NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027603

Metagenome / Metatranscriptome Family F027603

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027603
Family Type Metagenome / Metatranscriptome
Number of Sequences 194
Average Sequence Length 42 residues
Representative Sequence GDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND
Number of Associated Samples 153
Number of Associated Scaffolds 194

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.09 %
% of genes near scaffold ends (potentially truncated) 96.39 %
% of genes from short scaffolds (< 2000 bps) 91.24 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.938 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.340 % of family members)
Environment Ontology (ENVO) Unclassified
(23.711 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.938 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 20.59%    Coil/Unstructured: 79.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 194 Family Scaffolds
PF01322Cytochrom_C_2 1.03
PF04055Radical_SAM 0.52
PF12680SnoaL_2 0.52
PF10129OpgC_C 0.52
PF09084NMT1 0.52
PF07743HSCB_C 0.52
PF00656Peptidase_C14 0.52
PF00144Beta-lactamase 0.52
PF00675Peptidase_M16 0.52
PF12543DUF3738 0.52
PF02517Rce1-like 0.52
PF13709DUF4159 0.52
PF00768Peptidase_S11 0.52
PF00512HisKA 0.52
PF00069Pkinase 0.52
PF02687FtsX 0.52
PF05569Peptidase_M56 0.52
PF07690MFS_1 0.52
PF13249SQHop_cyclase_N 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 194 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.06
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.03
COG3909Cytochrome c556Energy production and conversion [C] 1.03
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.52
COG1076DnaJ domain-containing proteinPosttranslational modification, protein turnover, chaperones [O] 0.52
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.52
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.52
COG2367Beta-lactamase class ADefense mechanisms [V] 0.52
COG4249Uncharacterized conserved protein, contains caspase domainGeneral function prediction only [R] 0.52
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.52
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.45 %
UnclassifiedrootN/A1.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001372|YBBDRAFT_1194824All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300002124|C687J26631_10156197All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300004114|Ga0062593_100037655All Organisms → cellular organisms → Bacteria → Proteobacteria2855Open in IMG/M
3300004633|Ga0066395_10249850All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium950Open in IMG/M
3300004643|Ga0062591_101654014All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300004799|Ga0058863_10694178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300004803|Ga0058862_12870006All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005093|Ga0062594_101692248All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005183|Ga0068993_10399126All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300005330|Ga0070690_101094462All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005330|Ga0070690_101347759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300005332|Ga0066388_100153964All Organisms → cellular organisms → Bacteria2881Open in IMG/M
3300005332|Ga0066388_106140933All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300005335|Ga0070666_10739518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria722Open in IMG/M
3300005447|Ga0066689_10293163All Organisms → cellular organisms → Bacteria → Acidobacteria1008Open in IMG/M
3300005456|Ga0070678_101897036All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300005459|Ga0068867_101688177All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005534|Ga0070735_10175125All Organisms → cellular organisms → Bacteria → Proteobacteria1322Open in IMG/M
3300005540|Ga0066697_10471129All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300005541|Ga0070733_10001808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia15684Open in IMG/M
3300005541|Ga0070733_10982061All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300005548|Ga0070665_101514477Not Available679Open in IMG/M
3300005564|Ga0070664_100564742All Organisms → cellular organisms → Bacteria → Proteobacteria1053Open in IMG/M
3300005564|Ga0070664_101321194Not Available681Open in IMG/M
3300005586|Ga0066691_10671709All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005712|Ga0070764_10500797All Organisms → cellular organisms → Bacteria → Proteobacteria730Open in IMG/M
3300005713|Ga0066905_100076496All Organisms → cellular organisms → Bacteria → Acidobacteria2179Open in IMG/M
3300005764|Ga0066903_102437184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1012Open in IMG/M
