Metagenome / Metatranscriptome Family F026875

Basic Information
Family ID	F026875
Family Type	Metagenome / Metatranscriptome
Number of Sequences	196
Average Sequence Length	64 residues
Representative Sequence	MSDSPPDEARKRRAWQKIQRQLDEALEASFPASDPVAIVTSHEEEDWGIEPAAPAPKPLPPRNP
Number of Associated Samples	153
Number of Associated Scaffolds	196

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	77.05 %
% of genes near scaffold ends (potentially truncated)	23.47 %
% of genes from short scaffolds (< 2000 bps)	59.18 %
Associated GOLD sequencing projects	138
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.35

Most Common Taxonomy
Group	Bacteria (83.673 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (19.388 % of family members)
Environment Ontology (ENVO)	Unclassified (28.571 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (64.796 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 27.17% β-sheet: 0.00% Coil/Unstructured: 72.83%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 196 Family Scaffolds
PF00009	GTP_EFTU	25.00
PF04293	SpoVR	22.45
PF14492	EFG_III	10.20
PF04285	DUF444	7.14
PF00483	NTP_transferase	3.06
PF02643	DUF192	2.04
PF00908	dTDP_sugar_isom	1.53
PF08298	AAA_PrkA	1.53
PF13578	Methyltransf_24	1.02
PF16363	GDP_Man_Dehyd	0.51
PF00196	GerE	0.51
PF02669	KdpC	0.51
PF03030	H_PPase	0.51
PF02195	ParBc	0.51
PF04679	DNA_ligase_A_C	0.51
PF02786	CPSase_L_D2	0.51
PF13796	Sensor	0.51

COG ID	Name	Functional Category	% Frequency in 196 Family Scaffolds
COG2719	Stage V sporulation protein SpoVR/YcgB, involved in spore cortex formation (function unknown)	Cell cycle control, cell division, chromosome partitioning [D]	22.45
COG2718	Uncharacterized conserved protein YeaH/YhbH, required for sporulation, DUF444 family	General function prediction only [R]	7.14
COG1430	Uncharacterized conserved membrane protein, UPF0127 family	Function unknown [S]	2.04
COG1898	dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme	Cell wall/membrane/envelope biogenesis [M]	1.53
COG2766	Predicted Ser/Thr protein kinase	Signal transduction mechanisms [T]	1.53
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.51
COG2156	K+-transporting ATPase, KdpC subunit	Inorganic ion transport and metabolism [P]	0.51
COG3808	Na+ or H+-translocating membrane pyrophosphatase	Energy production and conversion [C]	0.51

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	84.18 %
Unclassified	root	N/A	15.82 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	84.18 %
Unclassified	root	N/A	15.82 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	83.67 %
Unclassified	root	N/A	15.82 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.51 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	80.61 %
Unclassified	root	N/A	15.82 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	47.45 %
Unclassified	root	N/A	15.82 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5.10 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.51 %

Name	Rank	Taxonomy	Distribution
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	19.39 %
Unclassified	root	N/A	15.82 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.10 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	4.08 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	3.06 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae	4.08 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	2.04 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	0.51 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter	4.08 %
Thiohalomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas	0.51 %
Arhodomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas	0.51 %
Rubrivivax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax	0.51 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Euphorbiaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Acalyphoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Acalyphoideae	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Acalypheae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Acalyphoideae → Acalypheae	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Ricinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Acalyphoideae → Acalypheae → Ricinus	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	19.39 %
Unclassified	root	N/A	15.82 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4.08 %
Ricinus communis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Acalyphoideae → Acalypheae → Ricinus → Ricinus communis	0.51 %
Thiohalomonas denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	0.51 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.51 %
Arhodomonas aquaeolei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908007\|FWIRElOz_GKZ9IRQ02JX78F	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	516	Open in IMG/M
3300001546\|JGI12659J15293_10015286	All Organisms → cellular organisms → Bacteria → Proteobacteria	2085	Open in IMG/M
