NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027949

Metagenome / Metatranscriptome Family F027949

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027949
Family Type Metagenome / Metatranscriptome
Number of Sequences 193
Average Sequence Length 38 residues
Representative Sequence MRAMVVEVGPEIEQLVFEICRRPEQQVIQILASNGAD
Number of Associated Samples 148
Number of Associated Scaffolds 193

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 25.39 %
% of genes near scaffold ends (potentially truncated) 40.93 %
% of genes from short scaffolds (< 2000 bps) 80.83 %
Associated GOLD sequencing projects 138
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.119 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.544 % of family members)
Environment Ontology (ENVO) Unclassified
(29.016 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.212 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.85%    β-sheet: 0.00%    Coil/Unstructured: 66.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 193 Family Scaffolds
PF04255DUF433 1.55
PF02371Transposase_20 1.55
PF00589Phage_integrase 1.55
PF01850PIN 1.55
PF13646HEAT_2 1.04
PF13545HTH_Crp_2 1.04
PF00665rve 1.04
PF13620CarboxypepD_reg 1.04
PF13408Zn_ribbon_recom 0.52
PF00072Response_reg 0.52
PF00106adh_short 0.52
PF02604PhdYeFM_antitox 0.52
PF13470PIN_3 0.52
PF08223PaaX_C 0.52
PF00989PAS 0.52
PF14690zf-ISL3 0.52
PF14321DUF4382 0.52
PF01979Amidohydro_1 0.52
PF14257DUF4349 0.52
PF13592HTH_33 0.52
PF01569PAP2 0.52
PF00400WD40 0.52
PF05717TnpB_IS66 0.52
PF13482RNase_H_2 0.52
PF01019G_glu_transpept 0.52
PF00118Cpn60_TCP1 0.52
PF13565HTH_32 0.52
PF03544TonB_C 0.52
PF13701DDE_Tnp_1_4 0.52
PF00924MS_channel 0.52
PF04264YceI 0.52
PF13414TPR_11 0.52
PF01183Glyco_hydro_25 0.52
PF01336tRNA_anti-codon 0.52
PF01695IstB_IS21 0.52
PF13546DDE_5 0.52
PF01904DUF72 0.52
PF13655RVT_N 0.52
PF01894UPF0047 0.52
PF01582TIR 0.52
PF00990GGDEF 0.52
PF13358DDE_3 0.52
PF04679DNA_ligase_A_C 0.52
PF13683rve_3 0.52
PF07607DUF1570 0.52
PF12840HTH_20 0.52
PF12704MacB_PCD 0.52
PF00069Pkinase 0.52
PF02810SEC-C 0.52
PF08937DUF1863 0.52
PF06863DUF1254 0.52
PF12006DUF3500 0.52
PF01070FMN_dh 0.52
PF01515PTA_PTB 0.52
PF08447PAS_3 0.52
PF13495Phage_int_SAM_4 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 193 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.07
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 1.55
COG3547TransposaseMobilome: prophages, transposons [X] 1.55
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.04
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.04
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.04
COG4584TransposaseMobilome: prophages, transposons [X] 1.04
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.52
COG0280Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase)Energy production and conversion [C] 0.52
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.52
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.52
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.52
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.52
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.52
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.52
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.52
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.52
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 0.52
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.52
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.52
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.52
COG3327DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation)Transcription [K] 0.52
COG3436TransposaseMobilome: prophages, transposons [X] 0.52
COG3757Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 familyCell wall/membrane/envelope biogenesis [M] 0.52
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.52
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 0.52

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.12 %
UnclassifiedrootN/A10.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02GRAG3All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300001471|JGI12712J15308_10151587All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300001593|JGI12635J15846_10008403All Organisms → cellular organisms → Bacteria8774Open in IMG/M
3300001593|JGI12635J15846_10681363All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300002245|JGIcombinedJ26739_100214677All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300005172|Ga0066683_10066093All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2156Open in IMG/M