3300005764|Ga0066903_103034920All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300005764|Ga0066903_105273667All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300005764|Ga0066903_106957436All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300005764|Ga0066903_107920781All Organisms → cellular organisms → Bacteria → Proteobacteria545Open in IMG/M
3300005764|Ga0066903_108542134All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005834|Ga0068851_11022880All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005840|Ga0068870_11354563All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300005841|Ga0068863_102314848All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300005842|Ga0068858_100524305All Organisms → cellular organisms → Bacteria → Acidobacteria1146Open in IMG/M
3300005921|Ga0070766_10358370All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300005921|Ga0070766_10650386All Organisms → cellular organisms → Bacteria → Proteobacteria711Open in IMG/M
3300006102|Ga0075015_100751592All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300006173|Ga0070716_101809906All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300006358|Ga0068871_101063509All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300006845|Ga0075421_101359681All Organisms → cellular organisms → Bacteria → Proteobacteria783Open in IMG/M
3300006845|Ga0075421_101741134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300006847|Ga0075431_101625930All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300006903|Ga0075426_11026022All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300006904|Ga0075424_100363872All Organisms → cellular organisms → Bacteria → Acidobacteria1541Open in IMG/M
3300006954|Ga0079219_10976319All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300007076|Ga0075435_101474256All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300009090|Ga0099827_10271502All Organisms → cellular organisms → Bacteria → Acidobacteria1430Open in IMG/M
3300009094|Ga0111539_13459991All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300009162|Ga0075423_12363034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300009174|Ga0105241_11652319All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300009176|Ga0105242_10410560All Organisms → cellular organisms → Bacteria → Acidobacteria1266Open in IMG/M
3300009176|Ga0105242_12251074All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300009523|Ga0116221_1340070All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300009839|Ga0116223_10648138All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300010047|Ga0126382_10540613All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300010048|Ga0126373_12338561All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300010358|Ga0126370_11583550All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300010362|Ga0126377_10019441All Organisms → cellular organisms → Bacteria5559Open in IMG/M
3300010362|Ga0126377_12018928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300010362|Ga0126377_13318605All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300010364|Ga0134066_10004714All Organisms → cellular organisms → Bacteria2478Open in IMG/M
3300010366|Ga0126379_12370665All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300010373|Ga0134128_10452941All Organisms → cellular organisms → Bacteria → Acidobacteria1432Open in IMG/M
3300010379|Ga0136449_100611624All Organisms → cellular organisms → Bacteria → Acidobacteria1854Open in IMG/M
3300010379|Ga0136449_103887929All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300010379|Ga0136449_104335872All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300010398|Ga0126383_12133367All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300010403|Ga0134123_12029574All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300010866|Ga0126344_1138765All Organisms → cellular organisms → Bacteria → Acidobacteria1581Open in IMG/M
3300010880|Ga0126350_10095881All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300011119|Ga0105246_11953204All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300011120|Ga0150983_12260884All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300011120|Ga0150983_14314333All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300011120|Ga0150983_14437177All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300011120|Ga0150983_15140875All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300011120|Ga0150983_15925271All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300011269|Ga0137392_11043707All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300011269|Ga0137392_11560986All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300011421|Ga0137462_1121350All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300012211|Ga0137377_10353044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1407Open in IMG/M
3300012212|Ga0150985_121091190All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium772Open in IMG/M
3300012212|Ga0150985_121660970All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia1770Open in IMG/M
