Basic Information | |
---|---|
Family ID | F027932 |
Family Type | Metagenome |
Number of Sequences | 193 |
Average Sequence Length | 42 residues |
Representative Sequence | VLVAVQLSVLGLYLPPVLKTLLLSPPPQTIISLPVHTAV |
Number of Associated Samples | 137 |
Number of Associated Scaffolds | 188 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 47.06 % |
% of genes near scaffold ends (potentially truncated) | 46.63 % |
% of genes from short scaffolds (< 2000 bps) | 56.48 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (50.259 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.062 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.907 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.332 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.85% β-sheet: 0.00% Coil/Unstructured: 70.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 188 Family Scaffolds |
---|---|---|
PF00982 | Glyco_transf_20 | 2.13 |
PF13418 | Kelch_4 | 1.60 |
PF06739 | SBBP | 1.06 |
PF11066 | DUF2867 | 0.53 |
PF01139 | RtcB | 0.53 |
PF00270 | DEAD | 0.53 |
PF06348 | DUF1059 | 0.53 |
PF06167 | Peptidase_M90 | 0.53 |
PF02954 | HTH_8 | 0.53 |
PF04828 | GFA | 0.53 |
PF04055 | Radical_SAM | 0.53 |
PF13462 | Thioredoxin_4 | 0.53 |
PF00990 | GGDEF | 0.53 |
PF00589 | Phage_integrase | 0.53 |
PF00903 | Glyoxalase | 0.53 |
PF07646 | Kelch_2 | 0.53 |
PF13964 | Kelch_6 | 0.53 |
PF01344 | Kelch_1 | 0.53 |
COG ID | Name | Functional Category | % Frequency in 188 Family Scaffolds |
---|---|---|---|
COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 2.13 |
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.53 |
COG3055 | N-acetylneuraminic acid mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
COG3228 | Mlc titration factor MtfA, regulates ptsG expression | Signal transduction mechanisms [T] | 0.53 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.26 % |
Unclassified | root | N/A | 49.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005093|Ga0062594_100865289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 847 | Open in IMG/M |
3300005174|Ga0066680_10553316 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 723 | Open in IMG/M |
3300005290|Ga0065712_10401503 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 731 | Open in IMG/M |
3300005454|Ga0066687_10576552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 668 | Open in IMG/M |
3300005467|Ga0070706_101524168 | Not Available | 611 | Open in IMG/M |
3300005552|Ga0066701_10962443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
3300005554|Ga0066661_10390452 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 852 | Open in IMG/M |
3300005557|Ga0066704_10504048 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 796 | Open in IMG/M |
3300005558|Ga0066698_10387156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 963 | Open in IMG/M |
3300005559|Ga0066700_10340744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1058 | Open in IMG/M |
3300005559|Ga0066700_10348464 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300005568|Ga0066703_10348000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 891 | Open in IMG/M |
3300005576|Ga0066708_10439305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 837 | Open in IMG/M |
3300005576|Ga0066708_10905899 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 550 | Open in IMG/M |
3300005587|Ga0066654_10128902 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300005764|Ga0066903_108939632 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
3300006797|Ga0066659_10667995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 847 | Open in IMG/M |
3300007258|Ga0099793_10287358 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300007258|Ga0099793_10687669 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300009012|Ga0066710_101440810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
3300009012|Ga0066710_104329564 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009094|Ga0111539_10445776 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1507 | Open in IMG/M |