3300001593\|JGI12635J15846_10782335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	547	Open in IMG/M
3300001661\|JGI12053J15887_10023074	All Organisms → cellular organisms → Bacteria → Proteobacteria	3486	Open in IMG/M
3300002557\|JGI25381J37097_1003372	All Organisms → cellular organisms → Bacteria → Proteobacteria	2733	Open in IMG/M
3300002909\|JGI25388J43891_1003393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3280	Open in IMG/M
3300002911\|JGI25390J43892_10001538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Arhodomonas → Arhodomonas aquaeolei	4815	Open in IMG/M
3300002911\|JGI25390J43892_10106290	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300004091\|Ga0062387_101798470	All Organisms → cellular organisms → Bacteria → Proteobacteria	500	Open in IMG/M
3300004479\|Ga0062595_100057590	Not Available	1825	Open in IMG/M
3300005167\|Ga0066672_10142005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	1500	Open in IMG/M
3300005167\|Ga0066672_10807697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	589	Open in IMG/M
3300005167\|Ga0066672_10839319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	574	Open in IMG/M
3300005175\|Ga0066673_10043332	All Organisms → cellular organisms → Bacteria → Proteobacteria	2236	Open in IMG/M
3300005176\|Ga0066679_10113384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1662	Open in IMG/M
3300005176\|Ga0066679_10238347	All Organisms → cellular organisms → Bacteria → Proteobacteria	1169	Open in IMG/M
3300005177\|Ga0066690_10003888	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	6601	Open in IMG/M
3300005186\|Ga0066676_10206487	All Organisms → cellular organisms → Bacteria → Proteobacteria	1265	Open in IMG/M
3300005187\|Ga0066675_10950940	All Organisms → cellular organisms → Bacteria → Proteobacteria	647	Open in IMG/M
3300005332\|Ga0066388_103143264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	844	Open in IMG/M
3300005332\|Ga0066388_103444854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	808	Open in IMG/M
3300005334\|Ga0068869_100037974	All Organisms → cellular organisms → Bacteria → Proteobacteria	3428	Open in IMG/M
3300005335\|Ga0070666_10008427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6401	Open in IMG/M
3300005364\|Ga0070673_100026410	All Organisms → cellular organisms → Bacteria → Proteobacteria	4288	Open in IMG/M
3300005437\|Ga0070710_10041060	All Organisms → cellular organisms → Bacteria → Proteobacteria	2552	Open in IMG/M
3300005444\|Ga0070694_100245850	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1351	Open in IMG/M
3300005450\|Ga0066682_10001890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	8684	Open in IMG/M
3300005454\|Ga0066687_10002515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5854	Open in IMG/M
3300005454\|Ga0066687_10207154	All Organisms → cellular organisms → Bacteria → Proteobacteria	1074	Open in IMG/M
3300005538\|Ga0070731_10236746	All Organisms → cellular organisms → Bacteria → Proteobacteria	1212	Open in IMG/M
3300005538\|Ga0070731_10899388	All Organisms → cellular organisms → Bacteria → Proteobacteria	587	Open in IMG/M
3300005558\|Ga0066698_10098159	All Organisms → cellular organisms → Bacteria → Proteobacteria	1930	Open in IMG/M
3300005559\|Ga0066700_10321903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1091	Open in IMG/M
3300005561\|Ga0066699_10511360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	859	Open in IMG/M
3300005561\|Ga0066699_10653459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	753	Open in IMG/M
3300005576\|Ga0066708_10729797	All Organisms → cellular organisms → Bacteria → Proteobacteria	625	Open in IMG/M
3300005586\|Ga0066691_10192432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1186	Open in IMG/M
3300005586\|Ga0066691_10635676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	633	Open in IMG/M
3300005591\|Ga0070761_10000735	All Organisms → cellular organisms → Bacteria → Proteobacteria	20867	Open in IMG/M
3300005591\|Ga0070761_10009232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thiohalomonas → Thiohalomonas denitrificans	5595	Open in IMG/M
3300005617\|Ga0068859_103104555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	506	Open in IMG/M
3300005840\|Ga0068870_11091708	All Organisms → cellular organisms → Bacteria → Proteobacteria	573	Open in IMG/M
3300005841\|Ga0068863_101327381	All Organisms → cellular organisms → Bacteria → Proteobacteria	726	Open in IMG/M
3300005842\|Ga0068858_100613239	All Organisms → cellular organisms → Bacteria → Proteobacteria	1056	Open in IMG/M
3300006034\|Ga0066656_10195051	All Organisms → cellular organisms → Bacteria → Proteobacteria	1287	Open in IMG/M
3300006574\|Ga0074056_11139597	All Organisms → cellular organisms → Bacteria → Proteobacteria	1163	Open in IMG/M
3300006796\|Ga0066665_10571181	All Organisms → cellular organisms → Bacteria → Proteobacteria	916	Open in IMG/M
