQPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPTLPGRFGLPEHI*
Ga0066699_1123155313300005561SoilRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066705_1056814613300005569SoilRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0068857_10064194933300005577Corn RhizosphereQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066903_10114984333300005764Tropical Forest SoilCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPERI*
Ga0066903_10468084613300005764Tropical Forest SoilGCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPAHI*
Ga0066903_10552171313300005764Tropical Forest SoilCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPEHI*
Ga0066651_1050657513300006031SoilSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066696_1055818613300006032SoilPAFGYYLRSRPRGMMVLTLSGSKVDEITFFADPALPGRLGLPEQI*
Ga0075432_1025374023300006058Populus RhizosphereYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHIEPTRMGST*
Ga0070715_1000708583300006163Corn, Switchgrass And Miscanthus RhizosphereQPAFGCYLRSQPWGMMVLTLSGSKVDEITYFADPSLPGRFGLPEHI*
Ga0070715_1049687813300006163Corn, Switchgrass And Miscanthus RhizosphereLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0070712_10013617713300006175Corn, Switchgrass And Miscanthus RhizospherePWGMIVLTLSGSKVDEITFFADPALLGRFGLPEHI*
Ga0070712_10191936523300006175Corn, Switchgrass And Miscanthus RhizosphereFGYYLRSQPRGMMVLTLSGSKVDEITFFADPSLPGRFGLPEHI*
Ga0074054_1218064413300006579SoilRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI*
Ga0074062_1299700423300006606SoilAFGCYLRSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI*
Ga0066653_1063857313300006791SoilNGQPAFGYYLRSQPRGMMVLALSGSKVDEITFFADPALPGRFGLPEHI*
Ga0066659_1119713313300006797SoilSRPRGMMVLTLSGSKVDQITFFADPALPGRFGLPQHI*
Ga0079220_1006188713300006806Agricultural SoilPEGMMVLTLSGSRVDEITFFADPALPGRFGLPEHL*
Ga0079220_1076116913300006806Agricultural SoilFGYYLRSQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI*
Ga0079220_1169164813300006806Agricultural SoilQPAFGYYVRSQPRGVIVLTLSGNKVAHMTFFDDPALPGRFGLPEHI*
Ga0075425_10017806913300006854Populus RhizosphereRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPAHI*
Ga0075425_10092675913300006854Populus RhizosphereSQPRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI*
Ga0075425_10151408713300006854Populus RhizosphereSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0075425_10305863723300006854Populus RhizosphereRGIMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0075424_10286284713300006904Populus RhizosphereAFGYYFRSQPRGMIVLTLSGSKVAHITFFDDPALPGRFGLPEHI*
Ga0066710_10053839513300009012Grasslands SoilGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI
Ga0099829_1110660323300009038Vadose Zone SoilRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI*
Ga0105250_1022639223300009092Switchgrass RhizosphereGQPAFGYYLHSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI*
Ga0105240_1142371123300009093Corn RhizosphereLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI*
Ga0111539_1088479113300009094Populus RhizospherePRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0105245_1147573023300009098Miscanthus RhizosphereLRSQPWGMMVLTLSGSKVDEITLFIDPGLPGRFGLPEHI*
Ga0105247_1039652413300009101Switchgrass RhizosphereSQAWGMMVLTLSGSKVDQITFFADPALPGRFGLPEHI*