3300009100|Ga0075418_11552748 | Not Available | 719 | Open in IMG/M |
3300009137|Ga0066709_100451242 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
3300009137|Ga0066709_103517711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
3300009147|Ga0114129_11555406 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 811 | Open in IMG/M |
3300009792|Ga0126374_11487890 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
3300010043|Ga0126380_11021063 | Not Available | 698 | Open in IMG/M |
3300010043|Ga0126380_11021063 | Not Available | 698 | Open in IMG/M |
3300010043|Ga0126380_12129651 | Not Available | 517 | Open in IMG/M |
3300010046|Ga0126384_10671245 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 915 | Open in IMG/M |
3300010047|Ga0126382_10302281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1202 | Open in IMG/M |
3300010048|Ga0126373_10597043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1156 | Open in IMG/M |
3300010048|Ga0126373_11344356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 780 | Open in IMG/M |
3300010048|Ga0126373_11679092 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 699 | Open in IMG/M |
3300010048|Ga0126373_11748858 | Not Available | 686 | Open in IMG/M |
3300010048|Ga0126373_12586383 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 566 | Open in IMG/M |
3300010301|Ga0134070_10238926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300010304|Ga0134088_10666778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
3300010320|Ga0134109_10423206 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
3300010321|Ga0134067_10238450 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 681 | Open in IMG/M |
3300010325|Ga0134064_10085220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1019 | Open in IMG/M |
3300010326|Ga0134065_10074912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1085 | Open in IMG/M |
3300010335|Ga0134063_10326631 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300010360|Ga0126372_10488267 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300010360|Ga0126372_13049136 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300010361|Ga0126378_10422049 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1447 | Open in IMG/M |
3300010362|Ga0126377_12573776 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 584 | Open in IMG/M |
3300010376|Ga0126381_105066696 | Not Available | 505 | Open in IMG/M |
3300010398|Ga0126383_12176497 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
3300012198|Ga0137364_10521594 | Not Available | 894 | Open in IMG/M |
3300012198|Ga0137364_10521594 | Not Available | 894 | Open in IMG/M |
3300012201|Ga0137365_10494055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 900 | Open in IMG/M |
3300012203|Ga0137399_11013032 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012205|Ga0137362_11666297 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300012351|Ga0137386_11037989 | Not Available | 582 | Open in IMG/M |
3300012354|Ga0137366_10603059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 787 | Open in IMG/M |
3300012357|Ga0137384_10979080 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300012362|Ga0137361_10691690 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 932 | Open in IMG/M |
3300012362|Ga0137361_11447389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
3300012362|Ga0137361_11655925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 560 | Open in IMG/M |
3300012363|Ga0137390_10696482 | Not Available | 978 | Open in IMG/M |
3300012517|Ga0157354_1075595 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
3300012683|Ga0137398_10659173 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300012902|Ga0157291_10184417 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012923|Ga0137359_10625494 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 943 | Open in IMG/M |
3300012924|Ga0137413_11335286 | Not Available | 577 | Open in IMG/M |