3300006800\|Ga0066660_10473646	All Organisms → cellular organisms → Bacteria → Proteobacteria	1050	Open in IMG/M
3300006903\|Ga0075426_10110173	All Organisms → cellular organisms → Bacteria → Proteobacteria	1976	Open in IMG/M
3300006953\|Ga0074063_10076044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4459	Open in IMG/M
3300007788\|Ga0099795_10017848	All Organisms → cellular organisms → Bacteria → Proteobacteria	2269	Open in IMG/M
3300009093\|Ga0105240_11969963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	607	Open in IMG/M
3300009101\|Ga0105247_10047710	All Organisms → cellular organisms → Bacteria → Proteobacteria	2631	Open in IMG/M
3300009137\|Ga0066709_102988113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	621	Open in IMG/M
3300009174\|Ga0105241_10088543	All Organisms → cellular organisms → Bacteria → Proteobacteria	2438	Open in IMG/M
3300009826\|Ga0123355_10446986	All Organisms → cellular organisms → Bacteria → Proteobacteria	1632	Open in IMG/M
3300010303\|Ga0134082_10272397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	705	Open in IMG/M
3300010303\|Ga0134082_10564656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	502	Open in IMG/M
3300010321\|Ga0134067_10201705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	731	Open in IMG/M
3300010376\|Ga0126381_102252600	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300010398\|Ga0126383_10352381	All Organisms → cellular organisms → Bacteria → Proteobacteria	1493	Open in IMG/M
3300010401\|Ga0134121_10010442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7375	Open in IMG/M
3300011120\|Ga0150983_13675918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	546	Open in IMG/M
3300012203\|Ga0137399_10010417	All Organisms → cellular organisms → Bacteria → Proteobacteria	5561	Open in IMG/M
3300012205\|Ga0137362_10001873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	13394	Open in IMG/M
3300012207\|Ga0137381_10144236	All Organisms → cellular organisms → Bacteria → Proteobacteria	2045	Open in IMG/M
3300012224\|Ga0134028_1208002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	516	Open in IMG/M
3300012285\|Ga0137370_10133103	Not Available	1427	Open in IMG/M
3300012285\|Ga0137370_10474577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	764	Open in IMG/M
3300012285\|Ga0137370_10589772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	686	Open in IMG/M
3300012351\|Ga0137386_10044994	All Organisms → cellular organisms → Bacteria → Proteobacteria	3036	Open in IMG/M
3300012362\|Ga0137361_10139309	All Organisms → cellular organisms → Bacteria → Proteobacteria	2156	Open in IMG/M
3300012381\|Ga0134026_1005832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	941	Open in IMG/M
3300012582\|Ga0137358_10205657	All Organisms → cellular organisms → Bacteria → Proteobacteria	1343	Open in IMG/M
3300012685\|Ga0137397_11083439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	585	Open in IMG/M
3300012925\|Ga0137419_10424362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1043	Open in IMG/M
3300012927\|Ga0137416_11147600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	698	Open in IMG/M
3300012951\|Ga0164300_10770588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	592	Open in IMG/M
3300012971\|Ga0126369_12885897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	563	Open in IMG/M
3300012986\|Ga0164304_10937071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	680	Open in IMG/M
3300012989\|Ga0164305_10006202	All Organisms → cellular organisms → Bacteria → Proteobacteria	5462	Open in IMG/M
3300014150\|Ga0134081_10395665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	517	Open in IMG/M
3300014325\|Ga0163163_10617012	Not Available	1148	Open in IMG/M
3300015054\|Ga0137420_1104031	Not Available	1183	Open in IMG/M
3300015356\|Ga0134073_10024187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Acalyphoideae → Acalypheae → Ricinus → Ricinus communis	1481	Open in IMG/M
3300017959\|Ga0187779_10169699	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	1354	Open in IMG/M
3300017961\|Ga0187778_10002285	Not Available	13099	Open in IMG/M
3300017961\|Ga0187778_10013193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5112	Open in IMG/M
3300017970\|Ga0187783_10002612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	13334	Open in IMG/M
3300017970\|Ga0187783_10036970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3618	Open in IMG/M
3300017970\|Ga0187783_10040489	All Organisms → cellular organisms → Bacteria → Proteobacteria	3451	Open in IMG/M
3300017970\|Ga0187783_11009502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	599	Open in IMG/M
3300017970\|Ga0187783_11397933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	504	Open in IMG/M
3300017972\|Ga0187781_10028750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3839	Open in IMG/M
3300018060\|Ga0187765_10692898	All Organisms → cellular organisms → Bacteria	668	Open in IMG/M