Ga0066709_10026592313300009137Grasslands SoilFGYYVRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI*
Ga0066709_10363872713300009137Grasslands SoilQPRGMMVLTLSGSKVDEITFFADPALPRRFGLPEAF*
Ga0114129_1232755213300009147Populus RhizospherePRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI*
Ga0105243_1155016023300009148Miscanthus RhizosphereSQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI*
Ga0105243_1202619013300009148Miscanthus RhizosphereYLRSQPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0111538_1214089523300009156Populus RhizosphereWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0075423_1015556213300009162Populus RhizosphereSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPAHI*
Ga0075423_1099934523300009162Populus RhizosphereRSQPRGMMVLTLSGSNVDEITFFADPALPGRFGLPEHI*
Ga0105242_1226265223300009176Miscanthus RhizosphereRSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0105237_1128223613300009545Corn RhizosphereGQPAFGCYLRSQPWGMMVLALSGSKIDEITLFADPALPGHFGLPEHI*
Ga0105249_1271975513300009553Switchgrass RhizosphereRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0127447_117798823300010136Grasslands SoilYYLRAQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134084_1045263323300010322Grasslands SoilSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPKHI*
Ga0134065_1033598313300010326Grasslands SoilPAFAYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0126370_1255678913300010358Tropical Forest SoilAFGCYLRSQPWGMMVLTLSGSQVDEITFFADPGLPGRFGLPEHI*
Ga0126376_1167427833300010359Tropical Forest SoilGCYLRSQPWAMMVLTLSGSKVDEITFFADPVLPGRFGLPDHI*
Ga0126372_1240082423300010360Tropical Forest SoilWGMMVLTLSGSKVDQITFFADPALPGRFGLPEHL*
Ga0126379_1073314633300010366Tropical Forest SoilAFGCYLRSQPWGMLVLALSGSKVDEITFFADPALPGRFGLPEHI*
Ga0126379_1152684713300010366Tropical Forest SoilYLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI*
Ga0126379_1354669613300010366Tropical Forest SoilQPAFACYLRSQPWGMIVLTLSGSKVDEITFFIDPALPARFGLPEPI*
Ga0134125_1269854713300010371Terrestrial SoilPAFGYYLRSQPRGMMVLTLSGGKVDEITFFADPALPGRFGLPEHI*
Ga0134128_1013258113300010373Terrestrial SoilPAFGYYLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI*
Ga0134128_1015898943300010373Terrestrial SoilYLRSQPWGMIVLRLSGNKVDEITFFADPALPGRFALPGHI*
Ga0134128_1109182013300010373Terrestrial SoilSEPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0105239_1071911413300010375Corn RhizospherePAFGCYLRSQPWGMVVLTLSGSKVDEITFFIDPALPGRFGLPKHI*
Ga0105239_1118744533300010375Corn RhizosphereRGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134126_1048177313300010396Terrestrial SoilYLRSQPRGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI*
Ga0134126_1067102813300010396Terrestrial SoilQPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134126_1151197923300010396Terrestrial SoilSDPGNGQPAFGYHLRSQPRGMVVLTLGGSKGDEITFFADPALPGRFGLPEQV*
Ga0126383_1293441613300010398Tropical Forest SoilQPAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0126383_1358061923300010398Tropical Forest SoilFGCYLRSQPWGMMVLTLSGSKVDEITLFADPALLGRFGLPEHI*
Ga0134127_1120923823300010399Terrestrial SoilGQPAFGYYLRSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134123_1022385313300010403Terrestrial SoilYLHSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI*
Ga0105246_1066205113300011119Miscanthus RhizosphereGQPAFGCYLRSQPWGMMVLTLSGSQVDEITFFADPALPGRFGLPEHI*