3300012925|Ga0137419_11316116 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 608 | Open in IMG/M |
3300012930|Ga0137407_10523286 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1109 | Open in IMG/M |
3300012944|Ga0137410_11931208 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300012955|Ga0164298_10408790 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 880 | Open in IMG/M |
3300012961|Ga0164302_10001624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7164 | Open in IMG/M |
3300012961|Ga0164302_10727307 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 739 | Open in IMG/M |
3300012971|Ga0126369_11261963 | Not Available | 829 | Open in IMG/M |
3300012971|Ga0126369_13471779 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
3300012977|Ga0134087_10140614 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300012984|Ga0164309_10681398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 813 | Open in IMG/M |
3300012985|Ga0164308_10098268 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2050 | Open in IMG/M |
3300012987|Ga0164307_10671760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
3300013296|Ga0157374_10813319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 950 | Open in IMG/M |
3300014150|Ga0134081_10255775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300015201|Ga0173478_10788960 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300015371|Ga0132258_10469511 | All Organisms → cellular organisms → Bacteria | 3140 | Open in IMG/M |
3300015371|Ga0132258_11608846 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
3300015372|Ga0132256_100037264 | All Organisms → cellular organisms → Bacteria | 4444 | Open in IMG/M |
3300015372|Ga0132256_100139984 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2413 | Open in IMG/M |
3300015373|Ga0132257_100042383 | All Organisms → cellular organisms → Bacteria | 5024 | Open in IMG/M |
3300015374|Ga0132255_101051252 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300015374|Ga0132255_104665256 | Not Available | 581 | Open in IMG/M |
3300016294|Ga0182041_10561817 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 998 | Open in IMG/M |
3300016357|Ga0182032_10430242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1073 | Open in IMG/M |
3300016387|Ga0182040_11798592 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
3300018028|Ga0184608_10433252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
3300018061|Ga0184619_10392023 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 629 | Open in IMG/M |
3300018433|Ga0066667_10029037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3081 | Open in IMG/M |
3300018433|Ga0066667_10133271 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
3300018433|Ga0066667_11708438 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
3300018482|Ga0066669_11447332 | Not Available | 623 | Open in IMG/M |
3300019886|Ga0193727_1121143 | Not Available | 747 | Open in IMG/M |
3300019999|Ga0193718_1068234 | Not Available | 762 | Open in IMG/M |
3300020004|Ga0193755_1186354 | Not Available | 604 | Open in IMG/M |
3300020006|Ga0193735_1006848 | All Organisms → cellular organisms → Bacteria | 3634 | Open in IMG/M |
3300020006|Ga0193735_1006848 | All Organisms → cellular organisms → Bacteria | 3634 | Open in IMG/M |
3300020006|Ga0193735_1006848 | All Organisms → cellular organisms → Bacteria | 3634 | Open in IMG/M |
3300020579|Ga0210407_10676376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 801 | Open in IMG/M |
3300024279|Ga0247692_1047246 | Not Available | 666 | Open in IMG/M |
3300025909|Ga0207705_10423101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1031 | Open in IMG/M |
3300026323|Ga0209472_1118196 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300026327|Ga0209266_1178105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 810 | Open in IMG/M |