3300018060\|Ga0187765_11222825	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	528	Open in IMG/M
3300018062\|Ga0187784_10113117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2213	Open in IMG/M
3300018086\|Ga0187769_11533872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	504	Open in IMG/M
3300018090\|Ga0187770_10725670	All Organisms → cellular organisms → Bacteria	793	Open in IMG/M
3300018431\|Ga0066655_10009543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4145	Open in IMG/M
3300018433\|Ga0066667_10643602	All Organisms → cellular organisms → Bacteria → Proteobacteria	886	Open in IMG/M
3300018433\|Ga0066667_11582037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	583	Open in IMG/M
3300018468\|Ga0066662_10032233	All Organisms → cellular organisms → Bacteria → Proteobacteria	3126	Open in IMG/M
3300018482\|Ga0066669_11960978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	547	Open in IMG/M
3300020199\|Ga0179592_10093957	Not Available	1376	Open in IMG/M
3300020199\|Ga0179592_10314305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	694	Open in IMG/M
3300020579\|Ga0210407_10073274	Not Available	2574	Open in IMG/M
3300020579\|Ga0210407_11061673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	615	Open in IMG/M
3300020582\|Ga0210395_10054125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2940	Open in IMG/M
3300020582\|Ga0210395_10619793	Not Available	811	Open in IMG/M
3300021086\|Ga0179596_10567863	Not Available	575	Open in IMG/M
3300021171\|Ga0210405_10006896	All Organisms → cellular organisms → Bacteria → Proteobacteria	10054	Open in IMG/M
3300021178\|Ga0210408_10035046	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3956	Open in IMG/M
3300021178\|Ga0210408_10067901	Not Available	2785	Open in IMG/M
3300021402\|Ga0210385_10001028	All Organisms → cellular organisms → Bacteria → Proteobacteria	17638	Open in IMG/M
3300021403\|Ga0210397_10063482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2401	Open in IMG/M
3300021420\|Ga0210394_10413783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1186	Open in IMG/M
3300021420\|Ga0210394_10452859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1129	Open in IMG/M
3300021432\|Ga0210384_10009239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	10186	Open in IMG/M
3300021432\|Ga0210384_10265669	Not Available	1544	Open in IMG/M
3300022506\|Ga0242648_1022983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	814	Open in IMG/M
3300022515\|Ga0224546_1016904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	625	Open in IMG/M
3300025911\|Ga0207654_11230744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	546	Open in IMG/M
3300025927\|Ga0207687_10080771	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	2348	Open in IMG/M
3300025931\|Ga0207644_11562773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	553	Open in IMG/M
3300025960\|Ga0207651_10059043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2654	Open in IMG/M
3300025986\|Ga0207658_10078805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	2518	Open in IMG/M
3300025986\|Ga0207658_10186820	Not Available	1719	Open in IMG/M
3300026035\|Ga0207703_10320472	All Organisms → cellular organisms → Bacteria → Proteobacteria	1419	Open in IMG/M
3300026035\|Ga0207703_10742008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	935	Open in IMG/M
3300026095\|Ga0207676_11462377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	680	Open in IMG/M
3300026313\|Ga0209761_1315332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	537	Open in IMG/M
3300026314\|Ga0209268_1005072	All Organisms → cellular organisms → Bacteria → Proteobacteria	5828	Open in IMG/M
3300026316\|Ga0209155_1003258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	7357	Open in IMG/M
3300026318\|Ga0209471_1000151	All Organisms → cellular organisms → Bacteria → Proteobacteria	51019	Open in IMG/M
3300026318\|Ga0209471_1024187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3032	Open in IMG/M
3300026318\|Ga0209471_1060867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1718	Open in IMG/M
3300026323\|Ga0209472_1000004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	141281	Open in IMG/M
3300026325\|Ga0209152_10028689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1908	Open in IMG/M
3300026328\|Ga0209802_1040892	All Organisms → cellular organisms → Bacteria → Proteobacteria	2360	Open in IMG/M
3300026330\|Ga0209473_1007628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	5536	Open in IMG/M
3300026333\|Ga0209158_1350045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	513	Open in IMG/M
3300026335\|Ga0209804_1000311	All Organisms → cellular organisms → Bacteria → Proteobacteria	41960	Open in IMG/M
3300026335\|Ga0209804_1086873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1457	Open in IMG/M
3300026481\|Ga0257155_1073231	Not Available	552	Open in IMG/M