Ga0105246_1258889013300011119Miscanthus RhizosphereFGCYLRSQPWGMMVLTLSGSKVDEITLFIDPALPGRFGLPEHI*
Ga0137364_1060354513300012198Vadose Zone SoilPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0137382_1021326513300012200Vadose Zone SoilSQPRGMMVLTLSGSKVDEITFFADPALPGRLGLPEHI*
Ga0137376_1019084843300012208Vadose Zone SoilRSQPRGMMVLALSGSKVEEITFFADPALPGRFGLPEHI*
Ga0137377_1115895113300012211Vadose Zone SoilPAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0137377_1155305613300012211Vadose Zone SoilRSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0137370_1053731413300012285Vadose Zone SoilRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0137370_1068321223300012285Vadose Zone SoilFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI*
Ga0137387_1021709113300012349Vadose Zone SoilYNIRSRTRGMLLLTPSGSKDDEITFFADPAQPGRFGLPEHI*
Ga0137387_1073412433300012349Vadose Zone SoilRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0157303_1015863913300012896SoilYVRSQPLGMMVLTLSGSKVDEITLFADPALPGRFGLPEHI*
Ga0157301_1029348813300012911SoilYLRSQPRGMMVLTLSGSKVDDITFFADPALPGRFGLPEHI*
Ga0164241_1070582223300012943SoilYLRSQPWGMMVLTLSGSKVDEITFFADAALPGRFGLPEHI*
Ga0164299_1105629413300012958SoilPAFGYYLRSKPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI*
Ga0164299_1135874113300012958SoilQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI*
Ga0164302_1033933623300012961SoilPWGMMVLTLSGSKVDEITFFADTALPSRFGLPEHI*
Ga0126369_1052613513300012971Tropical Forest SoilRSQPWGMIVLTLSGSKVDEITFFIDPALPRRFGLPEHI*
Ga0134110_1038968813300012975Grasslands SoilGYYLRSRPRGMMLLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0164309_1020399643300012984SoilFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI*
Ga0164309_1030701023300012984SoilCYLRSQPWGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI*
Ga0164309_1067999513300012984SoilPWGMMVLTLSGSTVDEITFFIDPALPCRFGLPEHI*
Ga0164309_1071417713300012984SoilGQPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0164308_1201279413300012985SoilNGQPAFGYYVRSQPRGMMVLTLSGSEVDEITFFADPALPGRFGLPEHI*
Ga0164307_1041120213300012987SoilPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI*
Ga0164307_1046996213300012987SoilPRGLMVLTLSGSKVDEITFFADPALPGRFDLPEHI*
Ga0157370_1137763123300013104Corn RhizosphereSQPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0157369_1045009823300013105Corn RhizosphereLRSQPWGMIVLTLSGNKVDEITFFADPALPGRFGLPGHI*
Ga0157374_1136958613300013296Miscanthus RhizosphereQPWGMVVLTLSSSEVDGITFFADPALPGRFGLPEHI*
Ga0157378_1326220923300013297Miscanthus RhizosphereWGMMVLTLSGRKVDEITLFIDPALPGRFGLPEHI*
Ga0157372_1048952943300013307Corn RhizospherePRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0157372_1182645133300013307Corn RhizosphereWGMMVLTLSGSKVDEITLFIDPGLPGRFGLPEHI*
Ga0134081_1009730013300014150Grasslands SoilYLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0134081_1028398423300014150Grasslands SoilQPAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPKHI*
Ga0163163_1035184243300014325Switchgrass RhizosphereYYLRSQPRGMMVLTLRGSKVDEITFFADPALLGRFGLPEHL*
Ga0163163_1037666513300014325Switchgrass RhizosphereAFGYYLRSQPRGMMVLTLSGSRVDEITFFADPALPGRFGLPEHI*
Ga0163163_1279421023300014325Switchgrass RhizosphereRSQPWGMMVLTLSGSKVDEITLFIDPALPGRFGLPEHI*
