Basic Information | |
---|---|
Family ID | F026906 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 196 |
Average Sequence Length | 48 residues |
Representative Sequence | FKREVYRRALMELERYLHARPQTRRERLYGWAHPEMPPSYANPATSRT |
Number of Associated Samples | 170 |
Number of Associated Scaffolds | 196 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.04 % |
% of genes near scaffold ends (potentially truncated) | 98.47 % |
% of genes from short scaffolds (< 2000 bps) | 92.86 % |
Associated GOLD sequencing projects | 159 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.959 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (7.653 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.796 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.449 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.47% β-sheet: 0.00% Coil/Unstructured: 60.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 196 Family Scaffolds |
---|---|---|
PF04893 | Yip1 | 51.53 |
PF01472 | PUA | 20.92 |
PF12276 | DUF3617 | 10.20 |
PF00293 | NUDIX | 1.53 |
PF01926 | MMR_HSR1 | 1.53 |
PF01197 | Ribosomal_L31 | 1.02 |
PF09363 | XFP_C | 1.02 |
PF09364 | XFP_N | 0.51 |
PF13180 | PDZ_2 | 0.51 |
PF11015 | DUF2853 | 0.51 |
PF10387 | DUF2442 | 0.51 |
PF00006 | ATP-synt_ab | 0.51 |
PF10282 | Lactonase | 0.51 |
PF13649 | Methyltransf_25 | 0.51 |
PF12867 | DinB_2 | 0.51 |
PF01814 | Hemerythrin | 0.51 |
COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
---|---|---|---|
COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 1.02 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.47 % |
Unclassified | root | N/A | 26.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y02GFGSH | Not Available | 732 | Open in IMG/M |
2199352024|deeps__Contig_189054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
2228664021|ICCgaii200_c0653596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 834 | Open in IMG/M |
3300004019|Ga0055439_10259726 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300004463|Ga0063356_101098426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1146 | Open in IMG/M |
3300004643|Ga0062591_100059517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2239 | Open in IMG/M |
3300005180|Ga0066685_10402353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
3300005328|Ga0070676_11380452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 540 | Open in IMG/M |
3300005329|Ga0070683_100828463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 887 | Open in IMG/M |
3300005329|Ga0070683_101307459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
3300005330|Ga0070690_101653872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
3300005331|Ga0070670_100021642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5529 | Open in IMG/M |
3300005335|Ga0070666_10707635 | Not Available | 739 | Open in IMG/M |
3300005339|Ga0070660_100833069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
3300005347|Ga0070668_100616444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 951 | Open in IMG/M |
3300005347|Ga0070668_101321819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 656 | Open in IMG/M |
3300005356|Ga0070674_101952526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 534 | Open in IMG/M |
3300005364|Ga0070673_101404042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 657 | Open in IMG/M |
3300005367|Ga0070667_102132418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
3300005434|Ga0070709_10167785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1531 | Open in IMG/M |
3300005434|Ga0070709_10621581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
3300005435|Ga0070714_102453429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
3300005444|Ga0070694_100687471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
3300005454|Ga0066687_10406451 | Not Available | 788 | Open in IMG/M |
3300005456|Ga0070678_101169171 | Not Available | 712 | Open in IMG/M |
3300005456|Ga0070678_101715537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
3300005457|Ga0070662_100451654 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300005459|Ga0068867_101477851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
3300005466|Ga0070685_11105180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
3300005466|Ga0070685_11243496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
3300005466|Ga0070685_11555500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300005467|Ga0070706_100227055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1743 | Open in IMG/M |
3300005471|Ga0070698_100222766 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1820 | Open in IMG/M |
3300005471|Ga0070698_100898707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 831 | Open in IMG/M |
3300005518|Ga0070699_101283432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300005535|Ga0070684_101478143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 640 | Open in IMG/M |
3300005536|Ga0070697_102092260 | Not Available | 507 | Open in IMG/M |
3300005539|Ga0068853_100129366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2259 | Open in IMG/M |
3300005560|Ga0066670_10873743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300005563|Ga0068855_100171027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2461 | Open in IMG/M |