3300026508\|Ga0257161_1011268	Not Available	1623	Open in IMG/M
3300026538\|Ga0209056_10102423	Not Available	2331	Open in IMG/M
3300026542\|Ga0209805_1002987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	9732	Open in IMG/M
3300026548\|Ga0209161_10163630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1274	Open in IMG/M
3300027266\|Ga0209215_1014631	Not Available	983	Open in IMG/M
3300027480\|Ga0208993_1009364	All Organisms → cellular organisms → Bacteria → Proteobacteria	1677	Open in IMG/M
3300027546\|Ga0208984_1000882	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	4775	Open in IMG/M
3300027648\|Ga0209420_1000264	All Organisms → cellular organisms → Bacteria → Proteobacteria	30720	Open in IMG/M
3300027663\|Ga0208990_1015188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2553	Open in IMG/M
3300027703\|Ga0207862_1070569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1051	Open in IMG/M
3300027738\|Ga0208989_10015041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2651	Open in IMG/M
3300027738\|Ga0208989_10088554	All Organisms → cellular organisms → Bacteria → Proteobacteria	1057	Open in IMG/M
3300027821\|Ga0209811_10000585	All Organisms → cellular organisms → Bacteria → Proteobacteria	14535	Open in IMG/M
3300027853\|Ga0209274_10027772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	2607	Open in IMG/M
3300027855\|Ga0209693_10253085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	863	Open in IMG/M
3300027869\|Ga0209579_10603545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	595	Open in IMG/M
3300028381\|Ga0268264_10617272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1070	Open in IMG/M
3300028536\|Ga0137415_10936891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	676	Open in IMG/M
3300029951\|Ga0311371_12511360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	524	Open in IMG/M
3300029999\|Ga0311339_10413517	All Organisms → cellular organisms → Bacteria → Proteobacteria	1402	Open in IMG/M
3300031543\|Ga0318516_10532467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	673	Open in IMG/M
3300031679\|Ga0318561_10779591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	525	Open in IMG/M
3300031720\|Ga0307469_10255768	Not Available	1413	Open in IMG/M
3300031753\|Ga0307477_10000518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	41947	Open in IMG/M
3300031753\|Ga0307477_10008736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6997	Open in IMG/M
3300031753\|Ga0307477_10059776	All Organisms → cellular organisms → Bacteria	2625	Open in IMG/M
3300031778\|Ga0318498_10540437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	512	Open in IMG/M
3300031820\|Ga0307473_10113434	All Organisms → cellular organisms → Bacteria → Proteobacteria	1471	Open in IMG/M
3300031820\|Ga0307473_11367685	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300031954\|Ga0306926_12096576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	633	Open in IMG/M
3300031962\|Ga0307479_10082406	All Organisms → cellular organisms → Bacteria	3113	Open in IMG/M
3300031962\|Ga0307479_10212684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1905	Open in IMG/M
3300032089\|Ga0318525_10403025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	701	Open in IMG/M
3300032180\|Ga0307471_100376891	All Organisms → cellular organisms → Bacteria → Proteobacteria	1538	Open in IMG/M
3300032180\|Ga0307471_100565201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1293	Open in IMG/M
3300032180\|Ga0307471_101429205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	851	Open in IMG/M
3300032955\|Ga0335076_10300050	All Organisms → cellular organisms → Bacteria → Proteobacteria	1496	Open in IMG/M
3300033805\|Ga0314864_0005073	Not Available	2412	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	88.27%
Host-Associated	Host-Associated	11.73%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	86.22%
Plants	Host-Associated → Plants	11.22%
Aquatic	Environmental → Aquatic	2.04%
Arthropoda	Host-Associated → Arthropoda	0.51%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	84.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.12%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.59%
Sediment	Environmental → Aquatic → Sediment	1.53%
Peat	Environmental → Terrestrial → Peat	1.53%
Freshwater	Environmental → Aquatic → Freshwater	0.51%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.51%
Roots	Host-Associated → Plants → Roots	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	65.31%
Loam	Environmental → Terrestrial → Soil → Loam	11.22%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.16%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.06%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.06%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.53%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.53%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.51%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.51%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.51%