3300026920|Ga0208575_1027161 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300028793|Ga0307299_10384544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300031469|Ga0170819_12236990 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031474|Ga0170818_115239681 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1049 | Open in IMG/M |
3300031912|Ga0306921_11202316 | Not Available | 844 | Open in IMG/M |
3300031946|Ga0310910_11494861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
3300031947|Ga0310909_10661061 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 870 | Open in IMG/M |
3300032012|Ga0310902_10450769 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300032180|Ga0307471_101134875 | Not Available | 947 | Open in IMG/M |
3300034965|Ga0370497_0086629 | Not Available | 733 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.70% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.11% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.07% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.55% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.55% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.04% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.04% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.52% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_02370790 | 2088090014 | Soil | VGALVVLVAIQLSVLGLYLPPVLSWLTLLTPPQTIISLPVQTAV |
Ga0063356_1049598652 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LLVLVAIQVLVLGLYLPPVFKYPPLLRPPQAIISVPVHTPV* |
Ga0062595_1026674131 | 3300004479 | Soil | PAGALVVLVADQLSVLGLYLAPVFETPTPLTVPPQTIISLPVQTAV* |
Ga0062594_1008652892 | 3300005093 | Soil | MVVVAVQLSVLGLYLPPVFETAELSSYPPQTIISLPVQTAV |
Ga0066680_105533162 | 3300005174 | Soil | LVVLVAIQLSVPGLYLPPVLKSLLELYPPQAIISLPVHTA |
Ga0066684_101026651 | 3300005179 | Soil | SGALVVLVAVQLSMLGSYLAPVFKVPLAVPPPQTIISLPVQIAVG* |
Ga0066684_107096672 | 3300005179 | Soil | VGALLVLVAVQLFVLGLYLPPVYKYGLPPQTIISLPVHTAV* |
Ga0065712_104015033 | 3300005290 | Miscanthus Rhizosphere | LLVLVAIQVSVPGLYLPPVFKYPPRLLPPQTIISVAVHTP |
Ga0070675_1002695873 | 3300005354 | Miscanthus Rhizosphere | MFVAVQLSVLGLYLPPVSNSPMLLLCPPQMIISLPVHTAV |
Ga0066687_105765522 | 3300005454 | Soil | VVLVAVQVSVPGLYLPPVFKTMFGPVNPPQTIISLPVHTA |
Ga0070706_1015241682 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLVALQVLLGLYLPPVSRIFVHGIPEHPPQTIISLPVHT |
Ga0066701_109624431 | 3300005552 | Soil | LVVLVAVQLSVPGSYLTPVLKKLLLPCPPQTIISLPVQT |
Ga0066661_103904522 | 3300005554 | Soil | TAVCSARPKGALVMLVAVQVFVPGLYLPPVFRKLPPITSPPQTIISFSVHTAV* |
Ga0066707_108086542 | 3300005556 | Soil | VVLVAVQLSVLGLYLPPVSQKSRSQSPYPPQTIISLPVQ |
Ga0066704_105040481 | 3300005557 | Soil | VGALEMLVAIQLSVPGSYLPPVFKRLKLKVSPPQTII |
Ga0066704_106511272 | 3300005557 | Soil | LLVLVSVQLSVTGLYLPPLLKRLLSPFHPPQMIISLPVQTAV |
Ga0066698_103871561 | 3300005558 | Soil | VVLVAVQVFVLGLYLPPVFKSLKVPTPPQTIISLPVQTAV* |
Ga0066700_103407441 | 3300005559 | Soil | LVVLVAIQLSVPGLYLPPVLKSLLELYPPQTIISLPVHTAV |
Ga0066700_103484643 | 3300005559 | Soil | MMLVAVQALVLGLYLSPVFKTLLLPYPPQTIISLSV |
Ga0066703_103480003 | 3300005568 | Soil | VVLVAVQVSVPGLYLPPVFKTMFGPVNPPQTIISL |
Ga0066702_105025603 | 3300005575 | Soil | VGALVVLVAVQLSVLGLYLPPLLKATPELDPPQTIISLPVHT |
Ga0066708_104393052 | 3300005576 | Soil | MVLVAVQLSVPAVYLPPVFKTPESPTPPQTIISLSVQTAV* |
Ga0066708_109058992 | 3300005576 | Soil | GAFVVLIAVQLSVVGLYLLPVLSGLPLRSVPPQMIISVPVHTAV* |
Ga0066654_101289021 | 3300005587 | Soil | VMLVAVQLSVLGSYSPPVFNSWKPLSSKYPPQTIISLPV |
Ga0068864_1009133731 | 3300005618 | Switchgrass Rhizosphere | VVLVAVQLSVLGLYLPPVFKKPLVPPPPQTIISLPSHTAVC |
Ga0066903_1033415282 | 3300005764 | Tropical Forest Soil | VLVAVQLSVLGLYLPPVLKLPPATWAPPQTIISLPV |
Ga0066903_1089396321 | 3300005764 | Tropical Forest Soil | VVLVAVQLSVPGLYLPPVLKIVGGFHPPQTIISLPVHTA |
Ga0081540_13526691 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VVLVAIQLSMLGSYVPPVFNTPLPPLPPQTVISLPVQTQ |
Ga0066696_107160791 | 3300006032 | Soil | VLVNVQLSVTGAYLPPLSKRPLVVPPPQMIISLPVHT |
Ga0070712_1003292181 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VGALVVLVAVQLSVLGLYLPPVFTKGVALSPPQTIISLP |