3300005563|Ga0068855_101435802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
3300005569|Ga0066705_10825624 | Not Available | 552 | Open in IMG/M |
3300005578|Ga0068854_101207418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
3300005578|Ga0068854_101971874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
3300005598|Ga0066706_10242385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1400 | Open in IMG/M |
3300005614|Ga0068856_101982038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
3300005616|Ga0068852_100066634 | Not Available | 3145 | Open in IMG/M |
3300005616|Ga0068852_101447403 | Not Available | 709 | Open in IMG/M |
3300005618|Ga0068864_101880922 | Not Available | 604 | Open in IMG/M |
3300005660|Ga0073904_10715762 | Not Available | 538 | Open in IMG/M |
3300005719|Ga0068861_100248018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1518 | Open in IMG/M |
3300005719|Ga0068861_100521023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
3300005764|Ga0066903_108543292 | Not Available | 522 | Open in IMG/M |
3300005836|Ga0074470_10756522 | Not Available | 503 | Open in IMG/M |
3300005844|Ga0068862_101725963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 635 | Open in IMG/M |
3300005950|Ga0066787_10043775 | Not Available | 844 | Open in IMG/M |
3300006046|Ga0066652_101060368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 768 | Open in IMG/M |
3300006237|Ga0097621_101082114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
3300006237|Ga0097621_102366980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
3300006574|Ga0074056_10185141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
3300006904|Ga0075424_100953972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
3300009012|Ga0066710_102258707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 792 | Open in IMG/M |
3300009101|Ga0105247_10364462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1020 | Open in IMG/M |
3300009131|Ga0115027_10659969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 779 | Open in IMG/M |
3300009137|Ga0066709_100520797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1678 | Open in IMG/M |
3300009148|Ga0105243_11224353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 765 | Open in IMG/M |
3300009156|Ga0111538_10406833 | Not Available | 1724 | Open in IMG/M |
3300009162|Ga0075423_13085161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 510 | Open in IMG/M |
3300009174|Ga0105241_10220970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1592 | Open in IMG/M |
3300009177|Ga0105248_10315232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1762 | Open in IMG/M |
3300009177|Ga0105248_11808586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 693 | Open in IMG/M |
3300009792|Ga0126374_11691484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
3300010043|Ga0126380_11793530 | Not Available | 554 | Open in IMG/M |
3300010359|Ga0126376_12276194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 588 | Open in IMG/M |
3300010359|Ga0126376_13066323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
3300010360|Ga0126372_10965453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 861 | Open in IMG/M |
3300010360|Ga0126372_13214570 | Not Available | 508 | Open in IMG/M |
3300010366|Ga0126379_13242762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
3300010373|Ga0134128_10034126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5966 | Open in IMG/M |
3300010375|Ga0105239_10157749 | Not Available | 2535 | Open in IMG/M |
3300010376|Ga0126381_105055040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 505 | Open in IMG/M |
3300010937|Ga0137776_1839153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 987 | Open in IMG/M |
3300012185|Ga0136619_10291937 | Not Available | 618 | Open in IMG/M |
3300012198|Ga0137364_10802662 | Not Available | 711 | Open in IMG/M |
3300012198|Ga0137364_11159181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 580 | Open in IMG/M |
3300012203|Ga0137399_10832553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300012206|Ga0137380_10470501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1110 | Open in IMG/M |
3300012208|Ga0137376_10446890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1122 | Open in IMG/M |
3300012350|Ga0137372_10181607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1697 | Open in IMG/M |
3300012350|Ga0137372_10516618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 886 | Open in IMG/M |
3300012355|Ga0137369_11080355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
3300012357|Ga0137384_10204414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1652 | Open in IMG/M |
3300012895|Ga0157309_10197361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 628 | Open in IMG/M |
3300012914|Ga0157297_10279345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 618 | Open in IMG/M |
3300012917|Ga0137395_10541381 | Not Available | 840 | Open in IMG/M |
3300012951|Ga0164300_10881005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 564 | Open in IMG/M |
3300012958|Ga0164299_11015676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 612 | Open in IMG/M |
3300012971|Ga0126369_10211425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1879 | Open in IMG/M |
3300012984|Ga0164309_11324363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 610 | Open in IMG/M |
3300012985|Ga0164308_10768587 | Not Available | 837 | Open in IMG/M |
3300012987|Ga0164307_10862258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 725 | Open in IMG/M |
3300012987|Ga0164307_11098078 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 653 | Open in IMG/M |
3300012988|Ga0164306_11957742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 510 | Open in IMG/M |
3300013100|Ga0157373_11047943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 610 | Open in IMG/M |
3300013102|Ga0157371_10017074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5400 | Open in IMG/M |
3300013104|Ga0157370_11684283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 569 | Open in IMG/M |
3300013306|Ga0163162_11510705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 765 | Open in IMG/M |
3300013306|Ga0163162_12825690 | Not Available | 559 | Open in IMG/M |
3300013307|Ga0157372_11737266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 718 | Open in IMG/M |
3300013308|Ga0157375_12130964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 667 | Open in IMG/M |
3300014154|Ga0134075_10224421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 810 | Open in IMG/M |
3300014326|Ga0157380_12691859 | Not Available | 564 | Open in IMG/M |
3300014498|Ga0182019_10525365 | Not Available | 823 | Open in IMG/M |
3300015374|Ga0132255_102053786 | Not Available | 870 | Open in IMG/M |
3300015374|Ga0132255_102744741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 753 | Open in IMG/M |
3300017927|Ga0187824_10041054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1413 | Open in IMG/M |
3300017930|Ga0187825_10106354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 973 | Open in IMG/M |
3300017974|Ga0187777_11095937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 579 | Open in IMG/M |
3300018058|Ga0187766_10527239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 798 | Open in IMG/M |
3300018075|Ga0184632_10338882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 646 | Open in IMG/M |
3300018432|Ga0190275_10461989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1295 | Open in IMG/M |
3300018476|Ga0190274_10300887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1493 | Open in IMG/M |
3300018476|Ga0190274_13065830 | Not Available | 561 | Open in IMG/M |
3300018482|Ga0066669_11724638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 576 | Open in IMG/M |
3300019356|Ga0173481_10438686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 649 | Open in IMG/M |
3300021280|Ga0213900_107408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
3300021420|Ga0210394_10543031 | Not Available | 1022 | Open in IMG/M |
3300021445|Ga0182009_10348216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 756 | Open in IMG/M |
3300022534|Ga0224452_1197510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 618 | Open in IMG/M |
3300022756|Ga0222622_10596979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 797 | Open in IMG/M |
3300025907|Ga0207645_10402886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 920 | Open in IMG/M |
3300025916|Ga0207663_10711161 | Not Available | 796 | Open in IMG/M |
3300025919|Ga0207657_10228952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1487 | Open in IMG/M |
3300025925|Ga0207650_10339349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1234 | Open in IMG/M |
3300025929|Ga0207664_10759718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 872 | Open in IMG/M |
3300025949|Ga0207667_10434852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1334 | Open in IMG/M |
3300025981|Ga0207640_11115013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 699 | Open in IMG/M |
3300026041|Ga0207639_10927757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 814 | Open in IMG/M |
3300026041|Ga0207639_10934147 | Not Available | 811 | Open in IMG/M |
3300026041|Ga0207639_11572102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 617 | Open in IMG/M |
3300026067|Ga0207678_11420166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 613 | Open in IMG/M |
3300026089|Ga0207648_10794601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 881 | Open in IMG/M |
3300026089|Ga0207648_11532031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 627 | Open in IMG/M |
3300026095|Ga0207676_10426129 | Not Available | 1245 | Open in IMG/M |
3300026095|Ga0207676_12001620 | Not Available | 578 | Open in IMG/M |
3300026312|Ga0209153_1279557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 533 | Open in IMG/M |
3300026335|Ga0209804_1112272 | Not Available | 1243 | Open in IMG/M |
3300026542|Ga0209805_1029942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2794 | Open in IMG/M |
3300027831|Ga0209797_10381934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 575 | Open in IMG/M |
3300027840|Ga0209683_10426709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 609 | Open in IMG/M |
3300027850|Ga0209591_10317066 | Not Available | 1139 | Open in IMG/M |
3300027871|Ga0209397_10646888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 530 | Open in IMG/M |
3300027897|Ga0209254_10333079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1148 | Open in IMG/M |
3300027899|Ga0209668_10105517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1645 | Open in IMG/M |
3300027900|Ga0209253_10437068 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300028380|Ga0268265_11686102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 639 | Open in IMG/M |
3300028589|Ga0247818_10687140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 709 | Open in IMG/M |
3300028861|Ga0302259_1136234 | Not Available | 607 | Open in IMG/M |
3300028869|Ga0302263_10171591 | Not Available | 865 | Open in IMG/M |
3300028889|Ga0247827_10332183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 899 | Open in IMG/M |
3300029984|Ga0311332_11485011 | Not Available | 549 | Open in IMG/M |
3300030000|Ga0311337_12048204 | Not Available | 503 | Open in IMG/M |
3300030010|Ga0302299_10201869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1061 | Open in IMG/M |
3300030114|Ga0311333_10091621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2250 | Open in IMG/M |
3300030294|Ga0311349_11518527 | Not Available | 621 | Open in IMG/M |
3300030339|Ga0311360_11520917 | Not Available | 523 | Open in IMG/M |
3300030491|Ga0302211_10243067 | Not Available | 533 | Open in IMG/M |
3300031232|Ga0302323_100445362 | Not Available | 1378 | Open in IMG/M |
3300031544|Ga0318534_10357966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
3300031720|Ga0307469_10801712 | Not Available | 864 | Open in IMG/M |
3300031722|Ga0311351_10064499 | Not Available | 2830 | Open in IMG/M |
3300031723|Ga0318493_10831810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
3300031726|Ga0302321_102508237 | Not Available | 602 | Open in IMG/M |
3300031805|Ga0318497_10406592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 762 | Open in IMG/M |
3300031820|Ga0307473_11066542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 594 | Open in IMG/M |
3300031821|Ga0318567_10899618 | Not Available | 501 | Open in IMG/M |
3300031845|Ga0318511_10192973 | Not Available | 903 | Open in IMG/M |
3300031901|Ga0307406_10473835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1009 | Open in IMG/M |
3300031999|Ga0315274_10510351 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300032002|Ga0307416_101242164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 851 | Open in IMG/M |
3300032143|Ga0315292_11674807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 511 | Open in IMG/M |
3300032156|Ga0315295_10305694 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300032205|Ga0307472_100030445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3121 | Open in IMG/M |
3300032205|Ga0307472_100265047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1357 | Open in IMG/M |
3300032342|Ga0315286_10719312 | Not Available | 1018 | Open in IMG/M |
3300032516|Ga0315273_10312480 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
3300032770|Ga0335085_12003221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 587 | Open in IMG/M |
3300032893|Ga0335069_10446986 | Not Available | 1508 | Open in IMG/M |
3300032955|Ga0335076_11112875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 673 | Open in IMG/M |
3300033413|Ga0316603_10389372 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
3300033418|Ga0316625_101760168 | Not Available | 599 | Open in IMG/M |
3300033475|Ga0310811_10875204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 818 | Open in IMG/M |
3300033483|Ga0316629_10907736 | Not Available | 685 | Open in IMG/M |
3300034150|Ga0364933_003164 | All Organisms → cellular organisms → Bacteria | 3642 | Open in IMG/M |
3300034195|Ga0370501_0153528 | Not Available | 798 | Open in IMG/M |
3300034354|Ga0364943_0207670 | Not Available | 722 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.63% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.61% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.10% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.06% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.06% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.04% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.04% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.53% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.53% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.53% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.02% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.02% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.02% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.02% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.02% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.02% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.02% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.02% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.02% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.02% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.02% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.02% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.51% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.51% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.51% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.51% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.51% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.51% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.51% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.51% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.51% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300021280 | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Shaw_3 | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_04111580 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | VIEFKREVYRRALLELERYLHAKPQTRRERLFGFAHPGSLPPSYAEPVREAS |
deeps_03578440 | 2199352024 | Soil | TGCRSKSVIDFKREVYRRALMELERFLHGRPQTRRERLYGWAHPEMPASYANPVTSRN |
ICCgaii200_06535962 | 2228664021 | Soil | RRALMELERYLHMRPQTRRERLYGFAHPEMPASYANPAGSRS |
Ga0055439_102597262 | 3300004019 | Natural And Restored Wetlands | TVIEFKREAYRRALVELERFMDARPQTRRERLYGFPHPVMPSSYSDPASQEGT* |
Ga0063356_1010984261 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SVIDFKREVYRRALMELERYLHARPHTRRERLYGWAHPEMPASYTDPVTSR* |
Ga0062591_1000595171 | 3300004643 | Soil | KREVYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG* |
Ga0066685_104023531 | 3300005180 | Soil | FKRDVYRRALTELERFLHQRPQSRRQRLYGWAHTIVPSPYGNSSDA* |
Ga0070676_113804521 | 3300005328 | Miscanthus Rhizosphere | SVIDFKREVYRRALTELERFMHAHPQTRRERLYGFPHPMMPSSYADPQT* |
Ga0070683_1008284632 | 3300005329 | Corn Rhizosphere | REVYRRALMELERYLHMRPQTRRERLYGFAHQEMPASYTNPAGSRS* |
Ga0070683_1013074592 | 3300005329 | Corn Rhizosphere | IPLDTVIEFKREVYRRALLELERYLHAKPSTRRERLFGFAHPPVMPPSYAEPATRGE* |
Ga0070690_1016538721 | 3300005330 | Switchgrass Rhizosphere | VIDFKREVYRRALLELERYVHNKPHTRRERLFGFVHPMSPPSYADPLVPGD* |
Ga0070670_1000216421 | 3300005331 | Switchgrass Rhizosphere | DSVIDFKREVYRRALMELERYLHTRPQTRRERLYGWAHPEMPASYANPSPSRS* |
Ga0070666_107076351 | 3300005335 | Switchgrass Rhizosphere | VYRRALTELERFMHAHPQTRRERLYGFPHPVMPPSYGEPSG* |
Ga0070660_1008330691 | 3300005339 | Corn Rhizosphere | SVIDFKREVYRRALMELERYLHMRPQTRRERLYGFAHPEMPASYENPAGSRS* |
Ga0070668_1006164441 | 3300005347 | Switchgrass Rhizosphere | DFKREVYRRALMELERYLHARPQTRRERLYGWAHPEMPPSYATPATSRT* |
Ga0070668_1013218192 | 3300005347 | Switchgrass Rhizosphere | DFKREVYRRALTELERFMHAHPQTRRERLYGFPHPMMPSSYADPST* |
Ga0070674_1019525262 | 3300005356 | Miscanthus Rhizosphere | VIEFKREVYRRALTELERFMHAHPHTRRERLYGFPHPMMPPSYADPPTN* |
Ga0070673_1014040421 | 3300005364 | Switchgrass Rhizosphere | EVYRRALMELERYLHMRPQTRRERLYGFAHQEMPASYTNPAGSRS* |
Ga0070667_1021324181 | 3300005367 | Switchgrass Rhizosphere | ESVIDFKREVYRRALMELERYLHMRTQTRRERLYGFAHQEMPASYTNPAGSRS* |
Ga0070709_101677851 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GLTELERFLHQRPQTRRERLYGWAHSVVPSPYTNPTGKA* |
Ga0070709_106215812 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVIDFKREVYRRALMELERFLYTRPQTRRERLYGFAHPEMPSSYANPVTSR* |
Ga0070714_1024534292 | 3300005435 | Agricultural Soil | FKREVYRRGLMELERYLHARPQTRRERMYGWAHPEMPASYTNPVTSR* |
Ga0070694_1006874711 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | PLDAVIDFKREAYRRGLTELERFLHHRPHTRRERLYGWAHAVVPSPYSNPPSDV* |
Ga0066687_104064512 | 3300005454 | Soil | EVYRRGLTELERYLHHRPQTRRERLYGWAHAVVPSPYSNPKA* |
Ga0070678_1011691711 | 3300005456 | Miscanthus Rhizosphere | VYRRALTELERFMHAHPQTRRERLYGFPHPVMPESYADPAAQTSR* |
Ga0070678_1017155372 | 3300005456 | Miscanthus Rhizosphere | LESVIEFKREVYRRALTELERFMHAHPQTRRERLYGFPHPMMPPSYADPPN* |
Ga0070662_1004516543 | 3300005457 | Corn Rhizosphere | VIEFKREVYRRALLELERYLHAKPSTRRERLFGFAHPPVMPPSYAEPATRGE* |
Ga0068867_1014778512 | 3300005459 | Miscanthus Rhizosphere | SVIEFKREVYRRALNELERYLHGKPQTRRERLFGFPHPLRPDGYADPSTRGGD* |
Ga0070685_111051802 | 3300005466 | Switchgrass Rhizosphere | FKREVYRRALMELERYLHARPQTRRERLYGWAHPEMPPSYANPATSRT* |
Ga0070685_112434961 | 3300005466 | Switchgrass Rhizosphere | LDSVIDFKREVYRRALTELERFMHAHPQTRRERLYGFPHPMMPSSYADPQT* |
Ga0070685_115555001 | 3300005466 | Switchgrass Rhizosphere | LDTVIEFKRESYRRALLELERFLHSKPQTRRQRLYGVPHPEMPESYADPVAPSVK* |
Ga0070706_1002270553 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RALTELERFLHDRPPSRRKRLYGWAHTIVPSPYGNPSGDL* |
Ga0070698_1002227662 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KREVYRRALTELERYLHVRPHTRRERLYGFPHPEMPASYSDPSIENTD* |
Ga0070698_1008987072 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DFKREVYRRALTELERFLHDRPPSRRKRLYGWAHTIVPSPYGNPSGDL* |
Ga0070699_1012834321 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PLDAVIDFKRDAYRRGLTELERFLHHRPHTRRERLYGWAHAVVPSPYSNPPSDV* |
Ga0070684_1014781431 | 3300005535 | Corn Rhizosphere | RRALMELERFLHGRPQTRRERLYGWAHPEMPSSYANPVISR* |
Ga0070697_1020922602 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EVYRRALTELERYLHVRPHTRRERLYGFPHPEMPASYSDPSIENTD* |
Ga0068853_1001293663 | 3300005539 | Corn Rhizosphere | PLEAVIDFKREVYRRALMELERFLHTRPQTRRERLYGWAHPEMPASYANPVTSR* |
Ga0066670_108737432 | 3300005560 | Soil | FKREVYRRALTELERYLHQRPQTRRERLYGWAHPVMPSSYADPTPSSGS* |
Ga0068855_1001710274 | 3300005563 | Corn Rhizosphere | ESVIDFKREVYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG* |
Ga0068855_1014358021 | 3300005563 | Corn Rhizosphere | ESVIDFKREVYRRALMELERYLHARPQTRRERLYGWAHPEMPASYLNPVTSRS* |
Ga0066705_108256241 | 3300005569 | Soil | KREVYRRALTELERYLRVRVQTRRERLYGVSHPVMPSSYSDPSIEKAD* |
Ga0068854_1012074182 | 3300005578 | Corn Rhizosphere | PLESVIDFKREVYRRALMELERFLHGRPQTRRERLYGWAHPEMPSSYANPVISR* |
Ga0068854_1019718742 | 3300005578 | Corn Rhizosphere | LEAVIDFKREVYRRALMELERYLHARPQTRRERLYGWAHPEMPPSYANPATSRT* |
Ga0066706_102423853 | 3300005598 | Soil | LETVIEFKREVYRRALLELERYIHMKPQTRRERLYGFAHPVMPPSYGEPTPSSGD* |
Ga0068856_1019820382 | 3300005614 | Corn Rhizosphere | VPLEAVIDFKREVYRRALMELERFLYTRPQTRRERLYGFAHPEMPSSYANPVTSR* |
Ga0068852_1000666341 | 3300005616 | Corn Rhizosphere | RRALMELERYLHARPQTRRERLYGWAHPEMPPSYANPATSRT* |
Ga0068852_1014474031 | 3300005616 | Corn Rhizosphere | GLTELERFLHQRPHTRRERLYGWAHSIVPSPYPAPPSKT* |
Ga0068864_1018809222 | 3300005618 | Switchgrass Rhizosphere | IEFKRESYRRALLELERFLHAKPQTRRQRLYGVQHPEMPDSYADPVAPTTE* |
Ga0073904_107157622 | 3300005660 | Activated Sludge | LDTVIEFKRESYRRALLELERFLQAKPQTRRQRLYGIPHPQMPQSYADPETSAVK* |
Ga0068861_1002480183 | 3300005719 | Switchgrass Rhizosphere | VIDFKREVYRRALLELERYMHIKPHTRRERLFGFAHPMTPPSYSDPDPVTGD* |
Ga0068861_1005210231 | 3300005719 | Switchgrass Rhizosphere | VIEFKREVYRRALNELERYLHGKPQTRRERLFGFPHPLRPDGYADPSTRGGD* |
Ga0066903_1085432921 | 3300005764 | Tropical Forest Soil | YRRALTELERYLHVRPHTRRERLYGFPHPVMPPSYADPSTQNNS* |
Ga0074470_107565221 | 3300005836 | Sediment (Intertidal) | LDSVIDFKREVYRRALTELERHLHGRPQTRRDRLYGWAHPERPSSYADPASQSGD* |
Ga0068862_1017259632 | 3300005844 | Switchgrass Rhizosphere | VIEFKREVYRRALVELERFLHARPQTRRERLFGVQHPSMPPAYEEPTAANGDAG* |
Ga0066787_100437752 | 3300005950 | Soil | DVYRRGLTELERYLHHRPQTRRERLYGWAHAVVPSPYTNPPGKV* |
Ga0066652_1010603682 | 3300006046 | Soil | RDVYRRGLTELERFLHQRPQTRRERLYGWAHSVVPSPYTNPTGKA* |
Ga0097621_1010821141 | 3300006237 | Miscanthus Rhizosphere | IDFKREVYRRALMELERYLHARPQTRRERLYGWAHPEMPPSYANPATSRT* |
Ga0097621_1023669802 | 3300006237 | Miscanthus Rhizosphere | DFKREVYRRALLELERFAHMKPQTRRERLYGFGHPVMPPSYADPNVTSSD* |
Ga0074056_101851412 | 3300006574 | Soil | YRRALMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG* |
Ga0075424_1009539721 | 3300006904 | Populus Rhizosphere | REVYRRALLELERYMHTKPHTRRERLFGFAHPMTPPSYSDPDPVTPGD* |
Ga0066710_1022587072 | 3300009012 | Grasslands Soil | RDVYRRALTELERYLHHHPQTRRERLYGWAHAVVPSPYTNPPGKA |
Ga0105247_103644623 | 3300009101 | Switchgrass Rhizosphere | VYRRALLELERYVHAKPQTRRERLFGFAHPMTPSSYSDPVTPSGD* |
Ga0115027_106599692 | 3300009131 | Wetland | EVYRRALTELERHLHARAQTRRDRLYGWAHPAMPSSYADPLPQSGD* |
Ga0066709_1005207973 | 3300009137 | Grasslands Soil | LTELERFLHHRPQTRRERLYGWAHAVVPSPYTNPPGDV* |
Ga0105243_112243531 | 3300009148 | Miscanthus Rhizosphere | KRDVYRRGLTELERFLHQRPQTRRERLYGWAHSVVPSPYTNPTGKA* |
Ga0111538_104068331 | 3300009156 | Populus Rhizosphere | EFKRESYRRALLELERFLHSKPQTRRQRLYGVPHPEMPESYADPVAPSVK* |
Ga0075423_130851611 | 3300009162 | Populus Rhizosphere | RRALMELERYLHTRPQTRRERLYGWGHPEMPASYANPAASRG* |
Ga0105241_102209703 | 3300009174 | Corn Rhizosphere | DVYRRGLTELERFLHQRPQTRRERLYGWAHSVVPSPYTNPTGKA* |
Ga0105248_103152323 | 3300009177 | Switchgrass Rhizosphere | IPLDNVIEFKREVYRRALVELERFLHARPQTRRERLFGVQHQSMPPAYEEPSTAGRDAD* |
Ga0105248_118085862 | 3300009177 | Switchgrass Rhizosphere | VPLDSVIDFKREVYRRALLELERFAHMKPQTRRERLYGFGHPVMPPSYADPNVTSSD* |
Ga0126374_116914842 | 3300009792 | Tropical Forest Soil | YRRALTELERFLHHRPQNRRERLYGWARAVMPSPYTNPPGKA* |
Ga0126380_117935301 | 3300010043 | Tropical Forest Soil | KREVYRRALTELERYLHVRPHTRRERLYGFPHPVMPPSYADPSTQNNS* |
Ga0126376_122761942 | 3300010359 | Tropical Forest Soil | VYRRALLELERFLHQRPQSRRQRLYGWAHSVMPSPYANPPGDA* |
Ga0126376_130663231 | 3300010359 | Tropical Forest Soil | KREVYRRALMELERFLYTRPQTRRERLYGFAHPEMPASYTNPVTARGTS* |
Ga0126372_109654533 | 3300010360 | Tropical Forest Soil | TELERFLHHRPQNRRQRLYGWARSVAPSPYPTPSSEA* |
Ga0126372_132145701 | 3300010360 | Tropical Forest Soil | TVIEFKREVYRRALTELERYLHVRPHTRRERLYGFPHPVMPPSYSDPSTQNNS* |
Ga0126379_132427621 | 3300010366 | Tropical Forest Soil | VYRRALTELERFLHHRPQNRRERLYGWARAVMPSPYTNPPGKA* |
Ga0134128_100341261 | 3300010373 | Terrestrial Soil | RRALMELERFLHSRPQTRRERLYGFAHPEMPASYANPETR* |
Ga0105239_101577494 | 3300010375 | Corn Rhizosphere | EVYRRALMELERYLHTRPQTRRERLYGWAHPEMPASYANPSPSRG* |
Ga0126381_1050550401 | 3300010376 | Tropical Forest Soil | EVYRRALMELERFLYTRPQTRRERLYGFAHPDMPASYTNPVTARGTS* |
Ga0137776_18391531 | 3300010937 | Sediment | ELERFLHHRPQNRRERLYGWARAVMPPNYTSPPEKA* |
Ga0136619_102919372 | 3300012185 | Polar Desert Sand | LDSVIDFKRESYRRALLELERFLHAKPATRRQRLYGIAYPEMPASYVGPAEAAGR* |
Ga0137364_108026622 | 3300012198 | Vadose Zone Soil | IPLENVIDFKREVYRRGLTELERYLHHRPQTRRERLYGWAHAVVPSPYSNPRV* |
Ga0137364_111591811 | 3300012198 | Vadose Zone Soil | LETVIDFKREVYRRALLELERYVHMKPQTRRERLYGFAHPVTPPSYDEPTPSSVD* |
Ga0137399_108325531 | 3300012203 | Vadose Zone Soil | DVYRRGLTELERFLHHRPQTRRERLYGWAHAVVPSPYNNPPSGEP* |
Ga0137380_104705012 | 3300012206 | Vadose Zone Soil | IDFKREVYRRALTELERFLHQRPQSRRKRLYGWAHTIVPSPYGNSSGDL* |
Ga0137376_104468901 | 3300012208 | Vadose Zone Soil | IPLEAVIDFKREVYRRALLELERYVHMKPQTRRERLYGFAHPVMPPSYAEPTPDTGD* |
Ga0137372_101816071 | 3300012350 | Vadose Zone Soil | TELERFLHHRPQTRRERLYGWAHAVVPSPYTNPPGDV* |
Ga0137372_105166182 | 3300012350 | Vadose Zone Soil | FKREVYRRALTELERFLHQRPQSRRKRLYGWTHTIVPSPYGNPSGDL* |
Ga0137369_110803551 | 3300012355 | Vadose Zone Soil | ELERFLHQRPQSRRQRLYGWAHSIMPSPYANPSGDA* |
Ga0137384_102044141 | 3300012357 | Vadose Zone Soil | ALTELERFLHDRPPSRRKRLYGWAHTIVPSPYGNPSGDL* |
Ga0157309_101973612 | 3300012895 | Soil | FKREVYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG* |
Ga0157297_102793451 | 3300012914 | Soil | IDFKREVYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG* |
Ga0137395_105413811 | 3300012917 | Vadose Zone Soil | REVYRRGLTELERYLHHRPQTRRERLYGWAHAVVPSPYSNPKA* |
Ga0164300_108810052 | 3300012951 | Soil | RALMELERYLHTRPQTRRERLYGWGHPEMPASYANPAASRG* |
Ga0164299_110156762 | 3300012958 | Soil | VPLESVIDFKREVYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG* |
Ga0126369_102114251 | 3300012971 | Tropical Forest Soil | DFKREVYRRALTELERFLHHRPQNRRERLYGWAHAVMPSPYTNPPGKA* |
Ga0164309_113243631 | 3300012984 | Soil | ELERFLHQRPQTRRERLYGWAHSVVPSPYTNPTGKA* |
Ga0164308_107685872 | 3300012985 | Soil | VIEFKRESYRRALLELERFLHAKPQTRRQRLYGIAHPAMPDSYIGPAMPTVD* |
Ga0164307_108622581 | 3300012987 | Soil | EVYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG* |
Ga0164307_110980782 | 3300012987 | Soil | VPLESVIDFKREVYRRALMELERYLHTRPQTRRERLYGWGHPEMPASYANPAASRG* |
Ga0164306_119577421 | 3300012988 | Soil | VPLESVIDFKREVYRRALMELERYLHTRPHTRRERLYGWAHPEMPP |
Ga0157373_110479432 | 3300013100 | Corn Rhizosphere | RGLMELERYLHTRPQTRRERLYGWAQPEMPASYANPAPSRG* |
Ga0157371_100170741 | 3300013102 | Corn Rhizosphere | PLESVIEFKREVYRRALLELERYLHAKPQTRRERLFGFAHPVMPPSYAEPVPRGE* |
Ga0157370_116842832 | 3300013104 | Corn Rhizosphere | EVYRRALMELERFLYSRPQTRRERLYGFAHPEMPASYANPVTARGVS* |
Ga0163162_115107051 | 3300013306 | Switchgrass Rhizosphere | DFKREVYRRALLELERYLHTRPHTRRERLYGWAHPEMPPSYANPVPSRG* |
Ga0163162_128256901 | 3300013306 | Switchgrass Rhizosphere | EFKREVYRRALLELERYIHMKPQTRRERLYGFAHPVMPPSYGEPSHSEN* |
Ga0157372_117372661 | 3300013307 | Corn Rhizosphere | PLESVIDFKREVYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG* |
Ga0157375_121309641 | 3300013308 | Miscanthus Rhizosphere | FKREVYRRALLELERFAHMKPQTRRERLYGFGHPVMPPSYADPNVTSSD* |
Ga0134075_102244211 | 3300014154 | Grasslands Soil | ELERYLHHHPQTRRERLYGWAHAVVPSPYTNPPGKA* |
Ga0157380_126918592 | 3300014326 | Switchgrass Rhizosphere | EVYRRALTELERFMHAHPQTRRERLYGFPHPMMPSSYSDPMG* |
Ga0182019_105253653 | 3300014498 | Fen | VIDFKRESYRRALLELERFLHAKPQTRRQRLYGSAHPAMPDSYGDPAMPTVD* |
Ga0132255_1020537862 | 3300015374 | Arabidopsis Rhizosphere | EFKRESYRRALLELERFLHSKPQTRRQRLYGVPHPEMPDSYSEPYVPAAK* |
Ga0132255_1027447412 | 3300015374 | Arabidopsis Rhizosphere | VIEFKREVYRRALTELERYLHMRPQTRRQRLFGMARQTVPESYSDPTSQEND* |
Ga0187824_100410541 | 3300017927 | Freshwater Sediment | DVYRRALTELERFLHQRPQSRRQRLYGWAHATAPSPYSNPSGKA |
Ga0187825_101063543 | 3300017930 | Freshwater Sediment | AVIDFKREVYRRALMELERFLYSRPQTRRERLYGFAHPEMPASYANPVTARGVS |
Ga0187777_110959372 | 3300017974 | Tropical Peatland | DFKRDVYRRGLMELERFLHQRPQTRRQRLYGWARSAMPPPYANPSGEA |
Ga0187766_105272391 | 3300018058 | Tropical Peatland | SVIEFKREVYRRGLTELERYLHQRPQTRRQRLYGWARSVMPPPYSNPTSKA |
Ga0184632_103388821 | 3300018075 | Groundwater Sediment | IDFKREVYRRALLELERYIHMKPQTRRERLFGLAHPVMPPSYGDPTANSGD |
Ga0190275_104619891 | 3300018432 | Soil | KREVYRRALLELERFLHAHPHTRLERLYGVAHHDMPASYAEPPMGTVEEGPA |
Ga0190274_103008873 | 3300018476 | Soil | VIDFKREVYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG |
Ga0190274_130658302 | 3300018476 | Soil | FKRESYRRALLELERFLHAKPQTRRQRLYGIAHPAMPDSYIDPAMPTVE |
Ga0066669_117246382 | 3300018482 | Grasslands Soil | FKREVYRRALLELERYIHMKPQTRRERLYGFAHPVTPPSYDEPTPTSGD |
Ga0173481_104386862 | 3300019356 | Soil | ESVIDFKREVYRRALMELERYLHMRPQTRRERLYGFAHPEMPASYANPAGSRG |
Ga0213900_1074082 | 3300021280 | Soil | VIDFKRDVYRRALLELERYMHVKPHTRRERLFGFAHPMTPPSYSDPDPVTPTGD |
Ga0210394_105430311 | 3300021420 | Soil | VIDFKRDVYRRALTELEHFLHQRPQTRRERLYGWAHAAVPARYGKPSGEA |
Ga0182009_103482161 | 3300021445 | Soil | YRRALLELERYLHAKPQTRRERLFGFAHPVMPPSYSDPVTRGD |
Ga0224452_11975102 | 3300022534 | Groundwater Sediment | KREVYRRALLVLERYIHMKPQTRRERLFGLAHPVMPPSYGDPTANSGD |
Ga0222622_105969791 | 3300022756 | Groundwater Sediment | REVYRRALLELERYLHAKPSTRRERLFGFAHPPVMPPSYAEPATRGD |
Ga0207645_104028862 | 3300025907 | Miscanthus Rhizosphere | VIDFKREVYRRALMELERYLHARPQTRRERLYGWAHPEMPPSYANPATSRT |
Ga0207663_107111611 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FKRESYRRALLELERFLHANPQTRRQRLFGIAHPAVPDSYADPAVPTGETSE |
Ga0207657_102289521 | 3300025919 | Corn Rhizosphere | YRRALMELERYLHTRPQTRRERLYGWAHPEMPASYANPSPSRG |
Ga0207650_103393494 | 3300025925 | Switchgrass Rhizosphere | LDSVIDFKREVYRRALMELERYLHTRPQTRRERLYGWAHPEMPASYANPSPSRS |
Ga0207664_107597181 | 3300025929 | Agricultural Soil | REVYRRGLMELDRYLHARPQTRRERLYGWAHPEMPASYTDPVTSRS |
Ga0207667_104348523 | 3300025949 | Corn Rhizosphere | IPLESVIEFKREVYRRALLELERYLHAKPQTRRERLFGFAHPVMPPSYAEPQ |
Ga0207640_111150132 | 3300025981 | Corn Rhizosphere | EVYRRALMELERFLHGRPQTRRERLYGWAHPEMPSSYANPVISR |
Ga0207639_109277572 | 3300026041 | Corn Rhizosphere | YRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG |
Ga0207639_109341472 | 3300026041 | Corn Rhizosphere | EGVIEFKRESYRRALLELERFLHAKPQTRRQRLYGIAHPAMPDSYIDPAMPTVD |
Ga0207639_115721021 | 3300026041 | Corn Rhizosphere | ELERFLHQRPQTRRERLYGWAHSVVPSPYTNPTGKA |
Ga0207678_114201662 | 3300026067 | Corn Rhizosphere | YRRALMELERFLYTRPQTRRERLYGFAHPEMPASYANPVTARGTG |
Ga0207648_107946012 | 3300026089 | Miscanthus Rhizosphere | SVIDFKREVYRRALMELERCLHMRPQTRRERLYGFAHQEMPASYTNPAGSRS |
Ga0207648_115320312 | 3300026089 | Miscanthus Rhizosphere | IDFKREVYRRALMELERYLHARPQTRRERLYGWAHPEMPPSYANPATSRT |
Ga0207676_104261291 | 3300026095 | Switchgrass Rhizosphere | LDSVIEFKREVYRRALTELERFMHAHPQTRRERLYGFPHPMMPSSYADPTSG |
Ga0207676_120016202 | 3300026095 | Switchgrass Rhizosphere | KREVYRRALTELERFMHAHPQTRRERLYGFPHPVMPPSYGEPSG |
Ga0209153_12795571 | 3300026312 | Soil | VIEFKREVYRRALLELERYIHMKPQTRRERLYGFAHPVMPPSYGEPTTSSGI |
Ga0209804_11122721 | 3300026335 | Soil | VYRRGLTELERYLHHRPQTRRERLYGWAHAVVPSPYSNPKA |
Ga0209805_10299424 | 3300026542 | Soil | LENVIDFKREVYRRGLTELERYLHHRPQTRRERLYGWAHAVVPSPYSNPKA |
Ga0209797_103819341 | 3300027831 | Wetland Sediment | LETVIEFKREVYRRALTELERFMHAHPQTRRERLYGLPHPAMPPSYADPATPPSYADPTTQDAP |
Ga0209683_104267091 | 3300027840 | Wetland Sediment | VIEFKREVYRRALTELERFMDARPQTRRERLYGFPHPVMPSSYADPAAQEGQ |
Ga0209591_103170661 | 3300027850 | Freshwater | FKRESYRRALLELERFLHAKPQTRRQRLYGVAQTDMPDSYADPAGTPSLDGA |
Ga0209397_106468882 | 3300027871 | Wetland | REVYRRALTELERYLHVRPQTRRQRLYGIPHPVMPPSYSEPGPSTAD |
Ga0209254_103330793 | 3300027897 | Freshwater Lake Sediment | FKREVYRRALTELERFMHAHPQTRRERLYGFAHPAMPSSYADPPG |
Ga0209668_101055173 | 3300027899 | Freshwater Lake Sediment | LDTVIDFKREVYRRALTELERYLHGRPQTRRQRLYGVAHPVMPPSYTEPGPSTAD |
Ga0209253_104370681 | 3300027900 | Freshwater Lake Sediment | RRALTELERFIEARPQTRRERLYGVSRPEMPPSYAEPIVQNGQ |
Ga0268265_116861022 | 3300028380 | Switchgrass Rhizosphere | IEFKREVYRRALVELERFLHARPQTRRERLFGVQHPSMPPAYEEPTAANGDAG |
Ga0247818_106871402 | 3300028589 | Soil | VYRRALMELERYLHMRPQTRRERLYGFAHQEMPASYTNPAGSRS |
Ga0302259_11362341 | 3300028861 | Fen | RALSELERYLHVRPQTRRERLFGFPHPQMPPSYSDPSVHEGD |
Ga0302263_101715911 | 3300028869 | Fen | LERYLHQRPQTRRERLYGWATQSVMPSPYPNSSGDA |
Ga0247827_103321832 | 3300028889 | Soil | VYRRGLMELERYLHTRPQTRRERLYGWAHPEMPASYANPAPSRG |
Ga0311332_114850112 | 3300029984 | Fen | EFKRESYRRALLELERFLYAKPQTRRQRLFGIEHPAMPDSYIDPAMPVD |
Ga0311337_120482042 | 3300030000 | Fen | DFKRESYRRALLELERFLHARPLARRPGGFGIEYPAMPDSYADPMTPSGD |
Ga0302299_102018693 | 3300030010 | Fen | EFKREVYRRALSELERYLHVRPQTRRERLFGFPHPQMPPSYSDPSIQDSD |
Ga0311333_100916213 | 3300030114 | Fen | TELERYLHQRPQTRRERLYGWATQSVMPSPYPNSSGDA |
Ga0311349_115185272 | 3300030294 | Fen | PLEGVIEFKRESYRRALLELERFLYAKPQTRRQRLFGIEHPAMPDSYIDPAMPVD |
Ga0311360_115209171 | 3300030339 | Bog | EVYRRALSELERYLHVRPQTRRERLFGFPHPQMPPSYSDPSVHEGD |
Ga0302211_102430671 | 3300030491 | Fen | ALTELERYLHQRPQTRRERLYGWATQSVMPSPYPNSSGDA |
Ga0302323_1004453621 | 3300031232 | Fen | LTELERYLHQRPQTRRERLYGWATQSVMPSPYPNSSGDA |
Ga0318534_103579663 | 3300031544 | Soil | RALTELERFLHHRPQNRRERLYGWAHAVMPSPYGHPSEKG |
Ga0307469_108017122 | 3300031720 | Hardwood Forest Soil | FKRDVYRRGLTELERYLHHRPQTRRERLYGWAHAVVPSPYTNPPGKV |
Ga0311351_100644991 | 3300031722 | Fen | EGVIEFKRESYRRALLELERFLHAKPQTRRQRLHGTAHPAMPDSYVDPAVPAVD |
Ga0318493_108318102 | 3300031723 | Soil | PLESVIDFKREVYRRALTELERFLHHRPQNRRQRLYGWAHAVMPSPYGQTSGKG |
Ga0302321_1025082371 | 3300031726 | Fen | VIEFKRESYRRALLELERFLYAKPVTRRQRLYGAPHAEMPDSYSDPVTPSTE |
Ga0318497_104065921 | 3300031805 | Soil | SVIDFKREVYRRALLELERYMHAKPHTRRERLFGFAHPMTPPSYSDPVTPTGD |
Ga0307473_110665421 | 3300031820 | Hardwood Forest Soil | DVYRRALTELERYLHHRPQTRRERLYGWAHSVMPSPYSNPSEKV |
Ga0318567_108996182 | 3300031821 | Soil | LDTVIEFKREAYRRALIELERFMDARPKTRRERLYGFPHPVMPASYADPPPPDGT |
Ga0318511_101929732 | 3300031845 | Soil | VIEFKREVYRRALLELERYMHAKPQTRRERLYGWAHPVMPPSYAEPVTPSGG |
Ga0307406_104738353 | 3300031901 | Rhizosphere | FKREVYRRALMELERYLHMRPQTRRERLYGFAHPEMPASYANPAGSRS |
Ga0315274_105103514 | 3300031999 | Sediment | DSVIEFKREVYRRGLTELERFMHAHPQTRRERLYGLAHPAMPSSYADPPG |
Ga0307416_1012421641 | 3300032002 | Rhizosphere | VPLEAVIDFKREVYRRALLELERFLHGRPQTRLERLYGVAHPVMPASYAEPLVRTGD |
Ga0315292_116748072 | 3300032143 | Sediment | LDSVIEFKREVYRRALTELERFIDARSHARRGRLYGLPHPERPASYAEPTVQTEQ |
Ga0315295_103056941 | 3300032156 | Sediment | VYRRALTELERFMHAHPQTRRERLYGFAHPVMPSSYADPPG |
Ga0307472_1000304451 | 3300032205 | Hardwood Forest Soil | RRALNELERFLHHRPQNRRQRLYGWARSVAPSPYPTPSSEV |
Ga0307472_1002650471 | 3300032205 | Hardwood Forest Soil | GLTELERFLHQRPQTRRERLYGWAHAVMPSPYTHPPGKA |
Ga0315286_107193122 | 3300032342 | Sediment | RESYRRALVELERFIDARPQTRRERLCGFPHPVMPPSYADPDPVTQSGS |
Ga0315273_103124801 | 3300032516 | Sediment | ETVIEFKRESYRRALVELERFIDARPQTRRERLYGFPHPVMPLSYADPDPVTQSGS |
Ga0335085_120032212 | 3300032770 | Soil | ALMELERFLHHRPQNRRERLYGWAHVVIPSPYANPPEKA |
Ga0335069_104469861 | 3300032893 | Soil | LDTVIEFKREAYRRALIELERFMDARPKTRRERLYGFPHPMMPDSYANPATQDEA |
Ga0335076_111128751 | 3300032955 | Soil | REVYRRALTELERFLHHRPQNRRERLYGWARAVMPPNYTSPPEKA |
Ga0316603_103893721 | 3300033413 | Soil | EFKRDVYRRALTELERFLHLRPQTRRERLFGVAHPVMPPSYADPSARSGD |
Ga0316625_1017601681 | 3300033418 | Soil | ETVIEFKRESYRRALLELERFLHVKPQTRRQRLYGVAQPEMPDSYADPVAPEAK |
Ga0310811_108752041 | 3300033475 | Soil | ESVIDFKREVYRRALMELERYLHTRPQTRRERLYGWAHPEMPASYANPSPSRG |
Ga0316629_109077361 | 3300033483 | Soil | ESVIEFKRDVYRRALTELERYLHLRPQTRRERLFGVAHPVMPASYADPSARSGD |
Ga0364933_003164_1_135 | 3300034150 | Sediment | KREVYRRALTELERFMHAHPQTRRERLYGLPHPVMPPSYGEPSG |
Ga0370501_0153528_3_158 | 3300034195 | Untreated Peat Soil | IEFKRESYRRALLELERFLHAKPQTRRQRLYGTAHPAMPDSYVDPAMPAID |
Ga0364943_0207670_1_159 | 3300034354 | Sediment | VIEFKRESYRRALLELERFLHAKPQTRRQRLYGIAHPAMPDSYIDPAMPTVE |
⦗Top⦘ |