Habitat	Taxonomy	Distribution
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	25.00%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.45%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	17.35%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.18%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.16%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.06%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.53%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.53%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.02%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.02%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.51%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.51%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.51%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.51%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	19.39%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	11.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.71%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	7.14%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	5.61%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.61%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	5.61%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.06%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.04%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.04%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	2.04%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.53%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.53%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.02%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.02%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.02%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.02%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.02%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.51%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.51%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.51%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.51%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.51%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.51%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.51%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.51%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908007	Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2	Environmental	Open in IMG/M
3300001546	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1	Environmental	Open in IMG/M
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm	Environmental	Open in IMG/M
3300002909	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm	Environmental	Open in IMG/M
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300004091	Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental	Open in IMG/M
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental	Open in IMG/M
3300006574	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012224	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012381	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300022506	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022515	Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026305	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026314	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)	Environmental	Open in IMG/M
3300026316	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026330	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)	Environmental	Open in IMG/M
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026481	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A	Environmental	Open in IMG/M
3300026508	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027266	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027480	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)	Environmental	Open in IMG/M
3300027546	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027648	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)	Environmental	Open in IMG/M
3300027663	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)	Environmental	Open in IMG/M
3300027703	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)	Environmental	Open in IMG/M
3300027738	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027853	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)	Environmental	Open in IMG/M
3300027855	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300029951	III_Palsa_N1 coassembly	Environmental	Open in IMG/M
3300029999	I_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033805	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.35
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.35
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F026875

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign