Basic Information | |
---|---|
Family ID | F027953 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 193 |
Average Sequence Length | 43 residues |
Representative Sequence | PAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN |
Number of Associated Samples | 164 |
Number of Associated Scaffolds | 193 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.52 % |
% of genes near scaffold ends (potentially truncated) | 98.96 % |
% of genes from short scaffolds (< 2000 bps) | 96.37 % |
Associated GOLD sequencing projects | 153 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.694 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.617 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.979 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.150 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.14% β-sheet: 14.29% Coil/Unstructured: 68.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 193 Family Scaffolds |
---|---|---|
PF01345 | DUF11 | 1.55 |
PF09351 | DUF1993 | 0.52 |
PF17210 | SdrD_B | 0.52 |
PF01618 | MotA_ExbB | 0.52 |
PF02472 | ExbD | 0.52 |
COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
---|---|---|---|
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.69 % |
All Organisms | root | All Organisms | 37.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY01CLY0D | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_14372052 | Not Available | 688 | Open in IMG/M |
3300002560|JGI25383J37093_10175024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300002562|JGI25382J37095_10050647 | Not Available | 1598 | Open in IMG/M |
3300002562|JGI25382J37095_10155317 | Not Available | 740 | Open in IMG/M |
3300002910|JGI25615J43890_1014257 | Not Available | 1298 | Open in IMG/M |
3300004114|Ga0062593_102533342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300004157|Ga0062590_101366312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300004643|Ga0062591_101658891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300004643|Ga0062591_102672458 | Not Available | 527 | Open in IMG/M |
3300005332|Ga0066388_106219117 | Not Available | 603 | Open in IMG/M |
3300005356|Ga0070674_100547811 | Not Available | 970 | Open in IMG/M |
3300005437|Ga0070710_11382193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300005518|Ga0070699_100355276 | Not Available | 1321 | Open in IMG/M |
3300005535|Ga0070684_100517466 | Not Available | 1106 | Open in IMG/M |
3300005557|Ga0066704_10144064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1594 | Open in IMG/M |
3300005558|Ga0066698_10332349 | Not Available | 1051 | Open in IMG/M |
3300005558|Ga0066698_10723650 | Not Available | 653 | Open in IMG/M |
3300005566|Ga0066693_10401604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300005568|Ga0066703_10355717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
3300005568|Ga0066703_10510305 | Not Available | 712 | Open in IMG/M |
3300005575|Ga0066702_10377793 | Not Available | 863 | Open in IMG/M |
3300005576|Ga0066708_10637297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300005586|Ga0066691_10907187 | Not Available | 518 | Open in IMG/M |
3300005829|Ga0074479_10059686 | Not Available | 559 | Open in IMG/M |
3300005950|Ga0066787_10012182 | Not Available | 1392 | Open in IMG/M |
3300006034|Ga0066656_10662257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300006046|Ga0066652_101558523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300006173|Ga0070716_101265245 | Not Available | 595 | Open in IMG/M |
3300006176|Ga0070765_101831722 | Not Available | 569 | Open in IMG/M |
3300006237|Ga0097621_102251169 | Not Available | 521 | Open in IMG/M |
3300006358|Ga0068871_101060936 | Not Available | 756 | Open in IMG/M |
3300006804|Ga0079221_10370782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
3300006844|Ga0075428_102659205 | Not Available | 510 | Open in IMG/M |
3300006845|Ga0075421_100136041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3077 | Open in IMG/M |
3300006954|Ga0079219_10240237 | Not Available | 1067 | Open in IMG/M |
3300006954|Ga0079219_11129886 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300007265|Ga0099794_10202824 | Not Available | 1016 | Open in IMG/M |
3300009012|Ga0066710_100786595 | Not Available | 1457 | Open in IMG/M |
3300009088|Ga0099830_11440050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300009089|Ga0099828_10992510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300009090|Ga0099827_11755966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300009091|Ga0102851_10078825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2775 | Open in IMG/M |