3300012232|Ga0137435_1187715All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300012469|Ga0150984_109545956All Organisms → cellular organisms → Bacteria → Acidobacteria1563Open in IMG/M
3300012487|Ga0157321_1003610All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300012906|Ga0157295_10192638All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300012964|Ga0153916_12263375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300012984|Ga0164309_10508588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300013296|Ga0157374_10025131All Organisms → cellular organisms → Bacteria → Acidobacteria5344Open in IMG/M
3300013296|Ga0157374_12576112All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300013306|Ga0163162_12783866All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300013307|Ga0157372_10330663All Organisms → cellular organisms → Bacteria → Acidobacteria1774Open in IMG/M
3300013307|Ga0157372_10879224All Organisms → cellular organisms → Bacteria → Acidobacteria1040Open in IMG/M
3300013308|Ga0157375_12486633Not Available618Open in IMG/M
3300014162|Ga0181538_10499373All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300014201|Ga0181537_10506442All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300014489|Ga0182018_10060037All Organisms → cellular organisms → Bacteria → Acidobacteria2299Open in IMG/M
3300014489|Ga0182018_10565050All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300014495|Ga0182015_10934698All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300014495|Ga0182015_10969698All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300014838|Ga0182030_10294450All Organisms → cellular organisms → Bacteria → Acidobacteria1796Open in IMG/M
3300014969|Ga0157376_11377548All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300015371|Ga0132258_10543154All Organisms → cellular organisms → Bacteria2912Open in IMG/M
3300015372|Ga0132256_103683077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300015373|Ga0132257_102188870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi715Open in IMG/M
3300015374|Ga0132255_101301552All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300015374|Ga0132255_102986074All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300015374|Ga0132255_103411499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300015374|Ga0132255_103553396All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300016357|Ga0182032_11600791All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300016371|Ga0182034_11915725All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300016422|Ga0182039_12121854All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300016445|Ga0182038_12044643All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300017943|Ga0187819_10763130All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300017965|Ga0190266_10069936All Organisms → cellular organisms → Bacteria → Acidobacteria1329Open in IMG/M
3300017973|Ga0187780_10630006All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300018476|Ga0190274_12717882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia592Open in IMG/M
3300018476|Ga0190274_13752491All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300019192|Ga0184603_129706All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300020582|Ga0210395_10141966All Organisms → cellular organisms → Bacteria → Acidobacteria1790Open in IMG/M
3300021170|Ga0210400_11505972All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300021171|Ga0210405_11364533All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300021181|Ga0210388_10331840All Organisms → cellular organisms → Bacteria → Acidobacteria1337Open in IMG/M
3300021181|Ga0210388_10940263All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300021181|Ga0210388_11121469All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300021401|Ga0210393_10917554All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300021404|Ga0210389_10061696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae2874Open in IMG/M
3300021407|Ga0210383_11027324All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300021475|Ga0210392_11432738All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300021477|Ga0210398_10890349All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300021559|Ga0210409_10021953All Organisms → cellular organisms → Bacteria → Proteobacteria6191Open in IMG/M
3300021560|Ga0126371_12192907All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300021861|Ga0213853_10343327All Organisms → cellular organisms → Bacteria → Acidobacteria865Open in IMG/M
3300021861|Ga0213853_11197657All Organisms → cellular organisms → Bacteria → Acidobacteria1678Open in IMG/M