Ga0070712_1010780452 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VGALVKLVALQLSALGWYLPPVLKGGEPLTDPPQTIISLPVHTAV* |
Ga0066665_105838513 | 3300006796 | Soil | MVLVNVQLSVLGLYLPPVFKKLLIPSPPQAIISLPVQT |
Ga0066659_106679952 | 3300006797 | Soil | VGVQLSVLGSYLPPTFKKVLPFHPPQTIISLPVQTAV* |
Ga0079221_109889323 | 3300006804 | Agricultural Soil | MVLVAVQLSVLGLYLPPVLKKGQLPPQTIISLPIQIAV |
Ga0099793_102873581 | 3300007258 | Vadose Zone Soil | MVLVAVQLSVVGLYLPPVFKAPLELPPPQTIISLPV |
Ga0099793_106876691 | 3300007258 | Vadose Zone Soil | AEGAFVPLVAVQLSVLGLYRPPVFTWWRVLSLPPQMIISLPVHTAV* |
Ga0066710_1014408101 | 3300009012 | Grasslands Soil | VVLMAVQVSVLGLYLPPVFRMPVMLLCPPQTIISLPSQHAKCTLRW |
Ga0066710_1033594991 | 3300009012 | Grasslands Soil | LLVAVAIQVLVLGLYLPPVLRAVLSLAPPQTIISLPVHAGVRLYRP |
Ga0066710_1043295641 | 3300009012 | Grasslands Soil | MVLVAVQLSVPGLYLPPVLRTPGLCPSQTIISLPVHTAVCFSRPAGV |
Ga0111539_104457763 | 3300009094 | Populus Rhizosphere | VLVAIQVLVLGLYLPPVFKYPPLLRPPQAIISVPVHTPV* |
Ga0075418_115527482 | 3300009100 | Populus Rhizosphere | MGALVVLVAVQLSVLGLYLPPVLKYVLKSYPPQMIISLPVHTAV* |
Ga0075418_118016001 | 3300009100 | Populus Rhizosphere | MIRPSGALVVLVAVQLSVLGLYLPPVFNSLVAFCPPQTIISLPVQTAV* |
Ga0066709_1002994781 | 3300009137 | Grasslands Soil | WESRASGALVVLVAAQLFVAGVYLPLGLKSLNEPALPPQTIISLPVQTAV* |
Ga0066709_1004512421 | 3300009137 | Grasslands Soil | MLGTPVVLVAAQLSVLELYLPPVFKPPKLLPPQTIISVPVQTAV* |
Ga0066709_1007175042 | 3300009137 | Grasslands Soil | MVLVNVQLSVLGLYLPPVFKKLLIPSPPQAIISLPVQTAV* |
Ga0066709_1035177111 | 3300009137 | Grasslands Soil | VLVAIQLSALGSYLPPVFKAPLGLSPPQTIIWLPVHTAV |
Ga0114129_115554061 | 3300009147 | Populus Rhizosphere | VLVAVQLSVPGLYLPPVLKIFGGSHPPQTIISLPVHTAVC |
Ga0114129_135149571 | 3300009147 | Populus Rhizosphere | MIRPSGALVVLVAVQLSVLGLYLPPVFNSLVGFCPPQTIISLPVQTAV* |
Ga0075423_125405721 | 3300009162 | Populus Rhizosphere | MGALVVLVAVQLSVMGLYLPPVLKKVLPSHPPHTIISLPVQTAV* |
Ga0126374_114878901 | 3300009792 | Tropical Forest Soil | VALVAVQLSVPGLYLPPVFKLAKKLVPPQTIISLPVQTAV* |
Ga0126380_110210631 | 3300010043 | Tropical Forest Soil | EGALVVLVAVQLSVVGLYLPPVLLPAPFHTIISLPVQIAV* |
Ga0126380_110210632 | 3300010043 | Tropical Forest Soil | MLVGVQLFVLGLYLPPVFKKGIVGELSYPPQTIISPPVQT |
Ga0126380_121296512 | 3300010043 | Tropical Forest Soil | MCRAAGALVVLVGVQLSVAGLYLPPVLKSLLGFCPPQTIISVPVQTAV* |
Ga0126384_106712452 | 3300010046 | Tropical Forest Soil | LVVLVAVQLSVLGLYLPPVFVSLNEELRPAQTIISLPVHTAV* |
Ga0126382_103022812 | 3300010047 | Tropical Forest Soil | MVGVQESVLGLYLPPVFKSPKVKLNPPQTIISLPV |
Ga0126382_123865341 | 3300010047 | Tropical Forest Soil | MVLVAVQLSVLGLYLPPVLKTLTPFHPPQTIISLPVHTA |
Ga0126373_105970432 | 3300010048 | Tropical Forest Soil | VAVQLSVLELYLPPVLKKVLLLSMYPPQTIISLPVQTAA* |
Ga0126373_113443561 | 3300010048 | Tropical Forest Soil | VVLVAVQVSVLGLYLPPVFKKPGRKRYPPHTIISLLVQT |
Ga0126373_116790922 | 3300010048 | Tropical Forest Soil | MLVPVQLSVLGLYLPPVLKILCKSVPPQTIISLPVQTAV |
Ga0126373_117488581 | 3300010048 | Tropical Forest Soil | RAVGALVMLVAVQVFVVGLYLPPVLVPLPPQTIISVPVQTAV* |
Ga0126373_125863831 | 3300010048 | Tropical Forest Soil | MLVAVQLSVPGLYLPPVFKAMGPINPPQTTISVPVQTAV |
Ga0134070_102389261 | 3300010301 | Grasslands Soil | VVLMAVQVSVLGLYLPPVFRMPVMLLCPPQTIISLPSQHAKCTLRWS |
Ga0134088_106667781 | 3300010304 | Grasslands Soil | GALVVLVAVQLFVPGLYLPPVLKKPPTWPNPPQMIILLPVQTAV* |
Ga0134109_100698072 | 3300010320 | Grasslands Soil | VGALVVLVAVQLSVLGLYLPPVFKKGPLVPPQRIISLPIQTAV* |
Ga0134109_104232061 | 3300010320 | Grasslands Soil | APAVLVALQLSVPGLYLPPVFKSLPRRVPPQTIISLPVHTAV* |
Ga0134109_104451462 | 3300010320 | Grasslands Soil | LLVAVAIQVLVLGLYLPPVLRAVLSLAPPQTIISLPVH |
Ga0134067_102384502 | 3300010321 | Grasslands Soil | VGAFVVLVAVQLFVPRLYLPTVVDRLEPSNPPQMIISLPLHTA |
Ga0134064_100852201 | 3300010325 | Grasslands Soil | LVVLAASQLSVLGSYLPPVFKELENPDPPQTIISLPVHT |
Ga0134065_100749121 | 3300010326 | Grasslands Soil | VWFDLELGALAVLVAVQVSVAGLYLPPVFPEPQTIISLPVHIAV* |