Ga0157379_1238009323300014968Switchgrass RhizospherePAFGYYLRSQPRGMMVLTLSGQEVDEITFFADPALPGRFGLPEHI*
Ga0173483_1030773013300015077SoilWGMMALTLSGSKVDEITFFIDPALPGRFDLPEHI*
Ga0173483_1031066123300015077SoilGCYLRSQPWGMMVLTLSGSKVDEITFFANPALPGRFGLPEHI*
Ga0134073_1019542413300015356Grasslands SoilSFGYYLRSQPQGLMVLTLSGSEIDEITFFADPALPGRFGLPEHI*
Ga0132258_1080689913300015371Arabidopsis RhizosphereAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLREHI*
Ga0132256_10269976413300015372Arabidopsis RhizosphereAYYLRSQSRGVMVLTLSGSKVADITFFADPTLPGRFGLPEHI*
Ga0132257_10014014863300015373Arabidopsis RhizosphereYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0132257_10025865413300015373Arabidopsis RhizosphereCYLRSRPWGMIVLTLSGSKVDEITLFADPALPGRFGLPEHI*
Ga0132257_10190339323300015373Arabidopsis RhizosphereGQPAFGCYLRSEPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0132255_10029119153300015374Arabidopsis RhizosphereRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLREHI*
Ga0132255_10170524223300015374Arabidopsis RhizospherePAFGYYLRSRPRGMMVLTVSGSKGDEITFFADPALPSRFGLPEHI*
Ga0132255_10261640033300015374Arabidopsis RhizosphereAFCCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI*
Ga0187776_1033550213300017966Tropical PeatlandPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHV
Ga0187788_1050443313300018032Tropical PeatlandFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0187773_1101717513300018064Tropical PeatlandAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0066667_1020506933300018433Grasslands SoilGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0066667_1080846423300018433Grasslands SoilRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0066667_1095639123300018433Grasslands SoilRSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0066662_1213923413300018468Grasslands SoilGQPAFAYYVRAQARGMIVLALSGGEIDEMTYFADPALPARFGLPERI
Ga0066669_1124370123300018482Grasslands SoilGQPAFACYLRSQPWGMIVLTLSGSKIDEITFFADPALPGRFGLPEHI
Ga0190267_1005959023300019767SoilQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207692_1058563623300025898Corn, Switchgrass And Miscanthus RhizospherePAFGYYVRSQPRGIMVLTLSGNKVDGITFFADAALPGRFGLPEHI
Ga0207642_1013440613300025899Miscanthus RhizosphereLRSEPRGLMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207647_1067643913300025904Corn RhizosphereAFGCYLRSQPWGMVVLTLSGSKVDEITFFIDPALPGRFGLPKHI
Ga0207685_1001187453300025905Corn, Switchgrass And Miscanthus RhizosphereLRSQPWGMMVLTLSGSKVDEITFFADPSLPGRFGLPEHI
Ga0207684_1059270233300025910Corn, Switchgrass And Miscanthus RhizosphereGCYLRSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI
Ga0207693_1038764733300025915Corn, Switchgrass And Miscanthus RhizosphereYLRSQPWGMIVLTLSGSKVDEITFFADPALLGRFGLPEHI
Ga0207693_1079928513300025915Corn, Switchgrass And Miscanthus RhizosphereYLRSQAWGMMVLTLSGSKVDEITLFADPTLAGRFGLPARI
Ga0207663_1149714513300025916Corn, Switchgrass And Miscanthus RhizosphereRSQPWGMMVLTLSGSTVDEITFFIDPALPGRFGLPEHI
Ga0207657_1071001633300025919Corn RhizosphereYLRSQPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207646_1020506913300025922Corn, Switchgrass And Miscanthus RhizosphereGQPALGYYLRSRPRGMIVLTLSGSKVDEITFFADPALPGRFGLPEQI
Ga0207681_1108401223300025923Switchgrass RhizosphereLRSQPRGMMVLTLSGKKVDKITFFADPALPGRFGLPEHI
Ga0207687_1028723813300025927Miscanthus RhizosphereAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207687_1107044613300025927Miscanthus RhizospherePAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0207687_1187213023300025927Miscanthus RhizosphereCYLRSQPWGMIVLTLSGSKVDEITLFADPALPGRFGLPKHI
Ga0207664_1062599713300025929Agricultural SoilPAFGYYVRSQPRGMMVLTLSGNKVDGITFFADPALPGRFGLPEHI
Ga0207665_1146423423300025939Corn, Switchgrass And Miscanthus RhizospherePAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHL
Ga0207661_1031678423300025944Corn RhizosphereRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHL
Ga0207651_1093821013300025960Switchgrass RhizosphereYLRSQPSGMMVLTLSSSKVDEITFFADPALPVRFGLPEHI
Ga0207668_1045057713300025972Switchgrass RhizosphereHSQPGGMMVLTLSGSKVDKITFFADPALPGRFGLPEHI
Ga0207702_1212402923300026078Corn RhizosphereQPRGMIVLTLSGSKVAHITFFDDPALPGRFGLPEHI
Ga0207683_1183384223300026121Miscanthus RhizospherePWGMVVLTLSSSKVDGITFFADPALPGRFGLPEHI
Ga0209234_104338113300026295Grasslands SoilYYLRSQPRGMMVLTLSGSKVDEITFFADPALPSRFGLPEHI
Ga0209160_134089213300026532SoilRSRPRGMMVLTLNGSKVDEITFFADPALPRRFGLPEHI
Ga0209805_129046413300026542SoilQPRGMMVLTLSGNKVDEITFFADPALPGRFGLPEHI
Ga0209161_1048628123300026548SoilSQPRGMMVLTLSGSKVEEITFFADPALPGRFGLPEHI
Ga0207626_10267713300027465SoilQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPERI
Ga0209811_1001063053300027821Surface SoilPRGMMVLTLSGSKVDEITFFADPALPGRFGLPGHI
Ga0209580_1020334523300027842Surface SoilLRAQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0307283_1004506623300028790SoilSEPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0307499_1016139413300031184SoilRSQPWGMMVLTLSGSKVDEITFFIDPALPGRFGLPEHI
Ga0318534_1040888513300031544SoilYLRSQPWGMVVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0318560_1069529413300031682SoilQPRGMMVLTLSGSKVCEITFFADPALPGRFGLPEHI
Ga0310813_1149265213300031716SoilLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0310813_1180358513300031716SoilPWGVIVLTLSGTTIDEITLFADPALLGRFGLPDHI
Ga0310813_1232005023300031716SoilQPAFGCYLRSQAWGMMVLTLSGSKVDEITLFADPTLAGRFGLPARI
Ga0318554_1026270313300031765SoilCYLRSQPWGMMVLTLSGSKVDEITLFADPALPGRFGLPERI
Ga0318498_1048684913300031778SoilPRGMLVLTLSGSKVCEITFFADPALPGRFGLPEHI
Ga0318499_1041966123300031832SoilYLHSQPRGIMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0310907_1031342013300031847SoilYLRSQPRGMMVLTLSGSKVDAITFFADPALPGRFGLPEHI
Ga0310892_1035530823300031858SoilGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPGRFGLPERI
Ga0306919_1153366113300031879SoilFGCYLRSQPWGMMVLTLSGSKVDEITLFADPALLARFGLPEHI
Ga0306925_1050859913300031890SoilRSQPRGMMVLTLSGSKVCEITFFADPALPRRFGLPEHI
Ga0308175_10016042813300031938SoilPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEQI
Ga0308174_1155762023300031939SoilAFGCYLRSQPWGMMVLTLSGSKVDEITFFADPALPRRFGLPEHI
Ga0308174_1169200213300031939SoilRSQPWGMIVLTLSGSKVDEITFFADPALPGRFGLPEQI
Ga0310884_1047036613300031944SoilQPAFGYYLRSQPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0310890_1034523913300032075SoilFGYYLRSQPRGIIVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0307471_10332630913300032180Hardwood Forest SoilGYYLRSRPRGMMVLTLSGSKVDEITFFADPALPGRFGLPEHI
Ga0310810_1144855713300033412SoilPAFGYYLRSQPRGMMVLTLSGNKVDEITFFADPALPGRFSLPEHI
Ga0372943_0159256_3_1673300034268SoilQPAFGYYLRSEPQGMIVLTLSGSTVDKITFFADPALPGRFGLPDHIYSNPGANL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.