3300022195|Ga0222625_1666693All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300022214|Ga0224505_10268172All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300022528|Ga0242669_1038515All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300022533|Ga0242662_10141318All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300022533|Ga0242662_10295635All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300022906|Ga0247766_1049302All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300024552|Ga0256345_1064109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300025901|Ga0207688_10897784All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300025903|Ga0207680_10087453All Organisms → cellular organisms → Bacteria → Acidobacteria1973Open in IMG/M
3300025920|Ga0207649_10597906All Organisms → cellular organisms → Bacteria → Acidobacteria848Open in IMG/M
3300025923|Ga0207681_11255082All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300025927|Ga0207687_11270707All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300025931|Ga0207644_10730837All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300025935|Ga0207709_11596443All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300025936|Ga0207670_11052245All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300025937|Ga0207669_11298264All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300025940|Ga0207691_11669972All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300025941|Ga0207711_10871701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium837Open in IMG/M
3300025944|Ga0207661_10402266All Organisms → cellular organisms → Bacteria → Acidobacteria1242Open in IMG/M
3300025945|Ga0207679_10684325All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300025960|Ga0207651_10022499All Organisms → cellular organisms → Bacteria → Acidobacteria3855Open in IMG/M
3300026089|Ga0207648_11493429All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300026538|Ga0209056_10523277All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300027812|Ga0209656_10036057All Organisms → cellular organisms → Bacteria2888Open in IMG/M
3300027854|Ga0209517_10549011All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300027867|Ga0209167_10000817All Organisms → cellular organisms → Bacteria → Acidobacteria20525Open in IMG/M
3300027873|Ga0209814_10122569All Organisms → cellular organisms → Bacteria → Acidobacteria1109Open in IMG/M
3300027873|Ga0209814_10291458All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300027874|Ga0209465_10106772All Organisms → cellular organisms → Bacteria → Acidobacteria1375Open in IMG/M
3300027874|Ga0209465_10390569All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300029910|Ga0311369_11224911All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300030000|Ga0311337_11468015All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300031234|Ga0302325_10220651All Organisms → cellular organisms → Bacteria → Acidobacteria3221Open in IMG/M
3300031234|Ga0302325_12138973All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300031538|Ga0310888_10038497All Organisms → cellular organisms → Bacteria → Acidobacteria2167Open in IMG/M
3300031668|Ga0318542_10204532All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M
3300031681|Ga0318572_10809167All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300031708|Ga0310686_101602779All Organisms → cellular organisms → Bacteria → Acidobacteria1147Open in IMG/M
3300031708|Ga0310686_108090908All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300031858|Ga0310892_10888290All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300031890|Ga0306925_10588749All Organisms → cellular organisms → Bacteria → Acidobacteria1176Open in IMG/M
3300031890|Ga0306925_11299929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300031896|Ga0318551_10673715All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300031902|Ga0302322_100977864All Organisms → cellular organisms → Bacteria → Acidobacteria1018Open in IMG/M
3300031912|Ga0306921_10656062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1209Open in IMG/M
3300031942|Ga0310916_10777979All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300031946|Ga0310910_10005658All Organisms → cellular organisms → Bacteria → Acidobacteria7486Open in IMG/M
3300031946|Ga0310910_11122489All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300031954|Ga0306926_12544852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300032001|Ga0306922_12307732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300032075|Ga0310890_11482551All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300032261|Ga0306920_103199932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300032261|Ga0306920_104355948All Organisms → cellular organisms → Eukaryota508Open in IMG/M