3300005174|Ga0066680_10754785All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005177|Ga0066690_10795892All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005184|Ga0066671_10809810All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005540|Ga0066697_10212946All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300005568|Ga0066703_10521351All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005602|Ga0070762_10649943All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005610|Ga0070763_10103125All Organisms → cellular organisms → Bacteria → Proteobacteria1441Open in IMG/M
3300005764|Ga0066903_102979501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium918Open in IMG/M
3300005921|Ga0070766_10148104All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300005921|Ga0070766_11132117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300005950|Ga0066787_10004193All Organisms → cellular organisms → Bacteria2123Open in IMG/M
3300005994|Ga0066789_10454277All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300006046|Ga0066652_100065994All Organisms → cellular organisms → Bacteria2797Open in IMG/M
3300006052|Ga0075029_101028550All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300006059|Ga0075017_101170720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300006173|Ga0070716_101637230All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006174|Ga0075014_100055573All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300006175|Ga0070712_100330202All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300006176|Ga0070765_100038653All Organisms → cellular organisms → Bacteria3798Open in IMG/M
3300006176|Ga0070765_102108476All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006804|Ga0079221_10290872All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300006864|Ga0066797_1024039All Organisms → cellular organisms → Bacteria2128Open in IMG/M
3300007258|Ga0099793_10024671All Organisms → cellular organisms → Bacteria → Acidobacteria2504Open in IMG/M
3300007258|Ga0099793_10687906All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300007265|Ga0099794_10409216Not Available709Open in IMG/M
3300007819|Ga0104322_121315All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300009090|Ga0099827_10413081All Organisms → cellular organisms → Bacteria → Acidobacteria1154Open in IMG/M
3300009176|Ga0105242_12507416All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009523|Ga0116221_1533211All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300009524|Ga0116225_1486663All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300009792|Ga0126374_10055370All Organisms → cellular organisms → Bacteria → Acidobacteria2039Open in IMG/M
3300009839|Ga0116223_10562567Not Available660Open in IMG/M
3300009839|Ga0116223_10611927All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300010046|Ga0126384_10656372All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300010048|Ga0126373_10017895All Organisms → cellular organisms → Bacteria5925Open in IMG/M
3300010048|Ga0126373_10108455All Organisms → cellular organisms → Bacteria2580Open in IMG/M
3300010048|Ga0126373_10121453All Organisms → cellular organisms → Bacteria → Acidobacteria2444Open in IMG/M
3300010048|Ga0126373_10494425All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300010048|Ga0126373_12313361All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300010154|Ga0127503_10162653All Organisms → cellular organisms → Bacteria → Acidobacteria1108Open in IMG/M
3300010304|Ga0134088_10527323All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300010326|Ga0134065_10303641All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300010326|Ga0134065_10359164All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300010335|Ga0134063_10390996All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010339|Ga0074046_10223995All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300010339|Ga0074046_10459261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300010341|Ga0074045_10020048All Organisms → cellular organisms → Bacteria → Acidobacteria5266Open in IMG/M
3300010341|Ga0074045_10605519All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300010358|Ga0126370_10230320All Organisms → cellular organisms → Bacteria → Acidobacteria1422Open in IMG/M
3300010358|Ga0126370_10260063Not Available1352Open in IMG/M
3300010361|Ga0126378_13215108All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010364|Ga0134066_10042285All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300010366|Ga0126379_10111622All Organisms → cellular organisms → Bacteria2459Open in IMG/M
3300010376|Ga0126381_100746472All Organisms → cellular organisms → Bacteria1402Open in IMG/M
3300010376|Ga0126381_100944979All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300010376|Ga0126381_101185415All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300010376|Ga0126381_101691717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans914Open in IMG/M
