NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027187

Metagenome / Metatranscriptome Family F027187

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027187
Family Type Metagenome / Metatranscriptome
Number of Sequences 195
Average Sequence Length 46 residues
Representative Sequence MDAILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQTAY
Number of Associated Samples 152
Number of Associated Scaffolds 195

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.17 %
% of genes near scaffold ends (potentially truncated) 89.23 %
% of genes from short scaffolds (< 2000 bps) 82.56 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.641 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(25.128 % of family members)
Environment Ontology (ENVO) Unclassified
(30.769 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.974 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.00%    β-sheet: 0.00%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 195 Family Scaffolds
PF01261AP_endonuc_2 3.08
PF01850PIN 1.54
PF13271DUF4062 1.54
PF00072Response_reg 1.54
PF12146Hydrolase_4 1.54
PF00156Pribosyltran 1.03
PF02021UPF0102 1.03
PF04552Sigma54_DBD 1.03
PF02129Peptidase_S15 1.03
PF09848DUF2075 1.03
PF12704MacB_PCD 1.03
PF09957VapB_antitoxin 1.03
PF13432TPR_16 1.03
PF00106adh_short 1.03
PF00581Rhodanese 1.03
PF01288HPPK 1.03
PF00248Aldo_ket_red 1.03
PF13672PP2C_2 0.51
PF00501AMP-binding 0.51
PF01436NHL 0.51
PF00731AIRC 0.51
PF00155Aminotran_1_2 0.51
PF01593Amino_oxidase 0.51
PF13586DDE_Tnp_1_2 0.51
PF06071YchF-GTPase_C 0.51
PF08502LeuA_dimer 0.51
PF00392GntR 0.51
PF01262AlaDh_PNT_C 0.51
PF00144Beta-lactamase 0.51
PF08867FRG 0.51
PF02310B12-binding 0.51
PF02113Peptidase_S13 0.51
PF06733DEAD_2 0.51
PF02586SRAP 0.51
PF01048PNP_UDP_1 0.51
PF04794YdjC 0.51
PF07969Amidohydro_3 0.51
PF13546DDE_5 0.51
PF08541ACP_syn_III_C 0.51
PF01148CTP_transf_1 0.51
PF01934HepT-like 0.51
PF10410DnaB_bind 0.51
PF10263SprT-like 0.51
PF06283ThuA 0.51
PF064393keto-disac_hyd 0.51
PF00300His_Phos_1 0.51
PF07977FabA 0.51
PF12244DUF3606 0.51
PF01882DUF58 0.51
PF04365BrnT_toxin 0.51
PF04255DUF433 0.51
PF00206Lyase_1 0.51
PF07992Pyr_redox_2 0.51
PF13620CarboxypepD_reg 0.51
PF13155Toprim_2 0.51
PF02954HTH_8 0.51
PF00430ATP-synt_B 0.51
PF02225PA 0.51
PF05221AdoHcyase 0.51
PF02153PDH_N 0.51
PF00326Peptidase_S9 0.51
PF03063Prismane 0.51
PF00670AdoHcyase_NAD 0.51
PF00294PfkB 0.51
PF00704Glyco_hydro_18 0.51
PF00795CN_hydrolase 0.51
PF05016ParE_toxin 0.51
PF02472ExbD 0.51
PF15919HicB_lk_antitox 0.51
PF02561FliS 0.51
PF00152tRNA-synt_2 0.51
PF01609DDE_Tnp_1 0.51
PF02661Fic 0.51
PF13744HTH_37 0.51
PF03023MurJ 0.51
PF04456DUF503 0.51
PF00154RecA 0.51
PF10418DHODB_Fe-S_bind 0.51
PF00990GGDEF 0.51
PF02565RecO_C 0.51
PF00202Aminotran_3 0.51
PF02913FAD-oxidase_C 0.51
PF02367TsaE 0.51
PF11967RecO_N 0.51
PF03466LysR_substrate 0.51
PF00849PseudoU_synth_2 0.51
PF04295GD_AH_C 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 195 Family Scaffolds
COG1516Flagellin-specific chaperone FliSCell motility [N] 1.54
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 1.03
COG0792Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 familyReplication, recombination and repair [L] 1.03
COG08017,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis)Coenzyme transport and metabolism [H] 1.03
COG1199Rad3-related DNA helicase DinGReplication, recombination and repair [L] 1.03
COG1508DNA-directed RNA polymerase specialized sigma subunit, sigma54 homologTranscription [K] 1.03
COG0012Ribosome-binding ATPase YchF, GTP1/OBG familyTranslation, ribosomal structure and biogenesis [J] 0.51
COG0017Aspartyl/asparaginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.51
COG0119Isopropylmalate/homocitrate/citramalate synthasesAmino acid transport and metabolism [E] 0.51
COG0173Aspartyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.51
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.51
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.51
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.51
COG0534Na+-driven multidrug efflux pump, DinF/NorM/MATE familyDefense mechanisms [V] 0.51
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 0.51
COG0711FoF1-type ATP synthase, membrane subunit b or b'Energy production and conversion [C] 0.51
COG0728Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis)Cell wall/membrane/envelope biogenesis [M] 0.51
COG07643-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydrataseLipid transport and metabolism [I] 0.51
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.51
COG0802tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaETranslation, ribosomal structure and biogenesis [J] 0.51
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.51
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 0.51
COG1151Hydroxylamine reductase (hybrid-cluster protein)Energy production and conversion [C] 0.51
COG1152CO dehydrogenase/acetyl-CoA synthase alpha subunitEnergy production and conversion [C] 0.51
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 0.51
COG1190Lysyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.51
COG1381Recombinational DNA repair protein RecO (RecF pathway)Replication, recombination and repair [L] 0.51
COG1550Stress-induced protein YlxP, DUF503 familyFunction unknown [S] 0.51
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.51
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.51
COG1721Uncharacterized conserved protein, DUF58 family, contains vWF domainFunction unknown [S] 0.51
COG2027D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.51
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.51
COG2244Membrane protein involved in the export of O-antigen and teichoic acidCell wall/membrane/envelope biogenesis [M] 0.51
COG2269Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)Translation, ribosomal structure and biogenesis [J] 0.51
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.51
COG2367Beta-lactamase class ADefense mechanisms [V] 0.51
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.51
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 0.51
COG2721Altronate dehydrataseCarbohydrate transport and metabolism [G] 0.51
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.51
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.51
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.51
COG3293TransposaseMobilome: prophages, transposons [X] 0.51
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.51
COG3394Chitooligosaccharide deacetylase ChbG, YdjC/CelG familyCarbohydrate transport and metabolism [G] 0.51
COG4706Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domainLipid transport and metabolism [I] 0.51
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 0.51
COG5421TransposaseMobilome: prophages, transposons [X] 0.51
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.51
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.15 %
UnclassifiedrootN/A13.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_100537017All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium758Open in IMG/M
3300004082|Ga0062384_100583111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae754Open in IMG/M
3300004082|Ga0062384_100856430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis640Open in IMG/M
3300004092|Ga0062389_100110316All Organisms → cellular organisms → Bacteria2468Open in IMG/M
3300004092|Ga0062389_100392745All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300004092|Ga0062389_102586621All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae675Open in IMG/M
3300004635|Ga0062388_101599268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4662Open in IMG/M
3300005338|Ga0068868_102237687All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia521Open in IMG/M
3300005539|Ga0068853_100169615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1974Open in IMG/M
3300006059|Ga0075017_100304804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41177Open in IMG/M
3300006086|Ga0075019_10255364All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300006358|Ga0068871_102068693All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300009137|Ga0066709_101253299All Organisms → cellular organisms → Bacteria → Acidobacteria1090Open in IMG/M
3300009510|Ga0116230_10102845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2444Open in IMG/M
3300009519|Ga0116108_1009187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683806Open in IMG/M
3300009520|Ga0116214_1120101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium971Open in IMG/M
3300009553|Ga0105249_10167969All Organisms → cellular organisms → Bacteria2125Open in IMG/M
3300009640|Ga0116126_1053697All Organisms → cellular organisms → Bacteria → Acidobacteria1567Open in IMG/M
3300009640|Ga0116126_1077281All Organisms → cellular organisms → Bacteria → Acidobacteria1228Open in IMG/M
3300009698|Ga0116216_10182496All Organisms → cellular organisms → Bacteria → Acidobacteria1288Open in IMG/M
3300009701|Ga0116228_11071581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae535Open in IMG/M
3300009709|Ga0116227_10952975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3646Open in IMG/M
3300012208|Ga0137376_10392795Not Available1205Open in IMG/M
3300012350|Ga0137372_11110587Not Available542Open in IMG/M
3300012931|Ga0153915_10654866Not Available1211Open in IMG/M
3300012944|Ga0137410_11842264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4535Open in IMG/M
3300013296|Ga0157374_11249443Not Available764Open in IMG/M
3300014151|Ga0181539_1343006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4541Open in IMG/M
3300014152|Ga0181533_1213536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae738Open in IMG/M
3300014155|Ga0181524_10315332Not Available707Open in IMG/M
3300014160|Ga0181517_10297444All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300014160|Ga0181517_10545022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068584Open in IMG/M
3300014161|Ga0181529_10244597All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300014161|Ga0181529_10447270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola → Granulicella tundricola MP5ACTX9691Open in IMG/M
3300014165|Ga0181523_10465870Not Available700Open in IMG/M
3300014167|Ga0181528_10222250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1019Open in IMG/M
3300014168|Ga0181534_10003279All Organisms → cellular organisms → Bacteria9654Open in IMG/M
3300014168|Ga0181534_10032866All Organisms → cellular organisms → Bacteria2575Open in IMG/M
3300014200|Ga0181526_11036060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales515Open in IMG/M
3300014489|Ga0182018_10614684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter570Open in IMG/M
3300014492|Ga0182013_10521562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis parvus615Open in IMG/M
3300014493|Ga0182016_10183149All Organisms → cellular organisms → Bacteria → Nitrospirae1371Open in IMG/M
3300014494|Ga0182017_10134671Not Available1604Open in IMG/M
3300014496|Ga0182011_10398496All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300014496|Ga0182011_10532770Not Available753Open in IMG/M
3300014498|Ga0182019_10073123All Organisms → cellular organisms → Bacteria2038Open in IMG/M
3300014498|Ga0182019_11281327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4540Open in IMG/M
3300014501|Ga0182024_11087828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis945Open in IMG/M
3300014655|Ga0181516_10586480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus575Open in IMG/M
3300014655|Ga0181516_10661411Not Available540Open in IMG/M
3300014657|Ga0181522_10079800All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300014838|Ga0182030_10252158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2015Open in IMG/M
3300014838|Ga0182030_10636852All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300014839|Ga0182027_10165951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682588Open in IMG/M
3300017929|Ga0187849_1142490All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300017975|Ga0187782_11680611All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300017988|Ga0181520_11022530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4546Open in IMG/M
3300018008|Ga0187888_1396706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4521Open in IMG/M
3300018012|Ga0187810_10258798All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300018014|Ga0187860_1253048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae698Open in IMG/M
3300018017|Ga0187872_10310160All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300018022|Ga0187864_10149888All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300018024|Ga0187881_10258315All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300018030|Ga0187869_10609444All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300018037|Ga0187883_10727903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300018038|Ga0187855_10432386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3767Open in IMG/M
3300018040|Ga0187862_10097188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2048Open in IMG/M
3300018042|Ga0187871_10809761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4523Open in IMG/M
3300018043|Ga0187887_10103810All Organisms → cellular organisms → Bacteria → Acidobacteria1712Open in IMG/M
3300018090|Ga0187770_11374641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4573Open in IMG/M
3300018090|Ga0187770_11511563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60547Open in IMG/M
3300021374|Ga0213881_10223996Not Available833Open in IMG/M
3300021433|Ga0210391_10509658All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium945Open in IMG/M
3300021476|Ga0187846_10087768All Organisms → cellular organisms → Bacteria → Acidobacteria1346Open in IMG/M
3300021560|Ga0126371_10237297All Organisms → cellular organisms → Bacteria → Acidobacteria1933Open in IMG/M
3300021861|Ga0213853_11281029All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3721Open in IMG/M
3300022557|Ga0212123_10027909Not Available5942Open in IMG/M
3300023090|Ga0224558_1058969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41513Open in IMG/M
3300023091|Ga0224559_1168557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae770Open in IMG/M
3300023101|Ga0224557_1237370Not Available611Open in IMG/M
3300023258|Ga0224535_1019636All Organisms → cellular organisms → Bacteria → Acidobacteria1627Open in IMG/M
3300023311|Ga0256681_10185347Not Available580Open in IMG/M
3300025406|Ga0208035_1024058Not Available979Open in IMG/M
3300025480|Ga0208688_1007223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683430Open in IMG/M
3300025506|Ga0208937_1128097All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300025507|Ga0208188_1073616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4808Open in IMG/M
3300026023|Ga0207677_11279082All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300026023|Ga0207677_11848065All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300026088|Ga0207641_11263966All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300027370|Ga0209010_1040226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta798Open in IMG/M
3300027807|Ga0209208_10288878All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300027824|Ga0209040_10202827All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300027853|Ga0209274_10572625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60585Open in IMG/M
3300027857|Ga0209166_10419378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4693Open in IMG/M
3300027878|Ga0209181_10349787Not Available1219Open in IMG/M
3300027911|Ga0209698_10762556All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300027911|Ga0209698_11252034All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300028552|Ga0302149_1203462All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300028560|Ga0302144_10073848All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300028565|Ga0302145_10017371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2654Open in IMG/M
3300028572|Ga0302152_10314248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46516Open in IMG/M
3300028745|Ga0302267_10049925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2367Open in IMG/M
3300028748|Ga0302156_10040673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2574Open in IMG/M
3300028748|Ga0302156_10338271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3667Open in IMG/M
3300028788|Ga0302189_10008871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6671Open in IMG/M
3300028788|Ga0302189_10128265All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis1116Open in IMG/M
3300028788|Ga0302189_10225043Not Available776Open in IMG/M
3300028800|Ga0265338_11023118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli559Open in IMG/M
3300028866|Ga0302278_10171036All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41109Open in IMG/M
3300028867|Ga0302146_10029811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales2445Open in IMG/M
3300028874|Ga0302155_10021883All Organisms → cellular organisms → Bacteria3144Open in IMG/M
3300028874|Ga0302155_10139081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1072Open in IMG/M
3300028882|Ga0302154_10093892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter1627Open in IMG/M
3300028882|Ga0302154_10296212All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300028882|Ga0302154_10486832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4588Open in IMG/M
3300028909|Ga0302200_10291419All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300029817|Ga0247275_1122486Not Available672Open in IMG/M
3300029907|Ga0311329_10241555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1350Open in IMG/M
3300029914|Ga0311359_10233486All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300029915|Ga0311358_10252107Not Available1542Open in IMG/M
3300029917|Ga0311326_10133911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1345Open in IMG/M
3300029917|Ga0311326_10561678All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300029918|Ga0302143_1141281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4576Open in IMG/M
3300029919|Ga0302141_1071065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4939Open in IMG/M
3300029939|Ga0311328_10067092All Organisms → cellular organisms → Bacteria3113Open in IMG/M
3300029939|Ga0311328_10573538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4781Open in IMG/M
3300029944|Ga0311352_10543331All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300029952|Ga0311346_10751763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4833Open in IMG/M
3300029952|Ga0311346_10778010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4812Open in IMG/M
3300029952|Ga0311346_10817798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4783Open in IMG/M
3300029952|Ga0311346_11019445Not Available666Open in IMG/M
3300029953|Ga0311343_10560698All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300029954|Ga0311331_10275060All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300029954|Ga0311331_10505128All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300029955|Ga0311342_10368130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1265Open in IMG/M
3300029956|Ga0302150_10012497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3431Open in IMG/M
3300030007|Ga0311338_10644962Not Available1081Open in IMG/M
3300030020|Ga0311344_10937619All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4684Open in IMG/M
3300030051|Ga0302195_10294394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4720Open in IMG/M
3300030054|Ga0302182_10401400All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300030494|Ga0310037_10412944All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300030503|Ga0311370_10925597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae984Open in IMG/M
3300030503|Ga0311370_12238429All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300030518|Ga0302275_10516733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4595Open in IMG/M
3300030580|Ga0311355_11498690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4583Open in IMG/M
3300030617|Ga0311356_10258895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis1757Open in IMG/M
3300030617|Ga0311356_11698850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae565Open in IMG/M
3300030688|Ga0311345_10036734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00686450Open in IMG/M
3300030688|Ga0311345_10189557All Organisms → cellular organisms → Bacteria2110Open in IMG/M
3300030688|Ga0311345_10884573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4687Open in IMG/M
3300030906|Ga0302314_11353106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium654Open in IMG/M
3300031234|Ga0302325_11769902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4776Open in IMG/M
3300031234|Ga0302325_12877787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4561Open in IMG/M
3300031235|Ga0265330_10158300Not Available962Open in IMG/M
3300031236|Ga0302324_100235119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2879Open in IMG/M
3300031236|Ga0302324_101059234All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300031250|Ga0265331_10294854All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300031258|Ga0302318_10075400All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1445Open in IMG/M
3300031258|Ga0302318_10516784All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300031261|Ga0302140_10134815All Organisms → cellular organisms → Bacteria2379Open in IMG/M
3300031261|Ga0302140_10305058All Organisms → cellular organisms → Bacteria → Nitrospirae1345Open in IMG/M
3300031524|Ga0302320_10336870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1962Open in IMG/M
3300031525|Ga0302326_10328569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2422Open in IMG/M
3300031525|Ga0302326_11116343All Organisms → cellular organisms → Bacteria → Acidobacteria1094Open in IMG/M
3300031525|Ga0302326_12091443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4727Open in IMG/M
3300031595|Ga0265313_10157034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4968Open in IMG/M
3300031670|Ga0307374_10352068All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300031708|Ga0310686_102726770All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium735Open in IMG/M
3300031712|Ga0265342_10514308All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4610Open in IMG/M
3300031724|Ga0318500_10552464All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300031788|Ga0302319_11291995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4666Open in IMG/M
3300031788|Ga0302319_11700384Not Available550Open in IMG/M
3300031833|Ga0310917_10965147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia572Open in IMG/M
3300032074|Ga0308173_11885659All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300032160|Ga0311301_10174082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA33789Open in IMG/M
3300032180|Ga0307471_101003423Not Available1002Open in IMG/M
3300032828|Ga0335080_12345335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae510Open in IMG/M
3300032893|Ga0335069_11919433All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6626Open in IMG/M
3300032895|Ga0335074_10149105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2963Open in IMG/M
3300032898|Ga0335072_10137934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3021Open in IMG/M
3300032898|Ga0335072_10211778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2281Open in IMG/M
3300032954|Ga0335083_10845383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3731Open in IMG/M
3300033134|Ga0335073_11658789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans606Open in IMG/M
3300033402|Ga0326728_10158094All Organisms → cellular organisms → Bacteria2429Open in IMG/M
3300033402|Ga0326728_10404627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41164Open in IMG/M
3300033405|Ga0326727_10270549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1720Open in IMG/M
3300033405|Ga0326727_11076323All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Paracidobacterium → Paracidobacterium acidisoli576Open in IMG/M
3300033755|Ga0371489_0121825All Organisms → cellular organisms → Bacteria → Acidobacteria1475Open in IMG/M
3300033982|Ga0371487_0022793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales4235Open in IMG/M
3300033983|Ga0371488_0477713All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium566Open in IMG/M
3300034065|Ga0334827_041433Not Available1748Open in IMG/M
3300034065|Ga0334827_109897All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4899Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog25.13%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog8.21%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.21%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.15%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.59%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.59%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.59%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.08%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.08%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.56%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.05%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.05%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.54%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.03%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.51%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.51%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.51%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.51%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.51%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.51%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.51%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.51%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.51%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.51%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.51%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009510Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009701Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027878Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10053701713300001213WetlandMDKTIRKYTSYKAMRTDEYRYWQSRPVHERMNAVSELSTAAYA
Ga0062384_10058311123300004082Bog Forest SoilMDAIIRKYASFNEMKADEYRYWQSRPVYERVDAVEEMIETAYALKGWEVEPD
Ga0062384_10085643013300004082Bog Forest SoilMDDTPITVRKYSDFDEIKADEYRYWQSRPAHERLDAVEEMIETAYALKGWEIE
Ga0062389_10011031633300004092Bog Forest SoilMDKTVRIYASLHEMKADEYRYWQSRPVHERMTAVAEILQCPQR*
Ga0062389_10039274513300004092Bog Forest SoilMNFMDKTIHKYTSFDEMKADEYRYWQTRPVHERMAAVSELTRALYALKGTA
Ga0062389_10258662123300004092Bog Forest SoilMEPIIRKYTNFDEMKADEYRYWQSRPVHERMDAVQELNLIAYPIKGGEPKPDV
Ga0062388_10159926823300004635Bog Forest SoilVDITIRKYTSHQEAKADEYRYWQSRPVHERMDAVEEITLAAYAMKGVELELD
Ga0068868_10223768713300005338Miscanthus RhizosphereMDLTIRKYISFDEMKADEYRYWQSRPAHERMDAVEELVRTAYELKGWEMEPDV
Ga0068853_10016961543300005539Corn RhizosphereMDLTIRKYISFDEMKADEYRYWQSRPAHERMDAVEELVRTAYELKGWEM
Ga0075017_10030480423300006059WatershedsMDKTIRRYTDFNEMKADEYRYWQSRPVHERLDAVDEMIETAYALKGWEIWR*
Ga0075019_1025536433300006086WatershedsMDKTIRKYTDFDEMKADEYRYWQSRPVHERVAAVSE
Ga0068871_10206869313300006358Miscanthus RhizosphereMMDPIIRKYRSFDEMKADEYRYWQSRPAHERFDVL
Ga0066709_10125329933300009137Grasslands SoilMDPIIRKYTSFDEMKADEYRYWQSRPVHERMDAIEEITLAAYAMKGVEPEPDVPRL
Ga0116230_1003926553300009510Host-AssociatedMNEAPTARKYTSFDEMKADEYRYWQSRPAHERLDAVEEMIQTGYAL
Ga0116230_1010284513300009510Host-AssociatedMCANMLQTSMEKLVRKYRDFDEMKADEYRYWQSRPVHERMDAVEAMIQTAYALKGWKLEP
Ga0116108_100918743300009519PeatlandMDAILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQTAY
Ga0116214_112010133300009520Peatlands SoilMDKTIRKYKNFDEMKADEYRYWQSRPVHERVAAVSELTEEGYKFKGI
Ga0105249_1016796943300009553Switchgrass RhizosphereMDLTIRKYISFDEMKADEYRYWQSRPAHERMDAVEELVRTA
Ga0116126_105369713300009640PeatlandMDEAIRIYHSHEEMKADEYRYWQGRPVHERMDAVEEMIQTAYALKGWEIEPDV
Ga0116126_107728133300009640PeatlandMDEAIRIYHSHDEMKADEYRYWQGRPVHERMDAVEEMIQTAYALKGWEIEPDV
Ga0116216_1018249613300009698Peatlands SoilMDKTIRKYTSLDEMKADEYRYWQSRPVHERMDAVEEMIYTAYELKGWE
Ga0116228_1107158123300009701Host-AssociatedMSLTVRRYTSFEEMKADEYRYWQSRPAHERLDAVDEMIETAYKLKGWELKTDVP
Ga0116227_1095297513300009709Host-AssociatedMDKTVRKYTNFDEMKADEYRYWQSRPAHERIDAVDEMIE
Ga0137376_1039279533300012208Vadose Zone SoilMDRTIRVYHSLDEMKAGEYRYWQSRPVHERMDAVEEINAAAYAIKGVGIEPDVRR
Ga0137372_1111058713300012350Vadose Zone SoilMIMTTRKYTSFEEMKADEYRYWQSRPVHERMDAVEEITLAAYAVKGGVSKPNVPRL
Ga0153915_1065486613300012931Freshwater WetlandsMDKTIRKYTDFDEMKADEYRYWQSRPVHERMAAVSELTEDSYKLKG
Ga0137410_1184226413300012944Vadose Zone SoilMDKTIHKYISFDAMKADEYRYWQSRSVQERMDAVSELTQATYAMKGAAPD
Ga0157374_1124944313300013296Miscanthus RhizosphereMTRRRKYTDFDEMKADEYRYWQSRPAHERLDAVEEMIQTAYELKG
Ga0181539_134300623300014151BogMDTILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQ
Ga0181533_121353623300014152BogMDTILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIKAAYELKGWEIEPNV
Ga0181524_1031533213300014155BogMDSILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQAAYALKGWEIEPD
Ga0181517_1029744413300014160BogMDKTIRKYTNFDEMKADEYRYWQSRPAHERLDAVAEMVETAYDL
Ga0181517_1054502213300014160BogMATILRRYTSFDEMKADEYRYWQSRPVHERMDAVEELNLAAAAIKGIEPEPN
Ga0181529_1024459713300014161BogMEKTIRKYTSYQVMKAGAYRYWQNRPLHERMDAVSELTPPPAR*
Ga0181529_1044727013300014161BogMETTLRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQTAY
Ga0181523_1046587023300014165BogMDKTIRKYASFDEKKPDEYRYWQSRPIHERVPAVSELTLELYAMKG
Ga0181528_1022225013300014167BogMSDAPIRIRKYSDFEEMKADEYRYWQSRPASERLDAVEELVEMAYALKGWKIEPD
Ga0181534_1000327963300014168BogMDKSIRKYKSFDEMKADEYRYWQSRPVWERTDAVSELTREHYAL
Ga0181534_1003286643300014168BogMDKTIRKYKSFDEMKADEYRYWQSRPVWERTDAVSELTREHYAL
Ga0181526_1103606023300014200BogMDLTIRKYTSLDEMKADEYRYWQSRPLHERIDAVEEMIETAYALKGWEIEPDVPR
Ga0182018_1061468423300014489PalsaMDKTIRKYTSLDEMKADEYRYWQSRPIWERTDAVSELTQEHY
Ga0182013_1052156213300014492BogMDAVLRKYASFEEMKADEYRYWQSRPVHERMDAVEEMIQAAYALKGWEIEP
Ga0182016_1018314913300014493BogMDKTIRKYTNFDEMKADEYRYWQSRPVHERLDAVEEMIQAAYELK
Ga0182017_1013467123300014494FenMDKTIRKYASLKAMKAEEYRYWRSRPVHERMDAVEEMIQAAYAIKGWEMEP
Ga0182011_1039849623300014496FenMLRKERMEPIIRKYTSFEEMKADEYRYWQSRPVHERIDAV
Ga0182011_1053277013300014496FenMDKTIRIYDSLDEMKADEYRYWQSRPVQERMDAVAEITLAT
Ga0182019_1007312333300014498FenMEPIVRKYTSLDEMKADEYRYWQSRPVHERIDAVEEMIRDAYALKGWEIEPDVPRL
Ga0182019_1128132713300014498FenMDSILRKYMSFDEMKADEYRYLQSRPVHERMDAV*
Ga0182024_1099547313300014501PermafrostMDSTAITVRKYTDFDEMKADEYRFWQSRPPHERLDAVEEMIETAYALKGWEI
Ga0182024_1108782813300014501PermafrostMDAVLRKYTSFGEMKADEYRYWQGRPVFERMDAVEEMIQAAYALKGWE
Ga0181516_1058648023300014655BogMDMTLRKYTSLEEMKADEYRYWQSRPVHERMEAVTELSLAAF
Ga0181516_1066141113300014655BogMETILRKYASFDEMKADEYRYWQSRPVHERMDAVEEMIQEAYTMKGW
Ga0181522_1007980043300014657BogMDKTIRKCTRLDEMKADEYRYWQSQPVHELMDAVEEVIRTAY
Ga0182030_1025215833300014838BogMCYKQGMDKTVRKYTSFDEMKADEYRYWQSRPAFERLDAVEEMIETA
Ga0182030_1063685223300014838BogMDKTIRKYTKFEEMKADEYRYWQSRPVHERLDAVDEMIETACALKGWEMEPDVPRR
Ga0182027_1016595133300014839FenMESTLRRYTSFDEMKADEYRYWQSRPVHERMDAVEELIQTAYAIKGWEIKPDVPRL
Ga0187849_114249013300017929PeatlandMGATLRKYTSFDEMKADEYRYWQSRPMHERMDAAEEMIRTAYALKGW
Ga0187782_1168061113300017975Tropical PeatlandMGDAPVIRRYTDFDEMKADEYRYWQSRPVHERMDAIEELVQTAYALKGWK
Ga0181520_1102253023300017988BogMETILRRYTSFDEMKADEYRYWQSRPVWERTDAVSELTREHYALKGEAPDVP
Ga0187888_139670623300018008PeatlandVLRIERMDDAPIIRKYAGFDEMKADEYRYWQSRPAHERLDAIEEIVETAYALKGWEIEP
Ga0187810_1025879813300018012Freshwater SedimentMATILRKYSSFEEMKADEYRYWQSRPVHERMDAVEELNRTAYAIKGG
Ga0187860_125304813300018014PeatlandMDKTIRKYTKFEEMKADEYRYWQSRPVHERVHAVSELTQEHYAMKGAVPDVP
Ga0187872_1031016013300018017PeatlandMDEAIRIYHSHDEMKADEYRYWQGRPVHERMDAVEEMIQTAYALKGWEIEP
Ga0187864_1014988823300018022PeatlandMDPIIRKYASFEEMKADEYRYWQSRPVHERMDAVEETISPLTQ
Ga0187881_1025831513300018024PeatlandMGATLRKYTSFDEMKADEYRYWQSRPMHERMDAAE
Ga0187869_1060944413300018030PeatlandMDKTIRKCTRLDEMKADEYRYWQSQPVHELMDAVEEVIRTAYEL
Ga0187883_1072790313300018037PeatlandMDAILRKYTSFEEMKADEYRYWQSRPVNERMDAVEE
Ga0187855_1043238613300018038PeatlandMDDAPIIVRKYTDFAEMKADEYRYWQSRPAHERLDAVEAMIETAYALKGWKIEPD
Ga0187862_1009718813300018040PeatlandMDATLRKYTSFEEMKADEYRYWQSRPVHERMDAVEEMIQ
Ga0187871_1080976123300018042PeatlandMDATLRKYTSFEEMKADEYRHWQSRPVYERMDAVEEMIQTA
Ga0187887_1010381023300018043PeatlandMDKSIRKYSSFDEMKADEYRYWQSRPVHERIDAVSELTQ
Ga0187770_1137464133300018090Tropical PeatlandMDKTIRKYTDFDEIKADEYRYWQSRPAHERLDAVEEM
Ga0187770_1151156313300018090Tropical PeatlandMEPILRKYTSLDEMKADEYRYWQGRPAQERLDAVEKMIEAAYQ
Ga0213881_1022399613300021374Exposed RockMDKTIRKFSKFAELKGEEYRYWQSRPVHERVAAVSELTQEHYALK
Ga0210391_1050965813300021433SoilMDKSVRVYHSHEEMKADEYRYWQSRPVWERMDAVEELIQTAYAMKGWE
Ga0187846_1008776813300021476BiofilmMDKTIRKYTSFEEMKADEYRYWQSRPGYERLNAIVELSVEGYRL
Ga0126371_1023729723300021560Tropical Forest SoilMDKTIRKYKSLDEMKAEEYRYWQSRPVHERMMAVSELSQAM
Ga0213853_1128102923300021861WatershedsMDKSIRKYTDFDEMKADEYRYWQSRPVHERMDAVEEMIETAYALKGW
Ga0212123_1002790913300022557Iron-Sulfur Acid SpringMDKTIRKFTDFDELKAEEYRYWQSRPVHERWAATEELSL
Ga0224558_105896913300023090SoilMVTILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQTAYALNDWEIEP
Ga0224559_116855713300023091SoilMESTLRRYTSFDEMKADEYRYWQSRPVHERMDAVEELIQTAYA
Ga0224557_123737013300023101SoilMGSMDSILRKYTSFEEMKADEYRYWQSRPVHERMDAVEEMIQAAYA
Ga0224535_101963623300023258SoilMEPVIRKYSSFDEMKADEYRYWQSRPVQERVDAVE
Ga0256681_1018534713300023311FreshwaterMDAILRKYKSFDEMKADEYRYWQSRPVHERMDAVEEMIQAAYALKGWEIEPD
Ga0208035_102405823300025406PeatlandMDTILRKYTSLDEMKADEYRYWQSRPVHERMDAVEEINLTALAIRGME
Ga0208688_100722313300025480PeatlandMDAILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQTAYAIK
Ga0208937_112809723300025506PeatlandMDAILRKYTSFEEMKADEYRYWQSRPVHERMDAVEEMIRTAYALKGWEIEPDV
Ga0208188_107361613300025507PeatlandMDKVIRTYTNLDEMKADEYRYWQSRPVYERMDAVEE
Ga0207677_1127908233300026023Miscanthus RhizosphereMDLTIRKYTSFDEMKADEYRYWQSRPAHERMDAVEELVQTAY
Ga0207677_1184806523300026023Miscanthus RhizosphereMDLTIRKYISFDEMKADEYRYWQSRPAHERMDAVEELVRTAYELKGWEMEPDVPRSQ
Ga0207641_1126396613300026088Switchgrass RhizosphereMDLTIRKYTSFDEMKADEYRYWQSRPAHERMDAVEELVQTAYEL
Ga0209010_104022613300027370Forest SoilMDKTLRKYTSFDEAKADEYRYWQSRPAHERMAAVS
Ga0209208_1028887813300027807Host-AssociatedMNEAPTARKYTSFDEMKADEYRYWQSRPAHERLDAVEEMIQTGYALKGWEIA
Ga0209040_1020282723300027824Bog Forest SoilMDMTVRKYTSHKEAKADEYRYWQSRPVHERMDAVEEITLDAYAMKGVELE
Ga0209274_1057262523300027853SoilMDKTVRRYTSLDEMKADEYRYWQSRPEYERFAAVKEMIETAYALKGWELK
Ga0209166_1041937833300027857Surface SoilMLQPKRMDKTLRKYTSFDEAKADEYRYWQSRPAHERMAAVSEITQELYAMKGA
Ga0209181_1034978733300027878FreshwaterVDKTIRRYSSLEEMKADEYRYWQRRPVYERTDAVSELTQEHYSLSSVRSSRT
Ga0209698_1076255613300027911WatershedsMDKSIRKYTNFDEMKADEYRYWQSRPVHERVAAVSELTR
Ga0209698_1125203413300027911WatershedsMLQKERMEPTIRKYSSLDEMKADEYRYWQSRPAHERIDAVEE
Ga0302149_120346213300028552BogMESTLRKYSSFDEMKADEYRYWQSRPVHERMDAVEEMIQTAYAI
Ga0302144_1007384813300028560BogMKAMDKIIRKYSNFDEMKADEYRYWQSRPAYERMDAIEEMIETAY
Ga0302145_1001737143300028565BogMTVRKYTDLDEMKADEYRYWQSRPVDERMDAVEQM
Ga0302152_1031424823300028572BogMLRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMI
Ga0302267_1004992513300028745BogMTVRKYTDLDEMKADEYRYWQSRPVHERMDAVEEMIQTAYELKGWELEPD
Ga0302156_1004067343300028748BogMTVRKYTDLDEMKADEYRYWQSRPVHERMDAVEQMIQTAYTLKGWELEP
Ga0302156_1033827113300028748BogMEAILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQA
Ga0302189_1000887113300028788BogMGAILRKYTSFDEMKADEYRYWQSRPVHERMDAAEAMVKEAYA
Ga0302189_1012826523300028788BogMTVRKYTDLDEMKADEYRYWQSRPVHERMDAVEEMIQT
Ga0302189_1022504333300028788BogMDKTICKYGNFDEMKADEYRYWQSRPVHEWVAAVS
Ga0265338_1102311813300028800RhizosphereMDKTVRKYTDFDEMKADEYRYWQSRPIHERVDAVEEMIREAYALKGWETEPDVPR
Ga0302278_1017103623300028866BogMDAVLRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQAAYALKGWEIEPE
Ga0302146_1002981123300028867BogMPSDSKTIQRKYTSFDERKADEYRYWQSRPVHERLDAVEEMIQEAYA
Ga0302155_1002188313300028874BogMVKRGMDKTIRKFTSLADMKAEEYRYWQSRPIHERVNA
Ga0302155_1013908113300028874BogMDKTIRKYTNFDEMKAEEYRYWRSRPIHERVRAVSE
Ga0302154_1009389223300028882BogMGLIVRKYTSFDEMKADEYRYWQSRPVYERMDAVEEMIQTAYALKGWEIEPDV
Ga0302154_1029621213300028882BogMDMTVRQYQSFEEMKADEYRYWQSRPVHELISAVSEITLAAYAM
Ga0302154_1048683223300028882BogMDKTIRKYTSFDEMKADEYRYWQGRPVHERMDAVEEMILAA
Ga0302200_1029141913300028909BogMGTMLRRYTNLDEMKADEYRYWQSRPVHERMDAVDEMIEAA
Ga0247275_112248623300029817SoilMDKNIRTYASFDEMKADEYRYWQSAPVEERMDAVAEIT
Ga0311329_1024155513300029907BogMRIMGPILRKYTSFDEMKEDEYRYWQSRPVHERMDAVAEMILAA
Ga0311359_1023348633300029914BogMDAILRKYTSFNEMKADEYLYWQGRPVHERMDAVEEMIQAAYALKG
Ga0311358_1025210713300029915BogMDVILRKYTSFDEMKADEYRYWQSRPVHERMDAAEEMIQAAYALKGWEIEP
Ga0311326_1013391123300029917BogMRIMGPILRKYTSFDEMKADEYRYWQSRPVHERMDAVAEMILSA
Ga0311326_1056167813300029917BogMKAMDKIIRKYSNFDEMKADEYRYWQSRPAYERMDAIEE
Ga0302143_114128113300029918BogMETVLRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQTAYAIKGWEVE
Ga0302141_107106513300029919BogMPSDSKTIQRKYTSFDERKADEYRYWQSRPVHERLDAVEEMIQEAYALKGWEIEPD
Ga0311328_1006709213300029939BogMESTLRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQTAYAIKGWEVKPDVP
Ga0311328_1057353813300029939BogMDTILRKYASFDEMKADEYRYWQSRPVHERMDAIQEMIH
Ga0311352_1054333123300029944PalsaMELFIRKYASFDEMKADEYSYWQSRPAHERLDAVD
Ga0311346_1075176323300029952BogMGTILRKYNSFDEMKAGEYRFWQSRPVHERMDAVEEMIQTDFALKGWEI
Ga0311346_1077801013300029952BogMDAVLRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMI
Ga0311346_1081779823300029952BogRSRMLKTRQDKTIRKYTDPDDFEELKAKEYRYWQSRPVHERVAAVSELTQ
Ga0311346_1101944513300029952BogMERIIRKYTSFDEMKADEYRYWQSRPVHERMDAVEKLIRTAYALKGWE
Ga0311343_1056069813300029953BogMGTMLRRYTSFDEMKADEYRYWQSRPVHERMDAVEEMIEAAYA
Ga0311331_1027506033300029954BogMDKTICKYGNFDEMKADEYRYWQSRPVHERVAAVSELTEEGYTLKGFEPDAF
Ga0311331_1050512823300029954BogMEETPITARRYTDFAEMKADEYRYWQSRPAHERLDAVEEMIETAYALKGWKLEP
Ga0311342_1036813023300029955BogMDKTIRKYTSFDEMKADEYRYWQSRPVHERVAAVSELTEEGYKLKGFA
Ga0302150_1001249713300029956BogMTVRKYTDFDEMKADEYRYWQSRPVHERMDAVEEMIQTAYEL
Ga0311338_1064496213300030007PalsaMHKTIRKYTSLDEMKADEYRYWQSRPVHERLDAVEEMIETAYALKGWKKV
Ga0311344_1093761923300030020BogMLKTRQDKTIRKYTDPDDFEELKAKEYRYWQSRPVHERVAAVSELTQ
Ga0302195_1029439423300030051BogMEAILRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIQAAYAL
Ga0302182_1040140013300030054PalsaMDKTVRMYTDFGEMKADECRYWQSRPAHERIDAVDEMIEVAYAPKGWK
Ga0310037_1041294423300030494Peatlands SoilMDKTIRKYKNFDEMKADEYRYWQSRPVHERVAAVSELTEEGYKLKGFKR
Ga0311370_1092559713300030503PalsaMGALVRKYANFDEMKADEYRYWQSRPVHERMDAVEEMI
Ga0311370_1223842913300030503PalsaMDKTVRMYTDFGEMKADECRYWQSRPAHERIDAVDEMIEVAY
Ga0302275_1051673313300030518BogVKMDAVLRKYTSFDEMKADEYRYWQSRPVHERMDA
Ga0311355_1149869013300030580PalsaMAMGTILRKYTSFDEMKADEYRYWQSRPVHERMDAAEEMIQFAYALKGWEIE
Ga0311356_1025889533300030617PalsaMGTILRKYTSFDEMKADEYRYWQSRPVHERMDAVEKMIQT
Ga0311356_1169885013300030617PalsaMDQTVRRYTSFEDMKADEYRYWQSRPAEERLGAVEEMIQT
Ga0311345_1003673463300030688BogMRIMGPILRKYTSFDEMKADEYRYWQSRPVHERMDAVAEMILAA
Ga0311345_1018955753300030688BogMDKTIRKYTKFEEMKADEYRYWQSRPVHERMDAVEELIQTAY
Ga0311345_1088457313300030688BogMGTMLRRYTNLDEMKADEYRYWQSRPAHERLDAVEEMVETAYALKGWEIEPDVPR
Ga0302314_1135310623300030906PalsaMEMTIRKYASFDEMKADEYRYWQSRPVHERMDAVEEMIRTAYELKGWEME
Ga0302325_1176990213300031234PalsaMDMTLRKYASFDEMKADEYRYWQSRPAQERLDAVEEMIQAAYASRR
Ga0302325_1287778713300031234PalsaMDKTIRKYTDFGEMKADEYRYWQSRPVHERVAAVSELSQEQYAMKGEIADVPR
Ga0265330_1015830033300031235RhizosphereMLQKERMDPILRRYTSFEEMKADEYRYWQSRPVHERMDAV
Ga0302324_10023511943300031236PalsaMRIMGTILRKYTSFGEMKADEYRYWQSRPVHERMDAVEEMIQTAYALKGWVIEPD
Ga0302324_10105923433300031236PalsaMDKTIRKYSSLDEMKADEYRYWQSRPVWERTDAVSELTQEQY
Ga0265331_1029485413300031250RhizosphereMDDGPIIRKYTDFDEMKADEYRYWQSRPAHERLDAIEEMIQTAYELKGWK
Ga0302318_1007540013300031258BogMTVRKYTDLDEMKADEYRYWQSRPVHERMDAVEQMIQT
Ga0302318_1051678423300031258BogMGAILRKYTSFDEMKADEYRYWQSRPVHERMDAAEAMVKEAYALKGWVIEP
Ga0302140_1013481513300031261BogMDKTICKYGNFDEMKADEYRYWQSRPVHERVAAVSE
Ga0302140_1030505833300031261BogMDKTIRKYTKFEEMKADEYRYWQSRPVHERMDAVEELIQTAYELKGWKMEPDV
Ga0302320_1033687033300031524BogMGTILRKYTNFGEMKADEYRYWQSRPVHERLDAVDEMV
Ga0302326_1032856913300031525PalsaMDKTIRRYSSLDEMKADEYRYWQSRPVHERLDAVEEMIETAYALKGWKMVPD
Ga0302326_1111634323300031525PalsaMDKTIRKYTDFDEMKADEYRYWQSRPVHERVDAVSQLTQE
Ga0302326_1209144313300031525PalsaMDKTIRKYSNFDEMKADQYRYWQSRPVHERVAAVSELTKEGYTL
Ga0265313_1015703413300031595RhizosphereMNDTLRVYRNHEEMKADEYRYWQSRPAYERMDAVEQITIAT
Ga0307374_1035206823300031670SoilMDKTIRRYTDFGEMKADEYRYWQSRPPHERLDAVEEMIQSAYALK
Ga0310686_10272677023300031708SoilMEVRVYHSHEEMRADEYRYWQSRPVWERMDAVEEMIQTAYAMKGWALEPDVPR
Ga0265342_1051430823300031712RhizosphereMDKTIRKYTDLDEMKADEYRYWQSRPVHERMDAIEELIQTAYALKGWELE
Ga0318500_1055246413300031724SoilMDKTIRKYTSFDEMKADEYRYWQSRPVYERMDAVEELVRIAYEIKG
Ga0302319_1129199513300031788BogMDKTIRKYTSFDEMKADEYRYWQSRPVHERVAAVSELTE
Ga0302319_1170038423300031788BogMDKTVRKYTNFDDMKADEYRYWQSRPVHERVTAVSE
Ga0310917_1096514723300031833SoilMGYKRCMDKTIRQYTSFDEMKAEEYRYWQSRPVYERV
Ga0318510_1041782823300032064SoilMDNTIRKYTSLDKMKADEYRYWQSRPVDERINAVSELTQEQYEMKGIHVPRLQRTLV
Ga0308173_1188565913300032074SoilMVDRIVRKYSSFDEMKADEYRYWQSRPVHERVNAV
Ga0311301_1017408213300032160Peatlands SoilMDPIIRRYTRFEEMKADEYRYWQSRPVHERMDAVEEINRTVYEIKGVEPEPDVPRL
Ga0307471_10100342313300032180Hardwood Forest SoilMEKTIRVHHRLDEMKADEYRYWQSRPVHERMDAVESQ
Ga0335080_1234533523300032828SoilMEPTVRKYTSFDDRKDDEYRYWQSRPAWERMEAVDELIRAAQRPGDAAG
Ga0335069_1191943323300032893SoilMPCGACYKKAGMEPTIRKYANFEEMKADEYRYWQSRPVHERVAAVSELSEEGYQLKG
Ga0335074_1014910513300032895SoilLRYARKYPSFDEMKTDEYRYWQSRPAHERLDAVEELIRTATQD
Ga0335072_1013793453300032898SoilMDKTIRKYASFDEMKADEYRYWQSRPAYERMDAVDVMPFP
Ga0335072_1021177843300032898SoilMDKTIRKYSGLTGLAEIKTEEYRYWQSRPVYERTDAVSELTREAY
Ga0335083_1084538323300032954SoilMRKYATFGEMKADEYRYWQSRPVHERMDAVEEINLTAYAIKGAEPEP
Ga0335073_1165878923300033134SoilMDKIIRKYAGVDQLDEIKADEYRYWQSRPVQERIDAVSELTQAMYALKG
Ga0326728_1015809423300033402Peat SoilLTPVVQKYVSLEEMKASECRYWQNRPVHERIDAFEERIQTAYALKGWEMYPDVPILLVHIRQGEFAQ
Ga0326728_1040462723300033402Peat SoilMDKTLRKYTDFEEMKADEYRYWQSRPVHERIDAVEELIQT
Ga0326727_1027054913300033405Peat SoilMDAILRNYTSFDEMKADEYRYWQSRPVHERLDAVEEMIQTAYALKGW
Ga0326727_1107632323300033405Peat SoilMDKSIRKYTDFKEMKADEYRYWQSRPVHERVNAVSELTQEYYAMKGAI
Ga0371489_0121825_1308_14753300033755Peat SoilMRFMLQTEGMDPILRKYTSFEEMKADEYRYWQSRPAHERMDAVEELNRIAYEIKGW
Ga0371487_0022793_1_1683300033982Peat SoilMLQKERMDPIVRKYASFDEMKAGEYRYWQSRPVHERVAAVSELTEEGYKLKGFKPD
Ga0371488_0477713_438_5663300033983Peat SoilMDKTIRKYTNFDEMKADEYRYWQSRPVWERMDAVEEMIETAYG
Ga0334827_041433_1643_17473300034065SoilMGTILRKYNSFDEMKAGEYRFWQSRPVHERMDAVE
Ga0334827_109897_738_8993300034065SoilMGTTLRKYTSFDEMKADEYRYWQSRPVHERMDAVEEMIRTAYALKGWEIEPDVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.