3300009100|Ga0075418_11269448 | Not Available | 798 | Open in IMG/M |
3300009137|Ga0066709_103786829 | Not Available | 549 | Open in IMG/M |
3300009147|Ga0114129_10770684 | Not Available | 1230 | Open in IMG/M |
3300009792|Ga0126374_11405051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300010046|Ga0126384_10222674 | Not Available | 1508 | Open in IMG/M |
3300010047|Ga0126382_10517479 | Not Available | 963 | Open in IMG/M |
3300010048|Ga0126373_12557583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300010304|Ga0134088_10372984 | Not Available | 694 | Open in IMG/M |
3300010321|Ga0134067_10221818 | Not Available | 702 | Open in IMG/M |
3300010329|Ga0134111_10059759 | Not Available | 1401 | Open in IMG/M |
3300010358|Ga0126370_11290423 | Not Available | 684 | Open in IMG/M |
3300010358|Ga0126370_11619537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300010359|Ga0126376_12819463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300010361|Ga0126378_12448566 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010361|Ga0126378_12552093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300010362|Ga0126377_11071776 | Not Available | 874 | Open in IMG/M |
3300010362|Ga0126377_11314041 | Not Available | 795 | Open in IMG/M |
3300010362|Ga0126377_12877503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300010366|Ga0126379_11262524 | Not Available | 845 | Open in IMG/M |
3300010366|Ga0126379_11328365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300010366|Ga0126379_12172817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300010366|Ga0126379_13862190 | Not Available | 502 | Open in IMG/M |
3300010373|Ga0134128_11095695 | Not Available | 879 | Open in IMG/M |
3300010376|Ga0126381_100455401 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
3300010398|Ga0126383_11157116 | Not Available | 863 | Open in IMG/M |
3300010398|Ga0126383_13210025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300010403|Ga0134123_12817751 | Not Available | 555 | Open in IMG/M |
3300010403|Ga0134123_13112873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300011269|Ga0137392_11140462 | Not Available | 637 | Open in IMG/M |
3300011271|Ga0137393_11324457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300011413|Ga0137333_1126704 | Not Available | 589 | Open in IMG/M |
3300011429|Ga0137455_1193943 | Not Available | 606 | Open in IMG/M |
3300011440|Ga0137433_1155058 | Not Available | 738 | Open in IMG/M |
3300012096|Ga0137389_11832174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300012163|Ga0137355_1112233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300012189|Ga0137388_11671060 | Not Available | 571 | Open in IMG/M |
3300012202|Ga0137363_10552682 | Not Available | 970 | Open in IMG/M |
3300012202|Ga0137363_11306581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300012202|Ga0137363_11701463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300012205|Ga0137362_10767757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300012356|Ga0137371_10703577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300012357|Ga0137384_10887106 | Not Available | 719 | Open in IMG/M |
3300012359|Ga0137385_11000851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300012360|Ga0137375_11188912 | Not Available | 585 | Open in IMG/M |
3300012532|Ga0137373_11048290 | Not Available | 587 | Open in IMG/M |
3300012917|Ga0137395_10477457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
3300012917|Ga0137395_10945828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300012918|Ga0137396_10899898 | Not Available | 649 | Open in IMG/M |
3300012918|Ga0137396_10901978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300012922|Ga0137394_11613004 | Not Available | 505 | Open in IMG/M |
3300012923|Ga0137359_10419967 | Not Available | 1185 | Open in IMG/M |
3300012930|Ga0137407_10526219 | Not Available | 1106 | Open in IMG/M |
3300012930|Ga0137407_10619441 | Not Available | 1016 | Open in IMG/M |
3300012948|Ga0126375_10525302 | Not Available | 888 | Open in IMG/M |
3300012972|Ga0134077_10165103 | Not Available | 889 | Open in IMG/M |
3300014165|Ga0181523_10776910 | Not Available | 522 | Open in IMG/M |
3300014326|Ga0157380_12925563 | Not Available | 544 | Open in IMG/M |
3300014745|Ga0157377_11327380 | Not Available | 564 | Open in IMG/M |
3300014866|Ga0180090_1074696 | Not Available | 602 | Open in IMG/M |
3300015052|Ga0137411_1144272 | Not Available | 1884 | Open in IMG/M |
3300015053|Ga0137405_1325719 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
3300015054|Ga0137420_1179843 | Not Available | 949 | Open in IMG/M |