3300032421|Ga0310812_10381179All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300032829|Ga0335070_11869675All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300033289|Ga0310914_11335058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300034820|Ga0373959_0217121All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.64%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.09%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.09%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.06%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.06%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.06%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.55%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.55%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.03%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.03%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.03%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.03%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.03%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.03%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.03%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.03%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.03%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.52%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.52%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.52%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.52%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.52%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.52%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.52%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.52%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.52%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.52%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019192Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300024552Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
YBBDRAFT_119482433300001372Marine EstuarineVKVKFIPAQNGSPLGFLKTVTYPDGHVIVVSAGGPND*
C687J26631_1015619713300002124SoilGPNALHTGDNIKVKFIPAKDGGPVGFLQTVTMPDGRVIQISGGGPNE*
Ga0062593_10003765533300004114SoilGENALHAGDMISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND*
Ga0066395_1024985013300004633Tropical Forest SoilGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0062591_10165401413300004643SoilTGPNALHAGDMISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND*
Ga0058863_1069417813300004799Host-AssociatedKTGPNALHAGDNITVKFIPARNGSPLGFLKTVTLPDGRVIQISAGNAND*
Ga0058862_1287000613300004803Host-AssociatedGDNIKVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0062594_10169224823300005093SoilDKIKVKFLPARNGSPLGFLKSVTLPDGRVIQISAGNPND*
Ga0068993_1039912623300005183Natural And Restored WetlandsDEISVKYIPARNGSPLGFLKSVTMPDGRVVQISAGNAND*
Ga0070690_10109446213300005330Switchgrass RhizosphereVGPTGQNALHQGDMVKVKYIPARNGSPLGFLKSVTYPDGRVVNISAGNPND*
Ga0070690_10134775923300005330Switchgrass RhizosphereNALHPGDKITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND*
Ga0066388_10015396433300005332Tropical Forest SoilTGDNITVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0066388_10614093313300005332Tropical Forest SoilNALHTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNVND*
Ga0070666_1073951823300005335Switchgrass RhizosphereGDEISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND*
Ga0066689_1029316313300005447SoilALHAGDNISVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0070678_10189703613300005456Miscanthus RhizosphereNALHAGDMISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND*
Ga0068867_10168817723300005459Miscanthus RhizosphereGQNALHQGDKITVKFIPARNGSPLGFLTSVKMPDGRVLNISSGNPND*
Ga0070735_1017512533300005534Surface SoilQGDKISVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0066697_1047112923300005540SoilKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0070733_1000180823300005541Surface SoilMRSIPGGGIKTKFLPARDGSPPGFLKTVIMPDGRVIQISAGNPND*
Ga0070733_1098206123300005541Surface SoilDAIKVKFLPARDGSPLGFLKVVTMPDGRLIQIAAPNATE*
Ga0070665_10151447723300005548Switchgrass RhizosphereKTGPNAMKVGDTLVVKFIPARNGSPLGFLKSVTLPDGRVIQISAGNPND*
Ga0070664_10056474223300005564Corn RhizosphereNALHAGDEISVKFIPARNGSPLGFLKSVTMPDGRVVMISAGNAND*
Ga0070664_10132119423300005564Corn RhizospherePNAMKVGDTLVVKFIPARNGSPLGFLKSVTLPDGRVIQISAGNPND*
Ga0066691_1067170923300005586SoilHTGDNIKVKFLPAKNGSPLGFLKSVTMPDGREIQISAVNPTD*
Ga0070764_1050079713300005712SoilRGIGKTGANALHAGDSIKVMFLPAKDGSPLGFLKTVTMPDGHVIQIAAPNATE*
Ga0066905_10007649623300005713Tropical Forest SoilTVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0066903_10243718423300005764Tropical Forest SoilPNALHAGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0066903_10303492023300005764Tropical Forest SoilDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0066903_10527366713300005764Tropical Forest SoilPNALHAGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGDPND*
Ga0066903_10695743613300005764Tropical Forest SoilITVKFLPAKDGSPLGFLKTVTMPDGRVIQISAGNPND*
Ga0066903_10792078123300005764Tropical Forest SoilPNALHQGDKITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0066903_10854213413300005764Tropical Forest SoilALHQGDQVKVKYIPARNGSPLGFLKSVTYPDGRVVNISTGNPND*
Ga0068851_1102288023300005834Corn RhizospherePNALHTGDNITVKFLPAIDGSPLGFLKTVVMPDGRVIQIFAGNPND*