Ga0134063_103266312 | 3300010335 | Grasslands Soil | VVLVDVQLSVLGLYLPPVFKSLLPSYPPQTIISLSVQTAV |
Ga0126372_104882672 | 3300010360 | Tropical Forest Soil | VLVAVQLSVLELYLPPVLKKVLLLSMYPPQTIISLPVQ |
Ga0126372_130491361 | 3300010360 | Tropical Forest Soil | VAVQLSVLGLYVPPVLKSLKKSSQHPPQTIISLSVH |
Ga0126378_104220491 | 3300010361 | Tropical Forest Soil | VLVIVQLSVVGLYLPPVLKAVLLSVPPQTIISLLVDTAV* |
Ga0126377_115523861 | 3300010362 | Tropical Forest Soil | MMLVAAQLSVLGLYLPPVLKKTVLVDPPQMIISVPVHTAV* |
Ga0126377_125737761 | 3300010362 | Tropical Forest Soil | PEGALAVFVDVQLSVSGLYLPPVLKKLELSFPPQTIISLPVHTAV* |
Ga0126377_128525751 | 3300010362 | Tropical Forest Soil | RPVGAFLVLVAIQLSVLGLYLPPVFKYILPSYPPQTIISLPVHTAV* |
Ga0105239_134492062 | 3300010375 | Corn Rhizosphere | LVVLVAVQLSVLGLYLPPVLKRIKNPEPQHPPQTIIS |
Ga0126381_1007919371 | 3300010376 | Tropical Forest Soil | VPYSGSGALVVVVAVQPAVLGLYLPPVLKGVHPLPHPPQTIISLPVQTAV* |
Ga0126381_1033617041 | 3300010376 | Tropical Forest Soil | NVLVATQLSVLGLYLPPVLKYVVAFCPPQTIMSLSVVQTAE* |
Ga0126381_1034046711 | 3300010376 | Tropical Forest Soil | MFVAVHESVLGLYLPPVLKTVLKAEDPPQTIISVPVHTAV* |
Ga0126381_1050666961 | 3300010376 | Tropical Forest Soil | VALVAVQLSVMGLYLLPVFKVPTPTTPPQTIISLPLHSAV* |
Ga0126383_121764971 | 3300010398 | Tropical Forest Soil | MMLVPVQLSVPGLYLPPLFKTFVPLNPPQTIISLPV |
Ga0137364_100956251 | 3300012198 | Vadose Zone Soil | MNRATGALVVLVAIQLSVPGLYRPPVFKSLLPLNPPQTIIS |
Ga0137364_105215941 | 3300012198 | Vadose Zone Soil | LVTLVAVQLSVLGLYLPPVFNALTSPNPPHTIISLPVQTAVC |
Ga0137364_105215942 | 3300012198 | Vadose Zone Soil | MVVVIVQLSVLGLYLPPVSKALTPSKPPQTIISLPVQTAV* |
Ga0137365_104940551 | 3300012201 | Vadose Zone Soil | KSRAEGALVVLVDVQLFVPGLYLPPVLKTLEPSNPPQMIISLPVHTAV* |
Ga0137399_110130321 | 3300012203 | Vadose Zone Soil | PGALVVLVAIQLSVPGLYLPPVLETLPESEPQLQTIISLPVQTAV* |
Ga0137362_102104061 | 3300012205 | Vadose Zone Soil | LVVLVGTQVSVLGLYLPPVFKSGPRFQPPQTIISVPVQTAVWRLRIEGAP |
Ga0137362_108931061 | 3300012205 | Vadose Zone Soil | VVLVAVQLLVLGLYLPPVFKPLKPSGVPPQTIISVPVQTAVC |
Ga0137362_116662971 | 3300012205 | Vadose Zone Soil | MVLVAVQLSVAGLYLPPVLLPTCPPQMIISLPVQTAV* |
Ga0137376_105976851 | 3300012208 | Vadose Zone Soil | MGALAVLVAVQESVLGLYLPPVLKGPDGLLTPPQTIISLPVHTAV* |
Ga0137378_103900913 | 3300012210 | Vadose Zone Soil | VGAPVVLVAVQLSVLGLYLPPVFPTLLPVPPQTIIWLPVQTA |
Ga0137387_110545091 | 3300012349 | Vadose Zone Soil | MLVAIQLSVLGLYLTPVFNGRKFPPTPPQTIISLPVQTAV* |
Ga0137387_112070591 | 3300012349 | Vadose Zone Soil | EGAVWVLVNVQLSVLGLYLPPVFRGRRLLKPPQMIISLPVHTAV* |
Ga0137386_110379891 | 3300012351 | Vadose Zone Soil | ALLVLVTVQLFVLGLYLPPVFKALSVFPPQTIISLPVQTAV* |
Ga0137366_106030591 | 3300012354 | Vadose Zone Soil | VGALVVLVGVQLFVLGLYLSPVFNAPALDSPPQTIISLPVQTAV |
Ga0137366_106454813 | 3300012354 | Vadose Zone Soil | MVLVAVQPSVPGSYLPPVLNKLVPTPPQTIISLPVQTAV* |
Ga0137384_109790801 | 3300012357 | Vadose Zone Soil | LVVLVAVQLSVLGLYLPPVFRKRLSPVPPQTIISLPVQTAV* |
Ga0137361_106916902 | 3300012362 | Vadose Zone Soil | LVVLVAVQLPVLGLYLPPVFNGLPLFPPQTIISLPAQT |
Ga0137361_114473891 | 3300012362 | Vadose Zone Soil | VGALVVLVAVQLFVLGLYLPPVLKTLTPFHPPQTIISLSVNTAV |
Ga0137361_116559252 | 3300012362 | Vadose Zone Soil | MVLVAVQVFVLGLYLPPVFKTPLVPIPPQTIISLPVQTAV |
Ga0137390_106964821 | 3300012363 | Vadose Zone Soil | VVVAVHVSVLGLYLPPVLKNVLHATSLHPPQTIIS |
Ga0157354_10755951 | 3300012517 | Unplanted Soil | GPMRAEGALVVLVAVQLFVLGLYLLPVFSQPLLSPPPQMIISLPVQTAV* |
Ga0137398_106591731 | 3300012683 | Vadose Zone Soil | MVLVADQLSVLGLYLPPVFRKRLSPVPPHTIISLPVHTAA* |
Ga0157294_102708451 | 3300012892 | Soil | AGALIVLVGVQLSVIGLYLPPVAPAFVPPKMIISLPVHTAV* |
Ga0157291_101844172 | 3300012902 | Soil | KSRAEGALVVLVDVQLFVPGLYLPPVLKTLPPLNPPQMIISLPVHTAV* |
Ga0137359_106254942 | 3300012923 | Vadose Zone Soil | VGALVVLVAVQLSVLGLYLPPLLKATPELNPPQTIISLPVHTAR* |
Ga0137359_109294981 | 3300012923 | Vadose Zone Soil | EGAPVVPVAVQLSVLGLYLPPVFRKLPGDSPPQTIISLPVQTAV* |
Ga0137413_113352862 | 3300012924 | Vadose Zone Soil | AGWCWARASGALVVLVAIQPSVLGLYLPPVLKKSLVPYPPQMIISLPVHTAV* |
Ga0137419_113161161 | 3300012925 | Vadose Zone Soil | ALVVLVPVQVSVPGLYLPPVLNKGPVLPPQTIISLPLQTAV* |
Ga0137407_105232862 | 3300012930 | Vadose Zone Soil | VVLVAIQLSVPGLYRPPVFNKPLLVPPQTIISVPVHTAV* |
Ga0137410_119312081 | 3300012944 | Vadose Zone Soil | GALIVVVAAQVSVGGLYIPPVFKPLKKTSSIPPQTIISLPVQVAV* |
Ga0164298_104087901 | 3300012955 | Soil | VGAPVVVVAVQLSVPALYLPPVFNPAYPPQTIISPPLQTAV |
Ga0164298_105636301 | 3300012955 | Soil | VVLVVVQVSALGLYLPPVLRGVLLSLPPQTIISLPVHTAV |
Ga0164301_108572451 | 3300012960 | Soil | VAIQLSVPGVYLPPVLNRVPPLAVPPQMTISLPVQIEL* |
Ga0164302_100016246 | 3300012961 | Soil | MLVATQLSVPGLYLPPLFKRTLFSSSPPHTIISLPVQSPV* |
Ga0164302_107273071 | 3300012961 | Soil | MVLVAVQLSVPGLYLPPVLKILGEFHPPQTIISLPVHTAAFWNRR |
Ga0126369_108038811 | 3300012971 | Tropical Forest Soil | ALAVLVVVQLSLLGLYLPPVLKKQELPHPAPPQMIISFSVHTAV* |
Ga0126369_112619632 | 3300012971 | Tropical Forest Soil | AVQLSVLGLYLPPVFREPLAPIPPQTIISVPVHTAV* |
Ga0126369_134717791 | 3300012971 | Tropical Forest Soil | MLVAVQLLVPGLYLPPVFKRPPGPAPPQTIISLPVQIA |
Ga0134087_101406141 | 3300012977 | Grasslands Soil | VVLVAVQLSVPGLYLPPVLKIVGGFHPPHTIISLPVHTAV |
Ga0164309_106813981 | 3300012984 | Soil | VVLVAVQLSVLGLYLPPVFNQKLPSYPPQTIISLP |
Ga0164308_100982682 | 3300012985 | Soil | LVVLVAVQLFVLGLYRPPVFKWRALPKPPQTIISLPVHTAV* |
Ga0164307_106717601 | 3300012987 | Soil | LVILVAVQLSLLELYLPPVFKKVKPPSGLPPQTIIWLAVQT |
Ga0157374_108133191 | 3300013296 | Miscanthus Rhizosphere | LIGALVILVAVQPSVLGLYRPPVLKTLTLLSPPQTIISLL |
Ga0157374_123257951 | 3300013296 | Miscanthus Rhizosphere | VGALVVLVAVQLSVLELYLPPVFKAWRPDPPHTIISLPVQTAE* |
Ga0157378_112856742 | 3300013297 | Miscanthus Rhizosphere | GALVVLVAIQLSVLGLYLPPVLKMVPLSSPPQTIISLPVHTAV* |
Ga0134081_102557751 | 3300014150 | Grasslands Soil | VVLMAVQVSVLGLYLPPVFRMPVMLLCPPQTIISLPSQHAK |
Ga0134079_104947972 | 3300014166 | Grasslands Soil | LPVLVAVQLSVLGLYLPPVFKGGTKKSGVPPQTIISLPVHTAVC |
Ga0163163_102583411 | 3300014325 | Switchgrass Rhizosphere | MLTAIQLFVPGLYLPPVLKLANEPSPPQTIISLPVHTALWRNRGAGA |
Ga0167638_10650583 | 3300015197 | Glacier Forefield Soil | MSRAAGAAVVLVAVQLSDAGLYFPPVLTTEPGNSPPHTIISLQ |
Ga0173478_107889601 | 3300015201 | Soil | LMVLVDAQLSVVALYLPPVLKLLPPPLPPHAIISLPVQTAV* |
Ga0137418_108197942 | 3300015241 | Vadose Zone Soil | VQTAAFEFRAAGAFVVLVAVQLSVLGLYFPPVFKLLMPSYPPQTIISLPVQTAV* |
Ga0137409_106537951 | 3300015245 | Vadose Zone Soil | FRAAGTPAGLVAVQLSVLGLYLAPVFKKLALLAPPQTIIWLPVHTAV* |
Ga0134085_104818142 | 3300015359 | Grasslands Soil | LVVLVAVQLSVLGSYLPPVFLAPALSRPDQTTILLP |
Ga0132258_104695111 | 3300015371 | Arabidopsis Rhizosphere | MLVAVHISVLGLYLPPEFKQEKPSYPPQTINTLPVQTAV* |
Ga0132258_105336432 | 3300015371 | Arabidopsis Rhizosphere | MLVAVQLFVPGSYLPPVFKKPLVALNPPHTIIWLPVHTAV* |
Ga0132258_116088462 | 3300015371 | Arabidopsis Rhizosphere | LVVLVDVQLFVLGLYLPPVLKTLPPLNPPQMIISLPVH |
Ga0132258_123821993 | 3300015371 | Arabidopsis Rhizosphere | LVVLVAIQLSVLGLYLPPVLKTSLPYPAQTIISLSVHTAV* |
Ga0132256_1000372643 | 3300015372 | Arabidopsis Rhizosphere | VWLTRPDGALVVLVAVQLFVFGLYFPPVLSKAPLLPQTIISLPVQTAV* |
Ga0132256_1001399842 | 3300015372 | Arabidopsis Rhizosphere | MLVAVHVSVLGLYLPPEFKQEKPSYPPQTINTLPVQTAV* |
Ga0132256_1023024881 | 3300015372 | Arabidopsis Rhizosphere | VGALVVLVGAQLSVLGLYLPPVLKELEPFHPAQTSISLPVQTAA* |
Ga0132257_1000423835 | 3300015373 | Arabidopsis Rhizosphere | MLVAVQPSVLALYLPPVLKSMVGQQKTPPQTIISPPVHTAV* |
Ga0132255_1010512523 | 3300015374 | Arabidopsis Rhizosphere | LLRAAVKLVAVQLSAPGLYLPPLFKEMPPVPPQTIISLPVHTAVC |
Ga0132255_1046652561 | 3300015374 | Arabidopsis Rhizosphere | FVVLVVVQLFMLGLYLPPVFEKPESPSPPQTIISLPVHTAV* |
Ga0182041_105618171 | 3300016294 | Soil | MGALVVLVGVQLSAPGLYLPPVLKFVVLSVPPQAIISL |
Ga0182035_118023341 | 3300016341 | Soil | KGAFAVLVDVQLSVLGLYLPPVLKLVGKGSPSPPQTIISLPVHTAV |
Ga0182032_104302421 | 3300016357 | Soil | VLIGIQVSVVGLYLPPFSPAVPPQTIISLPVQTAVC |
Ga0182040_117985922 | 3300016387 | Soil | VVLVAVQLPVPGLYLPPVLKTVGGSHPPQTIISLPVH |
Ga0184608_104332522 | 3300018028 | Groundwater Sediment | VLVGVQLSVLGVYLPPVTGSGVNIEPSLPPHTIISLPLQTAVC |
Ga0184619_103920231 | 3300018061 | Groundwater Sediment | LALVAVQPDVPGLYLPPVLNRSPTALLPPHTIISAPVQIAVWKNRAEG |
Ga0184618_105092392 | 3300018071 | Groundwater Sediment | VVLMGVQLSVLGLYLPPVLRPLMRSVVPPQTIISLPVHTAVLILRAMG |
Ga0066667_100290371 | 3300018433 | Grasslands Soil | VVFVAIQLFVPGSYLPPVFNRTKFWSVPPQTIISLPLQTA |
Ga0066667_101332713 | 3300018433 | Grasslands Soil | VVLVAVQLSVPGLYLPPVLKIVGGFHPPHTIISLPVHTAVCWNRPEGTLV |
Ga0066667_117084382 | 3300018433 | Grasslands Soil | VPVAVQLSVPGLHLPPVFTGGPLVSIPPQTIISVPVHTA |
Ga0066669_114473322 | 3300018482 | Grasslands Soil | LLVFVAVQLLVVGLYLPPVLKKLPLYPPQTIISLPVHTAV |
Ga0193700_10232612 | 3300019873 | Soil | AAGALVVLVAVQLSVLGLYLPPVFKLPPLLSPPQTIISLPVQTAV |
Ga0193722_11191361 | 3300019877 | Soil | LVVLVAVQLSVLGLYLPPVLTGGFPPQTIISLPLHT |
Ga0193727_11211432 | 3300019886 | Soil | VTGRASGALVVLVAVQLSVPGSYLPPVFESKIDGAYPAQTIISLPVHTAVCRDRAEG |
Ga0193718_10682343 | 3300019999 | Soil | RAEGALVVLVAVQLFVPGLYLPPVLKTMAPLNPPQMIISLPVHTAV |
Ga0193755_11863541 | 3300020004 | Soil | VLVAVQPSVPGLYLPPVLKYVGDASPPHTIISPPPVQTAVWYCRASG |
Ga0193735_10068485 | 3300020006 | Soil | VLVAVQLSVLGLYLPPVLKELLKSCPPQTIISLSVHTAV |
Ga0193735_10068487 | 3300020006 | Soil | VLVAVQLSVLGLYVPPVLRPWGLLSDPPQTIIPLPVHTAV |
Ga0193735_10068488 | 3300020006 | Soil | VLVAVQLSVLGLYLPPVLKTLLLSPPPQTIISLPVHTAV |
Ga0193726_11448572 | 3300020021 | Soil | VLVAVQLSVLGLYLPPVLKKKLIVSPDPPQTIISLPVQ |
Ga0210407_106763763 | 3300020579 | Soil | VMLVGTQLSVLGLYLPPVFRTLVALLYPPQTIISPPAQTAV |
Ga0224452_11924381 | 3300022534 | Groundwater Sediment | LVSVQLSVPGSYLPPVLVSVKPGTKPPHTIISLLVETAV |
Ga0224452_11924383 | 3300022534 | Groundwater Sediment | VVLVGIQLSEPGLYFPPVKAEPKSSTPPQTIISLPVQ |
Ga0222622_109886262 | 3300022756 | Groundwater Sediment | YRASGASVVVVGVQVFILGLYLPPVLKYVKLKVPPQTIISLPVHTAV |
Ga0247692_10472461 | 3300024279 | Soil | VVVVAVQLSVSGLYLPPEFRKPPLYPPQMIISLPLQTAV |
Ga0207705_104231011 | 3300025909 | Corn Rhizosphere | AVCQDRALGALAVLVAIQLFMLGLYLPRVEKSPPQTIISLPVQTAV |
Ga0207664_106233181 | 3300025929 | Agricultural Soil | VVLVVVQVSALGLYLPPVLRGALLSLPPQTIISLPVHTA |
Ga0209472_11181962 | 3300026323 | Soil | VVLVAVQLSVPGLYLPPVLKIVGGFHPPHTIISLPVHTAVCW |
Ga0209266_11781051 | 3300026327 | Soil | VVLVAVQLSMLGLYLPPVLKELTPFHPPQTIISRAVHTAVCWNR |
Ga0208575_10271612 | 3300026920 | Soil | VVLVDVQLSEPGLYLPPVFEVPEESSPPHTIMSLSAQTAV |
Ga0268266_115854792 | 3300028379 | Switchgrass Rhizosphere | GGLAVLVNVQLSVTGIYLPPLSKRPLVVPPPQMIISLPVHTAV |
Ga0307299_101549341 | 3300028793 | Soil | MVLVAVQLSVLGLYLPPVLKKPGGGRGPCPPQTIISLPVQ |
Ga0307299_103845441 | 3300028793 | Soil | AVHVSVLGSYLPPVFKKLLLLYPPQTIISLPVQTAV |
Ga0307312_110111882 | 3300028828 | Soil | AVCLDRAAGAFVMLVAVQLSVLGLYLPPVLKWLNASAPPQTIIWLPVHTAV |
Ga0170824_1167362241 | 3300031231 | Forest Soil | VWKNRADGALVVLVAVQLSVLGLYRPPVFKPLTPFCPPQTIISLP |
Ga0170819_122369901 | 3300031469 | Forest Soil | MVLVAVQVFVLGLYLPPVFKTTLKVPNPPQTIISLPVQTAV |
Ga0170818_1152396812 | 3300031474 | Forest Soil | VGAFVVLVAVQLSVIGSYLPPVFEKIPTFPPQTIISLPVHTAV |
Ga0306917_110347121 | 3300031719 | Soil | LVVLVAVQLSVLGSYLPPLLKNVTPPSNPPHTIIWLPVQTA |
Ga0307475_108711252 | 3300031754 | Hardwood Forest Soil | VLVAVQPSVLGLYLPPVLKALLASCPPQTIISLPVDTPVWEA |
Ga0307473_115156851 | 3300031820 | Hardwood Forest Soil | VVLVAVQLSVLGLYLPPVLEKGLPAVPPPQTIISLPVQ |
Ga0306921_112023161 | 3300031912 | Soil | MMLVAIHVFVLGLYLPPVFTLPPKVFPPQTIISLPVHTAV |
Ga0310910_114948612 | 3300031946 | Soil | VVLVAVQLFVLGLYLPPVLKSFEPTNPPQTIISLYV |
Ga0310909_106610612 | 3300031947 | Soil | VVVMAVQLFRVGSYLPPVLKILGGFHPPQTIISLPVHTA |
Ga0310902_104507691 | 3300032012 | Soil | MGVLVVLVAVQLSVLGSYLPPVFNSLPSNPPHTIISLPVHTAVF |
Ga0310902_112264371 | 3300032012 | Soil | VLVGVQLSLLGLYLPPVLKRMQLPIGPPVPPHTIISLPVHTAV |
Ga0308173_114860172 | 3300032074 | Soil | VGALVVLVAAQLSVLGLYRPPVLKRLPLLFPPQTIISLP |
Ga0307471_1011348751 | 3300032180 | Hardwood Forest Soil | VLVAIQPSVIGLYLPPVLKELLPLYPPQTIISLLVQIAVC |
Ga0370497_0086629_134_259 | 3300034965 | Untreated Peat Soil | LVLLVAVQLSVLGSYLPPVLKTPALAVPPQMIISLPLQTAV |
⦗Top⦘ |