3300015241|Ga0137418_10434151 | Not Available | 1064 | Open in IMG/M |
3300015264|Ga0137403_10080402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter tataouinensis | 3293 | Open in IMG/M |
3300015264|Ga0137403_10142334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2370 | Open in IMG/M |
3300015358|Ga0134089_10509353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300015371|Ga0132258_13793804 | Not Available | 1029 | Open in IMG/M |
3300015372|Ga0132256_103493007 | Not Available | 528 | Open in IMG/M |
3300015372|Ga0132256_103657258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300015373|Ga0132257_101806852 | Not Available | 785 | Open in IMG/M |
3300016270|Ga0182036_10908764 | Not Available | 722 | Open in IMG/M |
3300016387|Ga0182040_10192340 | Not Available | 1493 | Open in IMG/M |
3300016404|Ga0182037_10361809 | Not Available | 1185 | Open in IMG/M |
3300016445|Ga0182038_12099730 | Not Available | 512 | Open in IMG/M |
3300016445|Ga0182038_12172272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300017657|Ga0134074_1082332 | Not Available | 1099 | Open in IMG/M |
3300018429|Ga0190272_12282538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300018468|Ga0066662_12803817 | Not Available | 517 | Open in IMG/M |
3300019257|Ga0180115_1382053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300019263|Ga0184647_1046544 | Not Available | 584 | Open in IMG/M |
3300020170|Ga0179594_10339746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300021090|Ga0210377_10680725 | Not Available | 569 | Open in IMG/M |
3300021170|Ga0210400_11438943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300021171|Ga0210405_10945977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300021178|Ga0210408_10846017 | Not Available | 714 | Open in IMG/M |
3300021178|Ga0210408_11151615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300021404|Ga0210389_10683001 | Not Available | 805 | Open in IMG/M |
3300022726|Ga0242654_10195534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300022726|Ga0242654_10219059 | Not Available | 669 | Open in IMG/M |
3300024181|Ga0247693_1030948 | Not Available | 739 | Open in IMG/M |
3300024283|Ga0247670_1051023 | Not Available | 746 | Open in IMG/M |
3300024283|Ga0247670_1090546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300025930|Ga0207701_11194357 | Not Available | 627 | Open in IMG/M |
3300025937|Ga0207669_10754005 | Not Available | 804 | Open in IMG/M |
3300025938|Ga0207704_10806626 | Not Available | 784 | Open in IMG/M |
3300026041|Ga0207639_11904658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 555 | Open in IMG/M |
3300026121|Ga0207683_10771037 | Not Available | 892 | Open in IMG/M |
3300026304|Ga0209240_1141779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
3300026307|Ga0209469_1122466 | Not Available | 630 | Open in IMG/M |
3300026319|Ga0209647_1326822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300026333|Ga0209158_1137833 | Not Available | 902 | Open in IMG/M |
3300026361|Ga0257176_1036956 | Not Available | 749 | Open in IMG/M |
3300026498|Ga0257156_1071510 | Not Available | 719 | Open in IMG/M |
3300026499|Ga0257181_1070502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300026540|Ga0209376_1382053 | Not Available | 527 | Open in IMG/M |
3300026551|Ga0209648_10475505 | Not Available | 750 | Open in IMG/M |
3300026552|Ga0209577_10155742 | Not Available | 1792 | Open in IMG/M |
3300027725|Ga0209178_1027576 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300027862|Ga0209701_10597572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300027903|Ga0209488_11013650 | Not Available | 574 | Open in IMG/M |
3300027909|Ga0209382_11190465 | Not Available | 780 | Open in IMG/M |
3300028381|Ga0268264_10323539 | Not Available | 1459 | Open in IMG/M |
3300030842|Ga0075404_11377571 | Not Available | 573 | Open in IMG/M |
3300030847|Ga0075405_11078548 | Not Available | 600 | Open in IMG/M |
3300031099|Ga0308181_1054073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium caraganae | 770 | Open in IMG/M |
3300031231|Ga0170824_106083235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300031446|Ga0170820_17357102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300031680|Ga0318574_10481978 | Not Available | 726 | Open in IMG/M |
3300031720|Ga0307469_11186672 | Not Available | 721 | Open in IMG/M |
3300031731|Ga0307405_10363966 | Not Available | 1120 | Open in IMG/M |
3300031736|Ga0318501_10708900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300031754|Ga0307475_10300631 | Not Available | 1288 | Open in IMG/M |
3300031754|Ga0307475_11088232 | Not Available | 626 | Open in IMG/M |
3300031771|Ga0318546_10783266 | Not Available | 671 | Open in IMG/M |
3300031782|Ga0318552_10381721 | Not Available | 718 | Open in IMG/M |
3300031795|Ga0318557_10356523 | Not Available | 672 | Open in IMG/M |
3300031796|Ga0318576_10316373 | Not Available | 737 | Open in IMG/M |
3300031833|Ga0310917_10721564 | Not Available | 674 | Open in IMG/M |
3300031854|Ga0310904_10027957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2588 | Open in IMG/M |
3300031897|Ga0318520_10764645 | Not Available | 605 | Open in IMG/M |
3300031912|Ga0306921_10701679 | Not Available | 1163 | Open in IMG/M |
3300031912|Ga0306921_11327127 | Not Available | 794 | Open in IMG/M |
3300031912|Ga0306921_11809750 | Not Available | 656 | Open in IMG/M |
3300031939|Ga0308174_11611438 | Not Available | 557 | Open in IMG/M |
3300031941|Ga0310912_10631583 | Not Available | 832 | Open in IMG/M |
3300031945|Ga0310913_11204229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300031954|Ga0306926_10742004 | Not Available | 1188 | Open in IMG/M |
3300031995|Ga0307409_101712356 | Not Available | 657 | Open in IMG/M |
3300032005|Ga0307411_11105838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300032012|Ga0310902_10487318 | Not Available | 802 | Open in IMG/M |
3300032063|Ga0318504_10537688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300032064|Ga0318510_10341387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300032157|Ga0315912_11030737 | Not Available | 653 | Open in IMG/M |
3300032180|Ga0307471_101585755 | Not Available | 811 | Open in IMG/M |
3300032261|Ga0306920_100069424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5159 | Open in IMG/M |
3300032261|Ga0306920_100694951 | Not Available | 1499 | Open in IMG/M |
3300033412|Ga0310810_10600040 | Not Available | 1058 | Open in IMG/M |
3300033814|Ga0364930_0256070 | Not Available | 592 | Open in IMG/M |
3300034115|Ga0364945_0067876 | Not Available | 1015 | Open in IMG/M |
3300034660|Ga0314781_058260 | Not Available | 708 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.11% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.59% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.07% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.07% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.07% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.55% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.55% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.04% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.04% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.04% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.04% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.52% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.52% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.52% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_02406430 | 2170459010 | Grass Soil | RRVLGGLPAEQRVLFLAVDDRVNYEGVLRIIDLAKSRVEDLKIEFVATN |
ICChiseqgaiiFebDRAFT_143720521 | 3300000363 | Soil | VAEALGGRPKDRRVLFVTADDQLNYEGILRIVDLAKSRVDNLKIEMLTAQ* |
JGI25383J37093_101750241 | 3300002560 | Grasslands Soil | ARVAEILGGRPAGQRALFLAVDDRLNYEGVVRIIDLAKSGVEDLKIEFIATN* |
JGI25382J37095_100506471 | 3300002562 | Grasslands Soil | GRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN* |
JGI25382J37095_101553172 | 3300002562 | Grasslands Soil | PAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATN* |
JGI25615J43890_10142572 | 3300002910 | Grasslands Soil | GRPAEQRALFLAVDDRLXYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0062593_1025333421 | 3300004114 | Soil | ATELPVRVAQILSGRPAEQHALFLAVDDNLNYEGVLRIIDLAKAGVEDLKIEFIAAN* |
Ga0062590_1013663121 | 3300004157 | Soil | PMRVADILGSRPAEQRALFLAVDDRLNYEGVLRIIDLAKLGVEDLKIEFIATN* |
Ga0062591_1016588911 | 3300004643 | Soil | RVADILGSRPAEQRALFLAVDDRLNYEGVLRIIDLAKLGVEDLKIEFIATN* |
Ga0062591_1026724581 | 3300004643 | Soil | TRVAQVMSDRPADKRVLFLGADDRLNYEGVLRIVDLAMTGVPDLKIEFVEAN* |
Ga0066388_1062191172 | 3300005332 | Tropical Forest Soil | RPPEKRVLFLAADDRMNYEGVLRILDLAKSDVEDLKVEFITAN* |
Ga0070674_1005478111 | 3300005356 | Miscanthus Rhizosphere | PERVANILSGQPSEKHVLFLAAADRLNYEGVLRIVDLAKSRVDDLKIEFIATN* |
Ga0070710_113821932 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EQRALFLAVDDHLNYEAVLRIIDLAKSRVEDLKIEFVAAN* |
Ga0070699_1003552762 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EQRALFLAVDDHLNYEAVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0070684_1005174661 | 3300005535 | Corn Rhizosphere | AAMLSDQPAEQHALFLAVDDHLNYENVLRIIDLAKSGVEDLKIEFIATN* |
Ga0066704_101440643 | 3300005557 | Soil | FLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN* |
Ga0066698_103323491 | 3300005558 | Soil | VSEILGGRPAERRVLFIAADDRLNYEGVLRIVDFAKSRVDDLKIEFIATD* |
Ga0066698_107236502 | 3300005558 | Soil | RVLFIAADDRLNYEGVLRIVDFAKSRVDDLKIEFITTD* |
Ga0066693_104016041 | 3300005566 | Soil | ILRGRPAEQRALFLAVDDRLNYEAVLRIIDLAKSGVADLKIEFVAAN* |
Ga0066703_103557172 | 3300005568 | Soil | LFLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN* |
Ga0066703_105103052 | 3300005568 | Soil | FLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN* |
Ga0066702_103777932 | 3300005575 | Soil | DQPPERRVLFLDADDRLNYEGVLRIVDLAKSNVQDLKIEFITH* |
Ga0066708_106372971 | 3300005576 | Soil | AAELPARVAEILGGRPAGQRALFLAVDDRLNYEGVVRIIDLAKSGVEDLKIEFIATN* |
Ga0066691_109071872 | 3300005586 | Soil | FLAADNRLNYEGVLRIVDLAKSKVDDLTIEFITTD* |
Ga0074479_100596862 | 3300005829 | Sediment (Intertidal) | VDQRVLFLAADDRLNYEGVLRIVDLAKSGVEDLQIEFLSAE* |
Ga0066787_100121821 | 3300005950 | Soil | ARVGAILGSRPAEKRVLFLAADDRMNYEGVLRILDLAKSSVDDLKVEFITAN* |
Ga0066656_106622571 | 3300006034 | Soil | FLAVDDRLNYEGVVRIIDLAKSGVEDLKIEFIATN* |
Ga0066652_1015585231 | 3300006046 | Soil | LFLAVDDRLNYEAVLRIIDLAKSGVADLKIEFVAAN* |
Ga0070716_1012652452 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ASILGGRPAEQRALFLAIDDRLNYEGVLRIIDFAKSGVEDLKIEFVAAN* |
Ga0070765_1018317222 | 3300006176 | Soil | LFLAVDDRLNYEGVLRIIDSAKSGVEDLKIEFVAAN* |
Ga0097621_1022511691 | 3300006237 | Miscanthus Rhizosphere | EVPARVAETFAGRPANGRVLFLAADDRVNYEAVLRVVDLAKSRVDDLTIEFITTD* |
Ga0068871_1010609362 | 3300006358 | Miscanthus Rhizosphere | LAVDKSLNYEAVLRIVDFAKSNLDDLRIEFVTTNETN* |
Ga0079221_103707822 | 3300006804 | Agricultural Soil | PREKRVLFLDADDKLNYEGVLRIVDLAKSNVEDLKIEFITH* |
Ga0075428_1026592052 | 3300006844 | Populus Rhizosphere | LFLAADDRLNYEGVLRIIDLAKSGVEDLKIEFIATR* |
Ga0075421_1001360413 | 3300006845 | Populus Rhizosphere | LAADDRLNYEGVLRIIDLAKSGVENLKIEFVGNQ* |
Ga0079219_102402372 | 3300006954 | Agricultural Soil | VLFLDADDRLNYEGVLRIVDLAKSNVEDLKIEFITH* |
Ga0079219_111298862 | 3300006954 | Agricultural Soil | LAADDRMNYEGVLRILDLAKSGVEDLNVEFITAN* |
Ga0099794_102028241 | 3300007265 | Vadose Zone Soil | PAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN* |
Ga0066710_1007865951 | 3300009012 | Grasslands Soil | PAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATN |
Ga0099830_114400501 | 3300009088 | Vadose Zone Soil | RPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0099828_109925102 | 3300009089 | Vadose Zone Soil | PAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIAAN* |
Ga0099827_117559661 | 3300009090 | Vadose Zone Soil | RALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN* |
Ga0102851_100788253 | 3300009091 | Freshwater Wetlands | LPARVAELLGGRPRDQRVLVLAADDHLNYEGVLRIVDLAKSDVEDLTIEFITAE* |
Ga0075418_112694482 | 3300009100 | Populus Rhizosphere | GRPTEYRVLFLDVDDRVNYEGVLRIIDLAKSGVPDLKIEFLTTQ* |
Ga0066709_1037868291 | 3300009137 | Grasslands Soil | LGGRPADRRVLFLAADNRLNYEGVLRIVDLAKSKVDDLTIEFITTD* |
Ga0114129_107706841 | 3300009147 | Populus Rhizosphere | EFLGGQPTEKRVLFLAVDDRVNYEGVLRIIDLANSGVQDLKIEFITAH* |
Ga0126374_114050511 | 3300009792 | Tropical Forest Soil | QILGRRPAEQRALFLAVDDHLNYEGVLRIIDLAKSDVEDLKIEFVAAN* |
Ga0126384_102226741 | 3300010046 | Tropical Forest Soil | AEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATN* |
Ga0126382_105174792 | 3300010047 | Tropical Forest Soil | FLAVDDRMNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0126373_125575832 | 3300010048 | Tropical Forest Soil | GRPAEQRALFLAVDDHMNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0134088_103729842 | 3300010304 | Grasslands Soil | ERVLFVAVDDRLNYEGVLRIVDLAKSQVEDLTIEVITAN* |
Ga0134067_102218182 | 3300010321 | Grasslands Soil | FLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0134111_100597591 | 3300010329 | Grasslands Soil | AEILGGRPAGQRALFLAVDDRLNYEGVVRIIDLAKSGVEDLKIEFIATN* |
Ga0126370_112904232 | 3300010358 | Tropical Forest Soil | EILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN* |
Ga0126370_116195371 | 3300010358 | Tropical Forest Soil | QRALFLAVDDHMNYEGVLRIIDLAKSGVQDLKIEFVAAN* |
Ga0126376_128194632 | 3300010359 | Tropical Forest Soil | LAGRPTEQRALFLAVDDGLNYEGVLRIIDLAKSRVEDLKIEFIATN* |
Ga0126378_124485662 | 3300010361 | Tropical Forest Soil | FLAADDRLNYEGVLRILDLAKSGVEDLKVEFITSY* |
Ga0126378_125520931 | 3300010361 | Tropical Forest Soil | PARVASILGGRPAEQRALFLAVDDRMNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0126377_110717761 | 3300010362 | Tropical Forest Soil | VLFLAADDRLNYEGVLRILDLAKSGVEDLKVEFITAN* |
Ga0126377_113140412 | 3300010362 | Tropical Forest Soil | VLFLDADDRLNYEGVLRIVDLAKSDVEDLKIEFITH* |
Ga0126377_128775031 | 3300010362 | Tropical Forest Soil | RVASILGGRPAEQRALFLAVDDRMNYEGVLRIIDLAKSRVEDLKIEFVAANSN* |
Ga0126379_112625242 | 3300010366 | Tropical Forest Soil | EHVLFLAADDTLNYEGVLRIIDLAKSGIEDLKIEFVATQ* |
Ga0126379_113283652 | 3300010366 | Tropical Forest Soil | LRGRPPEQRALFMAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN* |
Ga0126379_121728172 | 3300010366 | Tropical Forest Soil | ELPARVASILGGRPPEQRALFLAVDDRVNYEAVLRIIDLAKSNVEDLKIEFVATN* |
Ga0126379_138621902 | 3300010366 | Tropical Forest Soil | LAARVTAALGSRPADEHVLFLAADDTLNYEGVLRIIDLAKSGVEDLKIEFVATQ* |
Ga0134128_110956952 | 3300010373 | Terrestrial Soil | FLAADDRLNYEGVLRILYLAKSGVGDVQVEFITSN* |
Ga0126381_1004554011 | 3300010376 | Tropical Forest Soil | LAADDRLNYEGVLRILDLAKSGVEDLQVEFITSN* |
Ga0126383_111571161 | 3300010398 | Tropical Forest Soil | KHVLFLAADDRLNYEGVLRILDLAKSGVEDLQVEFITSN* |
Ga0126383_132100251 | 3300010398 | Tropical Forest Soil | EQRALFLAVDDRLNYEGLLRIIDLAKSGVEDLKIEFIATN* |
Ga0134123_128177511 | 3300010403 | Terrestrial Soil | ELLSGRPKDQRVLFLMADDRLNYEGVLRIVDLAKSSVDDVSIEIIAAN* |
Ga0134123_131128732 | 3300010403 | Terrestrial Soil | VLFLAADDSLNYEGVLRIIDLAKSGVEDLKIEFIATQ* |
Ga0137392_111404622 | 3300011269 | Vadose Zone Soil | RALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATN* |
Ga0137393_113244571 | 3300011271 | Vadose Zone Soil | ALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0137333_11267042 | 3300011413 | Soil | GRPADGRVLFLAADDRLNYEGVLRIVDLAKTRVDDLTIAFIAND* |
Ga0137455_11939431 | 3300011429 | Soil | RVLFLAADDRLNYEGVLRIVDLATSGVSNLQIEFLTD* |
Ga0137433_11550582 | 3300011440 | Soil | MGGRPKDKRVLFLLADDRLNYEGVLRIVDLAKLKVNDMTIEIIAAN* |
Ga0137389_118321742 | 3300012096 | Vadose Zone Soil | ILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIAAN* |
Ga0137355_11122331 | 3300012163 | Soil | QRVLFLAADDRMNYEGVLRIVDLAKLGVGDLQIEFLTTD* |
Ga0137388_116710602 | 3300012189 | Vadose Zone Soil | ELPERVAEILGGQPPEKRVLFLAADNRLNYEGVLRIVDLAKSKVDDLTIEFITTD* |
Ga0137363_105526822 | 3300012202 | Vadose Zone Soil | AEILARRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0137363_113065812 | 3300012202 | Vadose Zone Soil | ALFLAVDDRLNYEAVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0137363_117014632 | 3300012202 | Vadose Zone Soil | EQHALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0137362_107677572 | 3300012205 | Vadose Zone Soil | RPAEQHALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0137371_107035772 | 3300012356 | Vadose Zone Soil | AEILGRRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN* |
Ga0137384_108871062 | 3300012357 | Vadose Zone Soil | GRPAEQRALFLAVDDRLNYEGILRIIDLAKSGVEDLKIEFVAAN* |
Ga0137385_110008511 | 3300012359 | Vadose Zone Soil | RPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN* |
Ga0137375_111889121 | 3300012360 | Vadose Zone Soil | DLPARVAELLGDRPPEKRVLFLAADNRLNYEGVLRIVDLAKSNIDDLTIEFITTD* |
Ga0137373_110482901 | 3300012532 | Vadose Zone Soil | ADRPSDKRVLFLAADYRLNYEGVLRILDLAKSGVEVLQVEFITSN* |
Ga0137395_104774571 | 3300012917 | Vadose Zone Soil | PAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0137395_109458282 | 3300012917 | Vadose Zone Soil | GRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVQDLKIEFVATN* |
Ga0137396_108998982 | 3300012918 | Vadose Zone Soil | LGGRPAEKRVLFLAADNRLNYEGVLRIVDLAKSKVDDLTIEFITTD* |
Ga0137396_109019782 | 3300012918 | Vadose Zone Soil | ASILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVQDLKIEFVATN* |
Ga0137394_116130041 | 3300012922 | Vadose Zone Soil | TEKRVLFLAVDDRVNYEGVLRIIDLANAGVQDLKIEFITAH* |
Ga0137359_104199672 | 3300012923 | Vadose Zone Soil | RPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATD* |
Ga0137407_105262191 | 3300012930 | Vadose Zone Soil | AAVGSILGGRPAEQRALFVAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATD* |
Ga0137407_106194412 | 3300012930 | Vadose Zone Soil | VRRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0126375_105253021 | 3300012948 | Tropical Forest Soil | ILGSRPTEKRVLFLAADDRMNYEGVLRILDLAKSGVEDLKVEFITTN* |
Ga0134077_101651031 | 3300012972 | Grasslands Soil | FIAADDRLNYEGVLRIVDFAKSRVDDLKIEFITTD* |
Ga0181523_107769102 | 3300014165 | Bog | SKILGGQPPEKRVLFLAADDRLNYEGTLRILDLAKSNVEDLKIEFITND* |
Ga0157380_129255632 | 3300014326 | Switchgrass Rhizosphere | LGRRPKDQRVLFLAADDNLNYEGVLRIVDLAKSRVEGLQIEVITTE* |
Ga0157377_113273801 | 3300014745 | Miscanthus Rhizosphere | RVLFLAADDRLNYEGVLRIVDLAKSGVEDLSIEFLTTH* |
Ga0180090_10746961 | 3300014866 | Soil | RMALFLAADDSLNYEGVLRIVDLAKSGVEGLKIEFIGTH* |