Ga0068870_1135456323300005840Miscanthus RhizosphereDTIKATFIPARNGSPLGFLKSVTLTDGKVITISAGNPND*
Ga0068863_10231484823300005841Switchgrass RhizosphereHAGDMISVKFIPARNGSPLGFLKSVTMPDGRVVQISAGNAND*
Ga0068858_10052430513300005842Switchgrass RhizosphereENALHAGDKISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND*
Ga0070766_1035837013300005921SoilVMFLPAKDGSPLGFLKTVTMPDGRVIEIAAPNATE*
Ga0070766_1065038623300005921SoilDHVKVMFLPAKDGSPLGFLKTVTMPDGHLIQIAAPNATE*
Ga0075015_10075159223300006102WatershedsISVKFLPAKDGSPLGFLKTVTMPDGRVIQISAGNPND*
Ga0070716_10180990613300006173Corn, Switchgrass And Miscanthus RhizosphereKMKFLPARVGRPLGFLKTVIMPDGRVIRISAGNPSD*
Ga0068871_10106350913300006358Miscanthus RhizosphereAIKAKFIPAKDGSPLGFLKSVTYPDGHTVQISAGNPND*
Ga0075421_10135968123300006845Populus RhizosphereDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAANPND*
Ga0075421_10174113423300006845Populus RhizosphereKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNVND*
Ga0075431_10162593023300006847Populus RhizosphereGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAANPND*
Ga0075426_1102602223300006903Populus RhizosphereNALHTGDNITVKFLPARNGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0075424_10036387223300006904Populus RhizosphereKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNAND*
Ga0079219_1097631923300006954Agricultural SoilPITVKFIPAKDGSPLGFLKSVTYGDGHVIVVSGGNPND*
Ga0075435_10147425623300007076Populus RhizosphereKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAANPND*
Ga0099827_1027150223300009090Vadose Zone SoilLREPPARDGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0111539_1345999123300009094Populus RhizosphereLHAGDMISVKFIPARNGSPLGFLKSVTMPDGRVVQILAGNAND*
Ga0075423_1236303413300009162Populus RhizosphereTGDMITVKFLPAKNGSPLGFLKTVIMPDGRVIQISAGNANC*
Ga0105241_1165231913300009174Corn RhizosphereHAGDMISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND*
Ga0105242_1041056023300009176Miscanthus RhizosphereHTGDAIKARFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND*
Ga0105242_1225107413300009176Miscanthus RhizosphereITVKFLPAKNGSPLCFLKTVVMPDGRVIQVSAGNPND*
Ga0116221_134007023300009523Peatlands SoilAQRGVGRTGENALHNGDNIKIKFRPAKDGSPLGFLETVTMPDGRVINIAAPNATE*
Ga0116223_1064813823300009839Peatlands SoilKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE*
Ga0126382_1054061333300010047Tropical Forest SoilTGPNALHTGDKITVKFLPARDGSPLGFLKTVIMPDGRVIQISAGNANC*
Ga0126373_1233856113300010048Tropical Forest SoilKFLPAKDGSPRGFLKTVIMPDGRTIQISAGNPND*
Ga0126370_1158355013300010358Tropical Forest SoilTGPNALHTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0126377_1001944113300010362Tropical Forest SoilTVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0126377_1201892823300010362Tropical Forest SoilALHTGDNITVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0126377_1331860523300010362Tropical Forest SoilALHAGDEISVKFIPARNGSPLGLLKAVTMPDGREVAISAGNAND*
Ga0134066_1000471443300010364Grasslands SoilISVKFIPARNGSPLGFLKSVTMPDGRVVMISAGNAND*
Ga0126379_1237066513300010366Tropical Forest SoilKITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND*
Ga0134128_1045294113300010373Terrestrial SoilRSGPNALHPGDKITVKFLGARDGSPFGFLKTVTMPDGRVIQISAGSAND*
Ga0136449_10061162423300010379Peatlands SoilGRTGENALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE*
Ga0136449_10388792923300010379Peatlands SoilGENALHNGDNIKIKFRPAKDGSPLGFLETVTMPDGRVISIAAPNATE*
Ga0136449_10433587223300010379Peatlands SoilIKIKFRPAKDGSPLGFLETVTMPDGRVISIAAPNATE*
Ga0126383_1213336713300010398Tropical Forest SoilITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0134123_1202957413300010403Terrestrial SoilLHAGDNIKVKFIPAINGSPLGFLKSVTMPDGRVINISAGNPND*
Ga0126344_113876523300010866Boreal Forest SoilALHAGDNIKVMLLPAQDGSPLGFHKTVTMPDGHVIKIAAPNATE*
Ga0126350_1009588113300010880Boreal Forest SoilDQITVRYIPANNGSPLGFLKSVVMPDGREVKISAGNPTD*
Ga0105246_1195320423300011119Miscanthus RhizosphereAGDKISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND*
Ga0150983_1226088413300011120Forest SoilKFRPAKDGSPLGFLETVTMPDGRVISIAAPNATE*
Ga0150983_1431433313300011120Forest SoilALHTGDNISVKFLPAKDGSPLGFLKTVTYPDGHVIQISAGNPND*
Ga0150983_1443717713300011120Forest SoilIKVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNAND*
Ga0150983_1514087513300011120Forest SoilTGPNALHLGDNIKVKFIPAGNGSPLGFLKTVTMPDGRMISISAGNPND*
Ga0150983_1592527123300011120Forest SoilHAGDNIKVMFLPAKDGSPLGFLKTVTMPDGRLIQIAAPNATE*
Ga0137392_1104370713300011269Vadose Zone SoilGDKVTVKFLGARDGSPLGFLKTVVLPDGRVIQISGGNPTD*
Ga0137392_1156098613300011269Vadose Zone SoilNITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0137462_112135023300011421SoilTGPNALHAGDMIKVTFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND*
Ga0137377_1035304413300012211Vadose Zone SoilKFIPARNGSPLGFLKSVTMPDGRVIQISAGNPND*
Ga0150985_12109119013300012212Avena Fatua RhizosphereLHAGDNISVKFIPAKNGSPLGFLKSVTLPDGRVITISAGQAND*
Ga0150985_12166097033300012212Avena Fatua RhizosphereGDNISVKFVPAKNGSPLGFLKSVTFPDGHVVQISAGNAND*
Ga0137435_118771513300012232SoilLHTGDQIKVKFLPARDGSPLGFLKTVTMPDGRVITISGGNATD*
Ga0150984_10954595633300012469Avena Fatua RhizosphereGKTGANALHTGDKITVKFLPAKDGSPLGFLKTVIMPDGRAIQISAGNPND*
Ga0157321_100361013300012487Arabidopsis RhizosphereTGENALHAGDEISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND*
Ga0157295_1019263813300012906SoilEISVKFIPARNGSPLGFLKSVTMPDGRVVMISAGNAND*
Ga0153916_1226337513300012964Freshwater WetlandsDMISVKFIPARNGSPLGFLKSVTMPDGRVVQISAGNAND*
Ga0164309_1050858813300012984SoilLVSVKFIPAKNGSPLGFLKSVTFPDGHVVQISAGNAND*
Ga0157374_1002513143300013296Miscanthus RhizosphereKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND*
Ga0157374_1257611213300013296Miscanthus RhizosphereVKFIPAKNGAPLGFLKSVTFPDGHVVQISAGNAND*
Ga0163162_1278386613300013306Switchgrass RhizosphereGPNALKTGDAIKAKFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND*
Ga0157372_1033066323300013307Corn RhizospherePGDKITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND*
Ga0157372_1087922423300013307Corn RhizosphereALHPGDKITVKILGAMDGSPLGFLKTVTYPDGHVVQISAGNAND*
Ga0157375_1248663313300013308Miscanthus RhizosphereTLVVKFIPARNGSPLGFLKSVTLPDGRVIQISAGNPND*
Ga0181538_1049937323300014162BogGIGRTGENALHNGDPIKIRFRPAKDGSPLGFLLLVTMPDGHVIQIAAPNATE*
Ga0181537_1050644223300014201BogKFLPAKDGSPLGFLKTVTYPDGHVIQISAGNAND*
Ga0182018_1006003713300014489PalsaPGDNIKVMFLPAKDGSPLGFLKTVTMPDGRLVQIAAPNATE*
Ga0182018_1056505013300014489PalsaTGENALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE*
Ga0182015_1093469823300014495PalsaKTGPNALHAGDAVKVMFLPAKDGSPLGFLKTVTMPDGRVIQIAAPNATE*
Ga0182015_1096969823300014495PalsaVKFLPAKDGSPLGFLKTVTMPDGRVIQISAGNAND*
Ga0182030_1029445023300014838BogKFRPAKDGSPLGFLEIVTMPDGRQVMVAAPNATE*
Ga0157376_1137754813300014969Miscanthus RhizosphereGPNALHTGDAIKARFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND*
Ga0132258_1054315413300015371Arabidopsis RhizosphereISVKFIPARNGSPLGFLKSVTMPDGRLIQISAGNAND*
Ga0132256_10368307723300015372Arabidopsis RhizosphereHTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0132257_10218887023300015373Arabidopsis RhizosphereVSVKFIPAKNGAPLGFLKSVTYPDGHVVQISAGNAND*
Ga0132255_10130155213300015374Arabidopsis RhizosphereKTGPNALHTGDNIKVKFLPAKDGSPLGFLKTVTMPDGRVISISAGNAND*
Ga0132255_10298607413300015374Arabidopsis RhizosphereNALHSGDKITVKFLPARNGSPLGFLKTVVMPDGRVIQVSMGNPND*
Ga0132255_10341149923300015374Arabidopsis RhizosphereNALHTGDKITVKFLPARNGSPLGFLKTVVMPDGRVIQISAGNPND*
Ga0132255_10355339613300015374Arabidopsis RhizosphereALHAGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNAND*
Ga0182032_1160079113300016357SoilDNIKVKFIPAKDGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0182034_1191572513300016371SoilTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND
Ga0182039_1212185413300016422SoilTVKFLPARDGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0182038_1204464313300016445SoilHQGDKITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0187819_1076313013300017943Freshwater SedimentHAGDTIKVMFLPAKDGSPLGFLKTVTMPDGHVIQIAAPNATE
Ga0190266_1006993613300017965SoilNALHAGDMIKVSFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND
Ga0187780_1063000613300017973Tropical PeatlandHQGDEVKVKFLPARDGSPLGFLRTVIMPDGRVIQIAAGTPNE
Ga0190274_1271788223300018476SoilSVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND
Ga0190274_1375249113300018476SoilTGPNAIRTGDSIKIKFLPAKNGSPLGFLQSVTMPDGRVIQISGGGANE
Ga0184603_12970613300019192SoilNALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE
Ga0210395_1014196623300020582SoilKVMFLPARDGSPLGFLKTVTMPDGHVIQIAAPNATE
Ga0210400_1150597223300021170SoilNALHTGDNITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNAND
Ga0210405_1136453323300021171SoilITVKFLPAKDGSPLGFLKSVTMPDGRVIQISAGNPND
Ga0210388_1033184023300021181SoilLHAGDSIKVMFLPAKDGSPLGFLKTVTMPDGHVIEIAAPNATE
Ga0210388_1094026313300021181SoilDNALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE
Ga0210388_1112146923300021181SoilKVMFLPAKDGSPLGFLKTVTMPDGRVIQIAAPNATE
Ga0210393_1091755413300021401SoilTGENALHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE
Ga0210389_1006169633300021404SoilTGPNALHTGDNITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNAND
Ga0210383_1102732413300021407SoilDNIKVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0210392_1143273823300021475SoilLHTRDEIKVKFLPARDGIPLGFLKTVIIPDRRVIQISAGNPNGNPND
Ga0210398_1089034923300021477SoilKTGPNALHAGDNIKVMFLPAKDGSPLGFLKTVTMPDGRVIQIAAPNATE
Ga0210409_1002195333300021559SoilVKFLPARDGSPLGFLNTVIMPDGRVIQISAGNPND
Ga0126371_1219290713300021560Tropical Forest SoilNALHQGDKITVKFLPAKDGSPLGFLKTVIMPDGRTIQISAGNPND
Ga0213853_1034332713300021861WatershedsSISVKFLPAKDGSPLGFLKTVTMPDGRVIQISAGNPND
Ga0213853_1119765713300021861WatershedsHNGDSIKVKFRPAKDGSPLGFLQTVTMPDGRVIQIAAPNATE
Ga0222625_166669313300022195Groundwater SedimentNIKVKFLPAKNGSPLGFLKSVTMPDGRVIVVSAGNAND
Ga0224505_1026817213300022214SedimentNAIHPGDKIKFKFLPAKDGSPLGFLQTVTMPDGRVIQISGGGPNE
Ga0242669_103851513300022528SoilGKTGPNALRTGDEIKVKFLRAREGSPLGFLKNVIMSDGRVIRISAGNPND
Ga0242662_1014131823300022533SoilALHSGDKITVKFFPAKDGSPLGALRTVIMPDGRVIQISSGSPND
Ga0242662_1029563513300022533SoilKVMFLPAKDGSPLGFLKTVTMPDGHVIQIAAPNATE
Ga0247766_104930223300022906Plant LitterGIGRTGENALHAGDMISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND
Ga0256345_106410913300024552FreshwaterVKFLPAKDGSPLGFLKTVTYPDGHVIQISAGNAND
Ga0207688_1089778423300025901Corn, Switchgrass And Miscanthus RhizosphereALHAGDMITVKFIPARNGSPLGFLKSVTMPDGRVVQISAGNAND
Ga0207680_1008745323300025903Switchgrass RhizosphereGENALHAGDEISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND
Ga0207649_1059790623300025920Corn RhizosphereVKFIPARNGSPLGFLKSVTMPDGRVVQISAGNAND
Ga0207681_1125508213300025923Switchgrass RhizosphereGDKIKVKFLPAKNGSPLGFLKTVVMPDGREIQISAGNPND
Ga0207687_1127070723300025927Miscanthus RhizosphereARFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND
Ga0207644_1073083723300025931Switchgrass RhizosphereHAGDKISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND
Ga0207709_1159644323300025935Miscanthus RhizosphereGPNALHTGDAIKARFIPAKDGSPLGFLKSVTYPDGHVVQISAGNPND
Ga0207670_1105224523300025936Switchgrass RhizosphereAMKVGDTLVVKFIPARNGSPLGFLKSVTLPDGRVIQISAGNPND
Ga0207669_1129826413300025937Miscanthus RhizosphereKTGPNALHPGDKITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND
Ga0207691_1166997223300025940Miscanthus RhizosphereALHAGDEISVKYIPARNGSPLGFLKSVTMPDGRVVVISAGNAND
Ga0207711_1087170113300025941Switchgrass RhizosphereALHPGDKITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND
Ga0207661_1040226623300025944Corn RhizosphereITVKILGARDGSPLGFLKTVTYPDGHVVQISAGNAND
Ga0207679_1068432513300025945Corn RhizosphereGPNALHAGDEISVKFIPARNGSPLGFLKSVTMPDGRVVMISAGNAND
Ga0207651_1002249953300025960Switchgrass RhizosphereRGIGRTGENALHAGDKISVKFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND
Ga0207648_1149342913300026089Miscanthus RhizosphereRLAQRGIGPTGQNALHQGDKITVKFIPARNGSPLGFLTSVKMPDGRVLNISSGNPND
Ga0209056_1052327713300026538SoilPNALHTGDKITVKFFPARDGSPLGALKTVVMPDGRVIQISSGNVND
Ga0209656_1003605743300027812Bog Forest SoilALHTGDEIKVKFLPAKDGSPLGFLKTVIMPDGRVIQTSAGRPND
Ga0209517_1054901113300027854Peatlands SoilHNGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVIQVAAPNATE
Ga0209167_10000817193300027867Surface SoilMRSIPGGGIKTKFLPARDGSPPGFLKTVIMPDGRVIQISAGNPND
Ga0209814_1012256913300027873Populus RhizosphereGDKITVKFLPARDGSPLGFLKTVVMPDGRVIQISAGNPND
Ga0209814_1029145823300027873Populus RhizosphereGDKITVKFLPAKNGSPLGFLKTVVMPDGRVIQISAGNPND
Ga0209465_1010677223300027874Tropical Forest SoilITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGDPND
Ga0209465_1039056913300027874Tropical Forest SoilITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND
Ga0311369_1122491113300029910PalsaALHAGDSIKVMFLPAKDGSPLGFLKTVTMPDGHVIEIAAPNATE
Ga0311337_1146801523300030000FenGKIGPNALHTGDNIKVKFLPAKDNSPLGFLKSVTYPDGHVIQISAGVGNE
Ga0302325_1022065113300031234PalsaGDAIKIRFRPAKDGSPLGFLLLVTMPDGHVITVAAPNATE
Ga0302325_1213897313300031234PalsaHAGDAIKVMFLPAKDGSPLGFLKTVTMPDGHVIQIAAPNATE
Ga0310888_1003849713300031538SoilGDEISVKFIPARNGSPLGFLKSVTMPDGRVIQISAGNAND
Ga0318542_1020453223300031668SoilLHAGDKISVKLLPARDGSPLGFLKTVTMPDGRVIQISAGNPND
Ga0318572_1080916723300031681SoilDKISVKLLPARDGSPLGFLKTVTMPDGRVIQISAGNPND
Ga0310686_10160277913300031708SoilIKVMFLPAKDGSPLGFLKTVTMPDGRVIQIAAPNATE
Ga0310686_10809090823300031708SoilLKLLPARDGSPLGFFKTVIMPDGRVVRISAGNPND
Ga0310892_1088829023300031858SoilNALHAGDMIKVLFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND
Ga0306925_1058874923300031890SoilLHVGDNIKVKFIPAKDGSPLGFLKTVIMPDGRTIQISAGNPND
Ga0306925_1129992913300031890SoilRAGDNITVKFLPARDGSPLGFLKTVIMPDGRVIQISADNPND
Ga0318551_1067371523300031896SoilGPNALHAGDKISVKLLPARDGSPLGFLKTVTMPDGRVIQISAGNPND
Ga0302322_10097786413300031902FenIGPNALHTGDNIKVKFLPAKDNSPLGFLKSVTYPDGHVIQISAGIGNE
Ga0306921_1065606213300031912SoilMLRAGDNITVKFLPARDGSPLGFLKTVIMPDGRVIQISADNPND
Ga0310916_1077797913300031942SoilLHAGDNIKVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0310910_10005658113300031946SoilSVKLLPARDGSPLGFLKTVTMPDGRVIQISAGNPND
Ga0310910_1112248923300031946SoilLHVGDNIKVKFIPAKDGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0306926_1254485223300031954SoilVKFLPARDTSPLGFLKTVIMPDGRVVQISAGNPND
Ga0306922_1230773223300032001SoilGPNALHVGDNITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0310890_1148255113300032075SoilMIKVQFIPARSGAPLGFLKSVTMPDGRVVQISAGNAND
Ga0306920_10319993213300032261SoilGDDITVKFLPARNGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0306920_10435594813300032261SoilVTVKYAPARDGSPLGFLKSITTPDGKVINISAGAASD
Ga0310812_1038117913300032421SoilGPNALHTGDKITVKFLPAKDGSPLGFLKTVVMPDGRVIQISAGNPND
Ga0335070_1186967523300032829SoilKITVKFLPAKDGSPLGFLKTVIMPDGRVIQISAGNPND
Ga0310914_1133505823300033289SoilDNITVKFLPARDESPLGFLKTVIMPDGRVIEISADNPND
Ga0373959_0217121_394_5103300034820Rhizosphere SoilKITVKFLPARDGSPLGFLKTVVMPDGRVIQISAGNAND


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.