3300010376|Ga0126381_102161722All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300010376|Ga0126381_103172197All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300010379|Ga0136449_100865629All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300010379|Ga0136449_100978512All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300010379|Ga0136449_102457243Not Available749Open in IMG/M
3300010379|Ga0136449_104010233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300011120|Ga0150983_16440703All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300011270|Ga0137391_10229153Not Available1613Open in IMG/M
3300011271|Ga0137393_10358211Not Available1247Open in IMG/M
3300012096|Ga0137389_11270339All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300012199|Ga0137383_10051841All Organisms → cellular organisms → Bacteria2934Open in IMG/M
3300012199|Ga0137383_10075550All Organisms → cellular organisms → Bacteria2432Open in IMG/M
3300012199|Ga0137383_10967642Not Available621Open in IMG/M
3300012200|Ga0137382_10324927All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300012211|Ga0137377_10145011All Organisms → cellular organisms → Bacteria2272Open in IMG/M
3300012211|Ga0137377_11948509Not Available504Open in IMG/M
3300012351|Ga0137386_10018802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 894662Open in IMG/M
3300012359|Ga0137385_10034340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4551Open in IMG/M
3300012362|Ga0137361_10298925All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300012378|Ga0134025_1126798All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300012683|Ga0137398_10713857All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300012683|Ga0137398_11116464All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300012685|Ga0137397_10280441All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300012917|Ga0137395_10381644All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300012922|Ga0137394_10146833Not Available2005Open in IMG/M
3300012923|Ga0137359_10845957All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300012925|Ga0137419_10036900All Organisms → cellular organisms → Bacteria3049Open in IMG/M
3300012925|Ga0137419_10231296Not Available1384Open in IMG/M
3300012925|Ga0137419_10356013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300012927|Ga0137416_10619738Not Available944Open in IMG/M
3300012958|Ga0164299_11674014All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300012971|Ga0126369_10685220All Organisms → cellular organisms → Bacteria → Acidobacteria1101Open in IMG/M
3300012971|Ga0126369_12028452All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012986|Ga0164304_10503564All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300012989|Ga0164305_11859663All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300013296|Ga0157374_11372210All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300014164|Ga0181532_10014301All Organisms → cellular organisms → Bacteria → Acidobacteria6000Open in IMG/M
3300014200|Ga0181526_10650370Not Available665Open in IMG/M
3300014501|Ga0182024_10125229All Organisms → cellular organisms → Bacteria3666Open in IMG/M
3300015054|Ga0137420_1092023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium956Open in IMG/M
3300015241|Ga0137418_11142393All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300015371|Ga0132258_11903592All Organisms → cellular organisms → Bacteria → Acidobacteria1497Open in IMG/M
3300016270|Ga0182036_10186080All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1510Open in IMG/M
3300016404|Ga0182037_10390954All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300016445|Ga0182038_11292491All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300017657|Ga0134074_1384248Not Available521Open in IMG/M
3300017928|Ga0187806_1071564All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300017930|Ga0187825_10313912All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300017932|Ga0187814_10292746All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300017932|Ga0187814_10412227All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300017937|Ga0187809_10334116All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300017946|Ga0187879_10566584All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300018006|Ga0187804_10525348Not Available533Open in IMG/M
3300018431|Ga0066655_11211020All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300020579|Ga0210407_10059917All Organisms → cellular organisms → Bacteria → Acidobacteria2849Open in IMG/M
3300020579|Ga0210407_10467699Not Available986Open in IMG/M
3300020579|Ga0210407_10838548All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300020580|Ga0210403_10434356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1070Open in IMG/M
3300020581|Ga0210399_11005540All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300020581|Ga0210399_11380154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300021168|Ga0210406_10074033All Organisms → cellular organisms → Bacteria2923Open in IMG/M
3300021168|Ga0210406_10827587All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300021170|Ga0210400_10633537All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300021171|Ga0210405_10070241All Organisms → cellular organisms → Bacteria → Acidobacteria2762Open in IMG/M
3300021401|Ga0210393_10812079All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300021405|Ga0210387_10238780All Organisms → cellular organisms → Bacteria1587Open in IMG/M
3300021405|Ga0210387_11738212All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300021406|Ga0210386_10224173All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300021420|Ga0210394_10252785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1542Open in IMG/M
3300021432|Ga0210384_10293844All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300021478|Ga0210402_10011674All Organisms → cellular organisms → Bacteria7578Open in IMG/M
3300021559|Ga0210409_10533792All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300021559|Ga0210409_10646366All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300021559|Ga0210409_11312580All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300021560|Ga0126371_11780097All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300025482|Ga0208715_1085380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300025929|Ga0207664_11007838All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300025939|Ga0207665_11596506All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300026295|Ga0209234_1003072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6347Open in IMG/M
3300026324|Ga0209470_1038585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2381Open in IMG/M
3300026328|Ga0209802_1067010All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300026328|Ga0209802_1321699All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300026334|Ga0209377_1008601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5901Open in IMG/M
3300026494|Ga0257159_1007216All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1678Open in IMG/M
3300026910|Ga0207840_1006222All Organisms → cellular organisms → Bacteria → Acidobacteria1333Open in IMG/M
3300027042|Ga0207766_1004078Not Available1818Open in IMG/M
3300027324|Ga0209845_1054064All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300027660|Ga0209736_1111684All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300027698|Ga0209446_1107078All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300027748|Ga0209689_1026546All Organisms → cellular organisms → Bacteria3498Open in IMG/M
3300027884|Ga0209275_10011534All Organisms → cellular organisms → Bacteria → Acidobacteria3794Open in IMG/M
3300027898|Ga0209067_10676571Not Available597Open in IMG/M
3300027908|Ga0209006_10173657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1882Open in IMG/M
3300028536|Ga0137415_10017148All Organisms → cellular organisms → Bacteria7182Open in IMG/M
3300031231|Ga0170824_117292639All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300031469|Ga0170819_11911630Not Available884Open in IMG/M
3300031469|Ga0170819_14195113All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300031474|Ga0170818_102886800All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031561|Ga0318528_10531210All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300031564|Ga0318573_10195130All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300031708|Ga0310686_107370346All Organisms → cellular organisms → Bacteria → Acidobacteria1716Open in IMG/M
3300031708|Ga0310686_108300777All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300031719|Ga0306917_10229296All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300031744|Ga0306918_10050941All Organisms → cellular organisms → Bacteria2749Open in IMG/M
3300031753|Ga0307477_10790156All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300031792|Ga0318529_10478674All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031833|Ga0310917_10729721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300031873|Ga0315297_11636548Not Available517Open in IMG/M
3300031879|Ga0306919_10483999All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300031890|Ga0306925_10123296All Organisms → cellular organisms → Bacteria → Acidobacteria2774Open in IMG/M
3300031897|Ga0318520_11066506All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300031912|Ga0306921_10131493All Organisms → cellular organisms → Bacteria2922Open in IMG/M
3300031941|Ga0310912_10491966All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300031946|Ga0310910_11530549All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031947|Ga0310909_11575759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300031954|Ga0306926_10750891All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300031954|Ga0306926_10803677All Organisms → cellular organisms → Bacteria → Acidobacteria1133Open in IMG/M
3300031962|Ga0307479_10406621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1346Open in IMG/M
3300031962|Ga0307479_10607935Not Available1075Open in IMG/M
3300032001|Ga0306922_10086863All Organisms → cellular organisms → Bacteria3291Open in IMG/M
3300032001|Ga0306922_10338204All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300032063|Ga0318504_10543307All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300032180|Ga0307471_100346124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1594Open in IMG/M
3300032205|Ga0307472_101639134Not Available633Open in IMG/M
3300032261|Ga0306920_100415343All Organisms → cellular organisms → Bacteria2000Open in IMG/M
3300032261|Ga0306920_100656669All Organisms → cellular organisms → Bacteria → Acidobacteria1548Open in IMG/M
3300032261|Ga0306920_101827574All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300032261|Ga0306920_103001646All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300033405|Ga0326727_10773049All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300033977|Ga0314861_0100289All Organisms → cellular organisms → Bacteria1480Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.54%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.22%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.59%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.07%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.07%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.07%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.55%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.04%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.52%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.52%
Permafrost SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil0.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.52%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.52%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.52%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.52%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.52%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.52%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007819Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012378Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025482Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026910Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes)EnvironmentalOpen in IMG/M
3300027042Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes)EnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_050983102170459010Grass SoilMRAMVVEVGPEIEQFVFQICRRPEQHVIQILASKGAD
JGI12712J15308_1015158713300001471Forest SoilMGTMVIVVGPQIEQFILEICTRPEHHMIQIFASNG
JGI12635J15846_1000840373300001593Forest SoilMVVEVGPEIEQLVFEVCRRPEQRVIQILAPNGAD*
JGI12635J15846_1068136313300001593Forest SoilMRAIVVEVGPEIEKLVFEICSGPEQHAIQILASKR
JGIcombinedJ26739_10021467713300002245Forest SoilMGTMVIVVGPQIEQFILEICTRPEHHMIQIFASNGADEPFHE
Ga0066683_1006609313300005172SoilMRAMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFHEWMG
Ga0066680_1075478513300005174SoilMVVEVVPELKQFIFEICGRPEQRVIQILASNRADEPFDERMR
Ga0066690_1079589223300005177SoilMVVEVVPELKEFIFEICGRPEQRVIQILASNRADEPFDERMR
Ga0066671_1080981013300005184SoilMRALVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPF
Ga0066697_1021294613300005540SoilMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFDE
Ga0066703_1052135113300005568SoilMMVVVVPEIEQFIFQIDSRPEQRVIQTFASNGADEPFHE
Ga0070762_1064994313300005602SoilMRAMVVEIGSEIEQLVFEICRRPEQDVIQVLAPKGAD*
Ga0070763_1010312513300005610SoilMVVEVGPEIQQFILEICTRPEQHVIQIFASNGANEPFHEGMRL
Ga0066903_10297950113300005764Tropical Forest SoilMGAMVVEVGSEIEQLVFEIRRSPEQNVIQILPSNGAD*
Ga0070766_1014810423300005921SoilMGAMVVEVGPKIEQLVFEICRRSEQSAIQILSANGAD*
Ga0070766_1113211723300005921SoilMGAMVVEVGPEIEQFILQICTRPEQHVIQIFASNGANEPF
Ga0066787_1000419323300005950SoilMVVEVGPEIEQLVFEICRRPEQGVIQILASKGAD*
Ga0066789_1045427723300005994SoilMVVVVVLEIEQFIFQIDSRPEQRVIQIFASNGADEP
Ga0066652_10006599453300006046SoilMVVEVGPEIEQLVFEICRRPEQSVIQVLAPNDAD*
Ga0075029_10102855013300006052WatershedsMRAMVVEVGPEIEQLVFKICRRPEQQVIQIFASKSPD*
Ga0075017_10117072013300006059WatershedsMRAMVVEVGPEIEQLVFEIASRPEQQVIQILSAKGAD*
Ga0070716_10163723013300006173Corn, Switchgrass And Miscanthus RhizosphereMRAMVVEVVPELKEFIFEICGRPEQRVIQTLASNGAD*
Ga0075014_10005557333300006174WatershedsMGAMVVEVVAEIEQFIFEIYRRPEQRVIQTLASNGAD*
Ga0070712_10033020213300006175Corn, Switchgrass And Miscanthus RhizosphereMRAMVVEVGPEIEQLVFEICRRPEQQVIQILASQGSD*
Ga0070765_10003865323300006176SoilMRAMVVEIGSEIEQLVFEICRRPEQDVIQVLASNGAD*
Ga0070765_10210847613300006176SoilMMVVVVSEIEQFIFQIDSRPEQHVIQIFASNGANEPFHEGM
Ga0079221_1029087223300006804Agricultural SoilMVVEVVPELKEFIFEICGRPEQRVIQTLASNRTDEPFGERMREGNAGDALDF
Ga0066797_102403923300006864SoilMVVEVGPEIEQFVFEIYRRPEQHVIQILASKGAD*
Ga0099793_1002467143300007258Vadose Zone SoilMRAMVVEVGPEIEQLVFEIFRRPEQSVIQVLAPKGA
Ga0099793_1068790613300007258Vadose Zone SoilMRAMTVKVGPEIEQLVFEICRRPEQSVIQVLAPKGAD*
Ga0099794_1040921613300007265Vadose Zone SoilMRAMVVKVGPEIEQLVFEIGRRPEQSVIQVLAPKGAD*
Ga0104322_12131523300007819Permafrost SoilMRAMVVEVRPEIEQLVFEICRRPEQGVIQILASKGAD*
Ga0099827_1041308133300009090Vadose Zone SoilMVVEVGPEIEQLVFEVRSRPEQRVIQILASNGAD*
Ga0105242_1250741623300009176Miscanthus RhizosphereSPFPRGMRAMVVEVAPEIKQLVFQNCRRPEQHVI*
Ga0116221_153321123300009523Peatlands SoilMRAMVVEVGPEIEQFVFEIYRRPEQHVIQILASKGAD*
Ga0116225_148666323300009524Peatlands SoilMRAMVIEVGSEIEQFRFEICGCPEQHVIQILASNGTD*
Ga0126374_1005537013300009792Tropical Forest SoilMGAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD*
Ga0116223_1056256723300009839Peatlands SoilMRAMVVEIGPEVEQFVFEIHRRPEQHVIQILASNGAD*
Ga0116223_1061192723300009839Peatlands SoilMRAMVVEVGSEIEQFAFEIGTRPEQHVIQVLASNGAD*
Ga0126384_1065637233300010046Tropical Forest SoilMGAMVVEVGPEIEQLVFEIRRSPEQNAIQILLSVAN*
Ga0126373_1001789563300010048Tropical Forest SoilMGAMVVEVGPEIEQFVLEIRRSPEQNVIQVLPSNGAD*
Ga0126373_1010845543300010048Tropical Forest SoilMGAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAVL*
Ga0126373_1012145323300010048Tropical Forest SoilMGAMAVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD*
Ga0126373_1049442523300010048Tropical Forest SoilMGAMVVEVGPEIEQLVFEIRRSPEQNVIQILSSNSAD*
Ga0126373_1231336123300010048Tropical Forest SoilMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD*
Ga0127503_1016265323300010154SoilMRAMVVEVSPEIEQLVFEICRRPEQQVIQILSAKGAD*
Ga0134088_1052732323300010304Grasslands SoilMRAMVVEVAPEIEQLVFEIASRPEQQVIQILSAKGAD*
Ga0134065_1030364113300010326Grasslands SoilMRAMVVEVGPEIEQLVFEICRRPEQSVIQVLAPNDAD*
Ga0134065_1035916423300010326Grasslands SoilMRAMAVKVRPEIVQFVFEVCCRPKKHLIQILASDGA
Ga0134063_1039099613300010335Grasslands SoilMRAMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFDE
Ga0074046_1022399533300010339Bog Forest SoilMGAMVVEVGSEIKQFVFEIYSRPEQHVIQILASNGAD*
Ga0074046_1045926113300010339Bog Forest SoilMRAMVVEVGPEIEQLVFEIASRPEQQVIQILASNGAD*
Ga0074045_1002004893300010341Bog Forest SoilMRAMVVEVGPEIEQLVFEIASRPEQQVIQILASKRAD*
Ga0074045_1060551923300010341Bog Forest SoilMPAMVIEVGSEIEQFGFEICGRPEQHVIQILASNRAD*
Ga0126370_1023032023300010358Tropical Forest SoilMGAMVVEVGPEIEQLVLEIRRSPEQNVIQILPSNGAD*
Ga0126370_1026006313300010358Tropical Forest SoilMRAMVVEVGSEIEQLVFKVCGRPEQQVIQILASKGAD*
Ga0126378_1321510823300010361Tropical Forest SoilMGAMVVEVGPEIERLVFEIRRSPEQNVIQILPSNGAN*
Ga0134066_1004228523300010364Grasslands SoilMRAMMVEVCAEIEQLVFEIRSGPEQRAIQKLASNRADQ
Ga0126379_1011162213300010366Tropical Forest SoilMGAMVVEVGPEIEQLVFEIRRSPEQNLIQMLPSNGAD*
Ga0126381_10074647213300010376Tropical Forest SoilMVVEVGPEIEQLILEIRRSPEQNVIQILPSNGAD*
Ga0126381_10094497913300010376Tropical Forest SoilMGATVVEVSPEIEQLVFEIRRSPEQNVIQILPSNGAD*
Ga0126381_10118541523300010376Tropical Forest SoilMRAMVVEVAPEIEQLVFQICRRPEQHLIQILASKAADEPFHEGMG*
Ga0126381_10169171713300010376Tropical Forest SoilMGAMVVEVGLEIEQLVFEIRRSPEENVIQILPSNGAD*
Ga0126381_10216172213300010376Tropical Forest SoilMGAMVVEVGPEIEQLVFEIRRSPEQNVIQVLPSNGAD*
Ga0126381_10317219713300010376Tropical Forest SoilMGAMVVEVGPENEQLVFEIRRSPEQNVIQILPSNGAD*
Ga0136449_10086562923300010379Peatlands SoilMRAMVVKVGPEIEQLVFEICRRPEQQVIQILSAKGAD*
Ga0136449_10097851223300010379Peatlands SoilMRAMVVEVGSEIEQFAFEICSRPEQHVIQVLASNGAD*
Ga0136449_10245724313300010379Peatlands SoilMRAMVVEVGSEIEQFVFEICGRPEQHVIQILASNGAD*
Ga0136449_10401023313300010379Peatlands SoilMRAMVVEVGSEIEQFVFQICRRPEQHVIQILASNGAD*
Ga0150983_1644070313300011120Forest SoilMRAMVVKVGPEIEQLVFEIASRPEQQVIQILSAKGAD*
Ga0137391_1022915323300011270Vadose Zone SoilMRAMVVEVGPEIEQLVFEICSGPEQHAIQILASKGAD*
Ga0137393_1035821113300011271Vadose Zone SoilMRAMVVEIGPEIEQLVFEICRHPEQSVIQVLAPKGAD*
Ga0137389_1127033913300012096Vadose Zone SoilMRAMTVKVGPEIEQFVFEVCCRPKQHLIQILAPDGAD*
Ga0137383_1005184123300012199Vadose Zone SoilMRAMVVEVGPEIEQLVFEICRRPEQSVIQVLTPKGAD*
Ga0137383_1007555023300012199Vadose Zone SoilMRAIVVEVGSEIEQLAFKICSRPEQQVIKILESNRAD*
Ga0137383_1096764213300012199Vadose Zone SoilMRAMVVEVGPEIEQLVFEVCSRPEQRVIQMLASNGAD*
Ga0137382_1032492713300012200Vadose Zone SoilMRAMVVEVGPEIEQFVFEVCSGPEQHAIQILAPKGAD*
Ga0137377_1014501133300012211Vadose Zone SoilMRAMVVEVGPELEQFVFEVRRRPEQQVIQIFASQRADHS
Ga0137377_1194850913300012211Vadose Zone SoilMGALMVEVCPEIEQLVFEIRRGPEQGAIQILASNRADQ
Ga0137386_1001880283300012351Vadose Zone SoilMRAMVVKVGPEIEQLVFEICCRPKQRMIQIFASNGADQPFHKW
Ga0137385_1003434063300012359Vadose Zone SoilMSAMVVKVGPEIEQLVFEICCRPKQRMIQILASNG
Ga0137361_1029892523300012362Vadose Zone SoilMRAIVVEVGSEIEQLAFKICSRPEQQVIQILASNRAD*
Ga0134025_112679823300012378Grasslands SoilMRAMVLEVGPEIERLVFEICRCPEQHAIQILVSKGA
Ga0137398_1071385723300012683Vadose Zone SoilMRAMVVEVGPEIEQLLFEIRSCPEQRLIEILAAKGAD*
Ga0137398_1111646413300012683Vadose Zone SoilMGAMMVVVVLEIEQFIFQIDSRPEQRVIQTFASNGADEPLHEGKIRGIGEKN
Ga0137397_1028044113300012685Vadose Zone SoilMRAMVVEVGPEIEQLVFEVCRRPEQGVIQILAPKGAD*
Ga0137395_1038164423300012917Vadose Zone SoilMRAIVVEVSPEIEQLVFEICRRPEQSVIQVLASNGAD
Ga0137394_1014683343300012922Vadose Zone SoilMRAIVVEVGPEIEQLVFEICRRPEQSVIQVLAPKDAD*
Ga0137359_1084595723300012923Vadose Zone SoilMRAMVVEIGPEIEQLVFEIGRRPEQSVIQVLASNGAD*
Ga0137419_1003690023300012925Vadose Zone SoilMRAMVVEVGPEIEQLVFEIGRRPEQSVIQVLAPKGAD*
Ga0137419_1023129613300012925Vadose Zone SoilMRATVVEVRPEIEQLLFEICGRPEQRVIQILASNGAD*
Ga0137419_1035601313300012925Vadose Zone SoilMRAIVVEVSPEIEQLVFEICRGPEQSVIQALAPQGADEPFHE*
Ga0137416_1061973823300012927Vadose Zone SoilGMRATVVEVRPEIEQLLFEICGRPEQRVIQILASNGAD*
Ga0164299_1167401413300012958SoilMRAMVVKVDPEIEQLVFEIASRPEQQVIQILASQGSD*
Ga0126369_1068522023300012971Tropical Forest SoilMRPMVVKVGPEIEQFVFETCPSPEQYVIQILPSKSAD*
Ga0126369_1202845213300012971Tropical Forest SoilMGAMVVEVGPEIEQLVFEIRRGPEQNVIQILPSNGAD*
Ga0164304_1050356413300012986SoilMRAMVVEVSPEIEQLVFEICRCPEQQVIQILAAKGAD*
Ga0164305_1185966313300012989SoilMVVEVGPEIEQLVFEIASRPEQQVIQILASKGSD*
Ga0157374_1137221013300013296Miscanthus RhizosphereMRAMVVEVGPEIEQLVFEIASRPEQQVIQILASKGAD*
Ga0181532_1001430153300014164BogMLAMVVEVGPEIEQLVFEICRRPEKRVIQILASKGAD*
Ga0181526_1065037023300014200BogMLIEICPEIEQLVFQIRRGPEQRMIQILASNRADQPF
Ga0182024_1012522953300014501PermafrostMRAMVVEVRPEIEQLVFEICRRPEQAVIQILASKGAD*
Ga0137420_109202313300015054Vadose Zone SoilMRAMVVEVGPEIEQLVFEICRRPEQSVIQVLAPKGAD*
Ga0137418_1114239313300015241Vadose Zone SoilMRAMAVKVRPEIEQFVFEVCCRPKQHLIQILASDGAD*
Ga0132258_1190359223300015371Arabidopsis RhizosphereMRAMVVEVVPELEEFIFEICRRPEQRVIQILASNRADEPFDERM
Ga0182036_1018608053300016270SoilMRAMVVEVGPEIEQLVFEIASRPEEQVIQILASKGTD
Ga0182037_1039095433300016404SoilMRALVVEVGFEIEQFVFEIYRRPEQHVIQIIASKGAD
Ga0182038_1129249113300016445SoilMRAMVVEVAPEIKQLVFEICRRPEQQVIQILSAKGAD
Ga0134074_138424813300017657Grasslands SoilMMVEVCPEIEQLVFEIRRGPEQGAIQILASNGADQP
Ga0187806_107156413300017928Freshwater SedimentMRAMVVEVSPEIEQFVFEIYRRPEQHAIQILSSQGAD
Ga0187825_1031391223300017930Freshwater SedimentMRAMVVKVGPEIEQLVFEICGRPEQQVIQILSAKGAD
Ga0187814_1029274623300017932Freshwater SedimentMRAMVVEVGPEIEQLVFEISSRPEQQVIQILASKGAD
Ga0187814_1041222713300017932Freshwater SedimentMRAMVVEVGPEIEQLVFEIASRPEQQVIQILASKGAD
Ga0187809_1033411613300017937Freshwater SedimentMVVEVGTEIEQLVFEIGSRPEQQVIQILASNGPDQPFHERMG
Ga0187879_1056658413300017946PeatlandMIVEVCPEIEQLVFEIRCRPEQRTIQILASNRADQP
Ga0187804_1052534823300018006Freshwater SedimentMRAMVVEVDLGIEQLVFEICRRPEQPVIQILAAKGAD
Ga0066655_1121102023300018431Grasslands SoilMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFDER
Ga0210407_1005991713300020579SoilMRAMVVEVGPEIEQLVFEICRRPEQQVIQILSAKGAD
Ga0210407_1046769933300020579SoilMRAMVVEVAPEVEQFVFEICRRPEQQVIQILASNGAD
Ga0210407_1083854823300020579SoilMVVEVVPELEQFIFEICGRPEQRVIQILASNRADEPFDERM
Ga0210403_1043435613300020580SoilMRAMVVKVGPEIEQLVFEICRRPEQQVIQILSAKGAD
Ga0210399_1100554023300020581SoilMVVEVVPEIEQFIFEICSRPEQRVIQILTSNSADQPFDERM
Ga0210399_1138015413300020581SoilMRALVVEVGFEIEQFVFEIYRRPEQHVIQILASNGAD
Ga0210406_1007403313300021168SoilPMVVKVDPEIEQLVFEICRCPEQQVIQILSAKGAD
Ga0210406_1082758723300021168SoilMRAMVVEVGPEIEQLVFEIASRPEQQVIQIFASKSPD
Ga0210400_1063353713300021170SoilMGAMVVKAGPEIEQFILQICTRPEQHVIQIFASNGANEPF
Ga0210405_1007024133300021171SoilMRAMVVEVGPEIEQFVFEIASRPEQQVIQILASKGAD
Ga0210393_1081207913300021401SoilMRPMVVKVGPEIEQLVFEICCRPEQNVVQILPSNGS
Ga0210387_1023878013300021405SoilMRPMVVKVGSEIEQLVFEICRSPKQNVIQIFPSNG
Ga0210387_1173821213300021405SoilMRPMVVKVGPEIEQLVFEISRSPKQNVIQILPSDGAD
Ga0210386_1022417333300021406SoilMVVEVGPEIQQFILQICTRPEQHVIQIFASNGANEPFHEGMR
Ga0210394_1025278523300021420SoilMGAMVVEVGPENEQLILQICTRPEQHVIQIFASNG
Ga0210384_1029384423300021432SoilMRAMVVEVGPEIEQLVFEICRRPEQQVIQILAAKGAD
Ga0210402_1001167423300021478SoilMRAMVVEVGPEIEQLVFEIASRPEQQVVQILSAKGAD
Ga0210409_1053379223300021559SoilMRAMVVEVVPEIEQFIFEIYSRPEQRVIQTLASNGAD
Ga0210409_1064636613300021559SoilMVVEVVPEIEQFIFEIYSRPEQRVIQTLASNGADEPFDERVR
Ga0210409_1131258013300021559SoilMRAMVVEVSPEIEQLVFEICRCPEQQVIQILSAKGAD
Ga0126371_1178009713300021560Tropical Forest SoilMRAMVVEVGPEIKQLVFEIRRSPEQNVIQILPSNGAD
Ga0208715_108538013300025482Arctic Peat SoilMRAMVVEVGPEIEQFVFEIYRRPEQHVIQILASKGAD
Ga0207664_1100783823300025929Agricultural SoilMVVEVVPEIEQFIFEIYSRPEQRVIQTLASNGADEPFD
Ga0207665_1159650613300025939Corn, Switchgrass And Miscanthus RhizosphereMVVEVVPELKEFIFEICGRPEQRVIQTLASNRTDEPFGERMRKGNAG
Ga0209234_100307263300026295Grasslands SoilMRAMAVKVRPEIEQFVFEVCCRPKKHLIQILASDGAN
Ga0209470_103858563300026324SoilMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFHEWMG
Ga0209802_106701013300026328SoilMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPF
Ga0209802_132169913300026328SoilMVVEVVPELKQFIFEICGRPEQRVIQILASNRADEPFDERMRE
Ga0209377_100860113300026334SoilMVVKVGPEIEQLVFEICCRPKQRMIQIVASNGADQPFHKWMG
Ga0257159_100721613300026494SoilMVVEVGPEIEQFILQICTRPEQHVIQIFASNGANEPFHEG
Ga0207840_100622223300026910Tropical Forest SoilMGAMVVEVGPEIEQLVFEIRGSPEQNVIQILPSNGAD
Ga0207766_100407833300027042Tropical Forest SoilMVVEVGPEIEQLVFEIRRSPEQNVTQILPSNLNPA
Ga0209845_105406423300027324Groundwater SandMRAMIVEVGSEIEQLVFEILARPEQCAIQILPPYR
Ga0209736_111168433300027660Forest SoilMVVEVGPEIEQLVFEIFRRPEQHMIQILASKGAFP
Ga0209446_110707833300027698Bog Forest SoilMRPMVVKVGPEIEQLVFEICRSPKQNVIQILPSNGAVLWRSP
Ga0209689_102654673300027748SoilMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQ
Ga0209275_1001153443300027884SoilMRALVVEVGPEIEQLVFQICRRPKQRVIQILASKGAD
Ga0209067_1067657113300027898WatershedsMGAMVVEGVPEIEQFIFEIYSRPEQRVIQTLASNGAD
Ga0209006_1017365713300027908Forest SoilMGTMVIVVGPQIEQFILEICTRPEHHMIQIFASNGAD
Ga0137415_1001714823300028536Vadose Zone SoilMRAMTVKVGPEIEQFVFEVCCRPKQHLIQILAPDGAD
Ga0170824_11729263913300031231Forest SoilMRAMVVEVGPEIEQLVFEIASRPEQQAIQILASKGAD
Ga0170819_1191163013300031469Forest SoilMRAMVVKAGPEIEQLAFEICRRPEQQVIQILSAKGAD
Ga0170819_1419511313300031469Forest SoilMRPMVVKVGPEIEQLVFEICRSPKQNVIQILPSNG
Ga0170818_10288680013300031474Forest SoilMRPMVVKVGSEIEQLVFEICRSPKQNVIRILPSNGA
Ga0318528_1053121023300031561SoilMVVEVSPEIEQFVFQICSRPEQHVIQILASNGADQPFHEGIGQR
Ga0318573_1019513023300031564SoilGMGAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD
Ga0310686_10737034613300031708SoilMRAMVIEVGPEIEQLVFEICRRPEQQVIQILAAKGAD
Ga0310686_10830077723300031708SoilMVVVVGPEIQQFIFQIYTRPEQRMIQVFASNGTDEPFHE
Ga0306917_1022929633300031719SoilMGAMVVEVGPEIEQLVFEICRRPEQQVIQILASNGAD
Ga0306918_1005094113300031744SoilMGAMVVEVGPEIEQLVFEIRRSPEQNLIQILPSNGAD
Ga0307477_1079015623300031753Hardwood Forest SoilMVVEVGPEIEQLVFEICRCPEQCVIQILASNGADEPFHKWM
Ga0318529_1047867413300031792SoilMRVMVVEVGPEIEQLVFEVCRRPEQPVLQVFAPQR
Ga0310917_1072972113300031833SoilMRAMVVEVGPEIEQFVFEICRRPEQHVIQILASNGAD
Ga0315297_1163654813300031873SedimentMIVEVGPEIEQLVFEIRARPDQRAIEILAAKGPDG
Ga0306919_1048399923300031879SoilMGAMVVEVGPEIEQLVLEIRRSPEQNLIQILPSNGAD
Ga0306925_1012329623300031890SoilMRAMVVEVGFEIEQFVFQIYRRPEQHVIQILASKG
Ga0318520_1106650623300031897SoilMRAMVVEVGPEIEQLVFEICRRPEQQVIQILASKGAD
Ga0306921_1013149343300031912SoilMRALVVEAGFEIEQFVFEIYRRPEQHVIQIIASKGAD
Ga0310912_1049196613300031941SoilMGAMVVEVGPEIEQLVFEIRLSPEQNVIQILPSNGAD
Ga0310910_1153054913300031946SoilMVVEVAPEIEQLVFQICRRPEQHLIQILASNGADEPF
Ga0310909_1157575923300031947SoilMVVEVGPEIEQLVFQICRRPEQHVIQILASKGADE
Ga0306926_1075089113300031954SoilMRAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD
Ga0306926_1080367713300031954SoilMRAMVVEVGFEIEQFVFQIYRRPEQHVIQILASKGAD
Ga0307479_1040662113300031962Hardwood Forest SoilMRAMVVEVGPEIEQLVFEICSRPEQRVIQILASNRADQP
Ga0307479_1060793513300031962Hardwood Forest SoilMRAMVVEVVPEPEQFIFEICGRPEQRVIQTLASNRADEPFDERMR
Ga0306922_1008686313300032001SoilMVVEVGPEIERFVFQICRRPEQHVIQILASQGADEPLDHML
Ga0306922_1033820423300032001SoilMGAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAN
Ga0318504_1054330713300032063SoilMRAMVVEVGPEIEQLVFEICRRPEQQVIQILASNGAD
Ga0307471_10034612413300032180Hardwood Forest SoilMRAMVVEVVPEIEQFIFQIYSRPEQRVIQTLASNGAV
Ga0307472_10163913413300032205Hardwood Forest SoilMRALVVEVGPEIQQLVFKICRGPEQHVIQIFAWKSS
Ga0306920_10041534323300032261SoilMGAMVVEVGLEIEQLVLEIRRSPEQNVIQILPSNGAD
Ga0306920_10065666933300032261SoilMGAMVVEVGTEIEQLVFEIRRSPEQNVIKILPSKGTD
Ga0306920_10182757413300032261SoilMRAMVVEVGPEIEQFVFQICSRLEQHVIQILASKGAD
Ga0306920_10300164613300032261SoilALVVEVGPEIEQLVFEIASRPEQEVIQILASTGAD
Ga0326727_1077304913300033405Peat SoilMRAMVVEVGPEIEQLVFKICRRPEQGVIPILASKGADDPFHERMGQ
Ga0314861_0100289_573_6863300033977PeatlandMRAMVVEVGPEIEQLVLEICRRPEHRAIQILASKGAD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.