Ga0137411_11442721 | 3300015052 | Vadose Zone Soil | PARGTAILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATD* |
Ga0137405_13257191 | 3300015053 | Vadose Zone Soil | RALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAD* |
Ga0137420_11798431 | 3300015054 | Vadose Zone Soil | LAVDDRLNYEGVLRIIYLAKSGVQDLKIEFVATN* |
Ga0137418_104341512 | 3300015241 | Vadose Zone Soil | RVLFLAADNRLNYEGVLRIVDLAKSKVDDLTIEFITTD* |
Ga0137403_100804021 | 3300015264 | Vadose Zone Soil | ILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0137403_101423341 | 3300015264 | Vadose Zone Soil | ILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATN* |
Ga0134089_105093531 | 3300015358 | Grasslands Soil | QRVLFLAADDRLNYEGVLRIIDLAKSGVEDLKIEFVATK* |
Ga0132258_137938041 | 3300015371 | Arabidopsis Rhizosphere | QRALFLAIDDRLNYEGVLRIIDLAKSGVPDLKIEFIATN* |
Ga0132256_1034930071 | 3300015372 | Arabidopsis Rhizosphere | RVLFLAADDSLNYEGVLRIVDLAKSGVEDLSIEFLTAH* |
Ga0132256_1036572582 | 3300015372 | Arabidopsis Rhizosphere | LFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN* |
Ga0132257_1018068522 | 3300015373 | Arabidopsis Rhizosphere | VLFLAADDRLNYEGVLRIIDLAKSDVEDLKIEFLTTH* |
Ga0182036_109087641 | 3300016270 | Soil | EQRALFLAVDDHLNYEAVLRIIDLAKSRVEDLKIEFVAAN |
Ga0182040_101923401 | 3300016387 | Soil | ELPARVASILGGRPPEQRALFLAVDDHMNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0182037_103618091 | 3300016404 | Soil | EQRALFLAVDDHLNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0182038_120997302 | 3300016445 | Soil | VLFLDADDRLNYEGVLRIVDLAKSNVEDLKIEFITSH |
Ga0182038_121722722 | 3300016445 | Soil | GGRPPEQRALFLAVDDHLNYEAVLRIIDLAKSRVEDLKIEFVAAN |
Ga0134074_10823321 | 3300017657 | Grasslands Soil | AEMPARVAEILGARPAGQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN |
Ga0190272_122825382 | 3300018429 | Soil | FLEADDRLNYEGVLRIVDLAKSGVEDLKIEFITTN |
Ga0066662_128038172 | 3300018468 | Grasslands Soil | VLFLDADDRLNYEGVLRILDLAKSNVEDLKIEFLTNH |
Ga0180115_13820532 | 3300019257 | Groundwater Sediment | ARVAEILGPRPAEQRALFLAIDDRLNYEGVLRIIDLAKSRVEGVKIEFIATN |
Ga0184647_10465441 | 3300019263 | Groundwater Sediment | GQPTEKRVLFLAASDNLNYEGVLRIVDLAKSRVEDLKIEFIAAN |
Ga0179594_103397462 | 3300020170 | Vadose Zone Soil | RPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN |
Ga0210377_106807252 | 3300021090 | Groundwater Sediment | VAEILGVRPADRRVLYLAADDRLNYEGILRIVDLAKSSVDDLTIEFISTD |
Ga0210400_114389432 | 3300021170 | Soil | EQRALFLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN |
Ga0210405_109459771 | 3300021171 | Soil | ILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN |
Ga0210408_108460172 | 3300021178 | Soil | QRALFLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN |
Ga0210408_111516151 | 3300021178 | Soil | ALFLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN |
Ga0210389_106830011 | 3300021404 | Soil | AEILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN |
Ga0242654_101955342 | 3300022726 | Soil | ALFLAVDDRLNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0242654_102190592 | 3300022726 | Soil | FLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN |
Ga0247693_10309481 | 3300024181 | Soil | RPAEERVLFLAVDDRVNYEGVLRIIDLAKSRVEDLKIEFIATN |
Ga0247670_10510232 | 3300024283 | Soil | ARVASILGGRPAEQRALFLAVDDRMNYEGVLRIIDLAKSGVEDLKIEFVAAN |
Ga0247670_10905461 | 3300024283 | Soil | SRVASVLRGRPAEQRALFLAVDDRMNYEGVLRIIDLAKSGVEDLKIEFVAAN |
Ga0207701_111943572 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VLFLDVDDRVNYEGVLRIVDLAKSGVENLKIEFVPAH |
Ga0207669_107540051 | 3300025937 | Miscanthus Rhizosphere | PSEKHVLFLAAADRLNYEGVLRIVDLAKSRVDDLKIEFIATN |
Ga0207704_108066262 | 3300025938 | Miscanthus Rhizosphere | SILGSRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIANN |
Ga0207639_119046582 | 3300026041 | Corn Rhizosphere | TELPTRVAEILGSRPAEKRVLFLDADDRLNYEGVLRIVDLANFGFEDALGDRMTPMPD |
Ga0207683_107710372 | 3300026121 | Miscanthus Rhizosphere | AQILGGRPAEQHALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN |
Ga0209240_11417791 | 3300026304 | Grasslands Soil | FLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN |
Ga0209469_11224662 | 3300026307 | Soil | GGRPAERRVLFIAADDRLNYEGVLRIVDFAKSRVDDLKIEFIATD |
Ga0209647_13268221 | 3300026319 | Grasslands Soil | AAELPTRVAEILGRRPPEQRALFLAVDDHMNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0209158_11378332 | 3300026333 | Soil | AEQRALFLAVDDRFNYEGVLRIIDLAKSGVEDLKIEFIATN |
Ga0257176_10369562 | 3300026361 | Soil | RPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVQDLKIEFVATN |
Ga0257156_10715102 | 3300026498 | Soil | ILGRRPAEQRALFLAVDDHLNYEAVLRIIDLAKSGVEYLKIEFVAAN |
Ga0257181_10705021 | 3300026499 | Soil | AEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN |
Ga0209376_13820531 | 3300026540 | Soil | RVLFLAADDRLNYEGVLRILDLAKSGVEDLQVEFITSN |
Ga0209648_104755052 | 3300026551 | Grasslands Soil | AEQRALFLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN |
Ga0209577_101557421 | 3300026552 | Soil | DLPARVAEILGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSRVADLKIEFIAAN |
Ga0209178_10275761 | 3300027725 | Agricultural Soil | LFLAVDDRLNYEAVLRIIDLAKSGVEELKIEFVAAN |
Ga0209701_105975722 | 3300027862 | Vadose Zone Soil | ALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVATN |
Ga0209488_110136501 | 3300027903 | Vadose Zone Soil | QRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN |
Ga0209382_111904652 | 3300027909 | Populus Rhizosphere | GRQPTEKRVLFLAADDSLNYEGVLRIIDLAKSGVEDLKIEFVSTH |
Ga0268264_103235393 | 3300028381 | Switchgrass Rhizosphere | SGRPADRRVLFLAADDRLNYEGALRIVDLAKSRVDSLQIEFLTTD |
Ga0075404_113775711 | 3300030842 | Soil | LFLAVDDRLNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0075405_110785481 | 3300030847 | Soil | LFLAVDDRLNYEAVLRIIDLAKSGVEDLKIEFIATN |
Ga0308181_10540732 | 3300031099 | Soil | LFLAADDRLNYEGVLRIIDLAKSGVDDLKIEFLTSN |
Ga0170824_1060832351 | 3300031231 | Forest Soil | PSRVAEILGRRPAEQRALFLAVDDRLNYEGVLRIIDLAKSRVEDLKIEFVAAN |
Ga0170820_173571022 | 3300031446 | Forest Soil | PLFLAVDDRLNYEAVLRIIDLAKSGVEDLEIEFVAAN |
Ga0318574_104819782 | 3300031680 | Soil | GRPPDPRALFLAVDDHMNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0307469_111866722 | 3300031720 | Hardwood Forest Soil | GGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVADLKIEFIATN |
Ga0307405_103639661 | 3300031731 | Rhizosphere | LPTRVAGILGPLPSEKRVLFLDADDRLNYEGVLRILDLAKSNVEDLKVEFITSH |
Ga0318501_107089002 | 3300031736 | Soil | FLAVDDHVNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0307475_103006311 | 3300031754 | Hardwood Forest Soil | GRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVQDLKIEFVATN |
Ga0307475_110882321 | 3300031754 | Hardwood Forest Soil | LGGRPAEQRALFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFIATN |
Ga0318546_107832661 | 3300031771 | Soil | PARVASILGGRPAEQRALFLAVDDHMNYEGVLRIIDLAKSGVQDVKIEFVAAN |
Ga0318552_103817212 | 3300031782 | Soil | LFLAVDDHMNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0318557_103565232 | 3300031795 | Soil | LFLAVDDRLNYEGVLRIIDLAKSGVEDLKIEFVAAN |
Ga0318576_103163731 | 3300031796 | Soil | SILGGRPPEQRALFLAVDDHLNYEAVLRIIDLAKSGVEDLKIEFVAAH |
Ga0310917_107215641 | 3300031833 | Soil | GRPPEQRALFLAVDDHMNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0310904_100279573 | 3300031854 | Soil | RLLFLAADDRLNYEGVLRIIDLAKSGVEDLKIEFIATR |
Ga0318520_107646451 | 3300031897 | Soil | RPPEQRALFLAVDDHLNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0306921_107016791 | 3300031912 | Soil | LFLAADDRLNYEGVLRILDLAKSGVEGLQVEFITTN |
Ga0306921_113271272 | 3300031912 | Soil | FLAVDDHMNYEGVLRIIDLAKSGVQDVKIEFVAAN |
Ga0306921_118097501 | 3300031912 | Soil | PPEQRALFLAVDDHMNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0308174_116114381 | 3300031939 | Soil | LFLAADDRLNYEGVLRILDLAKSGVDDLKVEFITAN |
Ga0310912_106315831 | 3300031941 | Soil | VASILGGRPPEQRALFLAVDDHVNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0310913_112042291 | 3300031945 | Soil | RALFLAVDDHLNYEAVLRIIDLAKSRVEDLKIEFVAAN |
Ga0306926_107420042 | 3300031954 | Soil | VLFLDADDRLNYEGVLRIVDLAKSNVEDLKIDFITSH |
Ga0307409_1017123562 | 3300031995 | Rhizosphere | VLFLDADDRLNYEGVLRILDLAKSNVEDLKIEFITSH |
Ga0307411_111058382 | 3300032005 | Rhizosphere | VLFLDADDRLNYEGVLRILDLAKSNVEDLKVEFITSH |
Ga0310902_104873181 | 3300032012 | Soil | VLFLAADDQLNYEGVLRIVDLAKSGVDDLKIEFVAAH |
Ga0318504_105376881 | 3300032063 | Soil | QEQRALFLAVDDHLNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0318510_103413872 | 3300032064 | Soil | FLAVDDHLNYEAVLRIIDLAKSGVEDLKIEFVAAH |
Ga0315912_110307372 | 3300032157 | Soil | LFLAADDRLNYEGVLRVVDLAKSGVEDLKIEFLTSN |
Ga0307471_1015857551 | 3300032180 | Hardwood Forest Soil | ALFLAVDDRLNYEGVLRIIDFAKSGVEDLKIEFVAAN |
Ga0306920_1000694243 | 3300032261 | Soil | LFLAVDDHVNYEAVLRIIDLAKSGVEDLKIEFVAAN |
Ga0306920_1006949511 | 3300032261 | Soil | ARVGEILGSRPAEKRVLFLAADDRMNYEAVLRILDLAKSGVEDLKVEFITSM |
Ga0310810_106000401 | 3300033412 | Soil | LFLAVDDRMNYEGVLRIIDLAKSGVEDLKIEFVAAN |
Ga0364930_0256070_2_154 | 3300033814 | Sediment | VAEILGGRPAEKRVLFLAADNRLNYEGVLRIVDLAKSNIDDLTIEFITTD |
Ga0364945_0067876_893_1015 | 3300034115 | Sediment | DSRVLFLAADDRMNYEGVLRIVDLAKANVDDLSIEFVAND |
Ga0314781_058260_1_117 | 3300034660 | Soil | RALFLAIDDRLNYEGVLRIIDLAKSGVQDLKIEFIATN |
⦗Top⦘ |