Basic Information | |
---|---|
Family ID | F026833 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 196 |
Average Sequence Length | 45 residues |
Representative Sequence | MAPAVATYEPRDPSRTVLYTVIADHLETFLASLDADPDATGLPAY |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 196 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.20 % |
% of genes near scaffold ends (potentially truncated) | 77.04 % |
% of genes from short scaffolds (< 2000 bps) | 93.88 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.204 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (26.531 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.122 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.510 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.14% β-sheet: 0.00% Coil/Unstructured: 69.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 196 Family Scaffolds |
---|---|---|
PF04986 | Y2_Tnp | 6.12 |
PF14319 | Zn_Tnp_IS91 | 3.06 |
PF01797 | Y1_Tnp | 2.04 |
PF01609 | DDE_Tnp_1 | 1.53 |
PF01610 | DDE_Tnp_ISL3 | 1.53 |
PF00486 | Trans_reg_C | 1.02 |
PF08388 | GIIM | 1.02 |
PF08447 | PAS_3 | 1.02 |
PF00962 | A_deaminase | 0.51 |
PF14706 | Tnp_DNA_bind | 0.51 |
PF03167 | UDG | 0.51 |
PF13602 | ADH_zinc_N_2 | 0.51 |
PF14659 | Phage_int_SAM_3 | 0.51 |
PF13586 | DDE_Tnp_1_2 | 0.51 |
PF13565 | HTH_32 | 0.51 |
PF13360 | PQQ_2 | 0.51 |
PF13518 | HTH_28 | 0.51 |
PF13714 | PEP_mutase | 0.51 |
PF00528 | BPD_transp_1 | 0.51 |
PF07592 | DDE_Tnp_ISAZ013 | 0.51 |
PF07505 | DUF5131 | 0.51 |
PF13551 | HTH_29 | 0.51 |
PF13808 | DDE_Tnp_1_assoc | 0.51 |
PF01381 | HTH_3 | 0.51 |
PF02776 | TPP_enzyme_N | 0.51 |
PF00296 | Bac_luciferase | 0.51 |
PF13086 | AAA_11 | 0.51 |
PF04909 | Amidohydro_2 | 0.51 |
PF01175 | Urocanase | 0.51 |
PF13229 | Beta_helix | 0.51 |
PF05225 | HTH_psq | 0.51 |
PF13700 | DUF4158 | 0.51 |
PF13424 | TPR_12 | 0.51 |
PF12762 | DDE_Tnp_IS1595 | 0.51 |
PF01934 | HepT-like | 0.51 |
PF09339 | HTH_IclR | 0.51 |
PF01548 | DEDD_Tnp_IS110 | 0.51 |
PF07282 | OrfB_Zn_ribbon | 0.51 |
PF11867 | DUF3387 | 0.51 |
PF07690 | MFS_1 | 0.51 |
PF00361 | Proton_antipo_M | 0.51 |
PF12759 | HTH_Tnp_IS1 | 0.51 |
PF01051 | Rep_3 | 0.51 |
PF14863 | Alkyl_sulf_dimr | 0.51 |
PF01844 | HNH | 0.51 |
COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
---|---|---|---|
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.04 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.53 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.53 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.53 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 1.53 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.53 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.53 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.53 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.51 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.51 |
COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.51 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.51 |
COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.51 |
COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.51 |
COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 0.51 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.51 |
COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.51 |
COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.71 % |
Unclassified | root | N/A | 14.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_13337341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 518 | Open in IMG/M |
3300003993|Ga0055468_10292472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 519 | Open in IMG/M |
3300005174|Ga0066680_10734857 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300005174|Ga0066680_10924957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 515 | Open in IMG/M |
3300005294|Ga0065705_10894560 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005332|Ga0066388_107365422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 553 | Open in IMG/M |
3300005332|Ga0066388_107812925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 535 | Open in IMG/M |
3300005445|Ga0070708_101683966 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005447|Ga0066689_10228842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
3300005467|Ga0070706_100025330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5459 | Open in IMG/M |
3300005471|Ga0070698_100278743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1603 | Open in IMG/M |
3300005471|Ga0070698_100954093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
3300005552|Ga0066701_10468885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 782 | Open in IMG/M |
3300005552|Ga0066701_10769486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 575 | Open in IMG/M |
3300005554|Ga0066661_10826990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 542 | Open in IMG/M |
3300005555|Ga0066692_10827394 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 569 | Open in IMG/M |
3300005559|Ga0066700_11071368 | Not Available | 528 | Open in IMG/M |
3300005586|Ga0066691_10742602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 580 | Open in IMG/M |
3300005713|Ga0066905_100985082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 743 | Open in IMG/M |
3300005764|Ga0066903_100294999 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
3300005764|Ga0066903_101660396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1215 | Open in IMG/M |
3300005764|Ga0066903_104524442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 741 | Open in IMG/M |
3300005764|Ga0066903_108466422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 525 | Open in IMG/M |
3300006796|Ga0066665_10899430 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300006796|Ga0066665_10952431 | Not Available | 661 | Open in IMG/M |
3300006797|Ga0066659_11205089 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300006844|Ga0075428_100836780 | Not Available | 977 | Open in IMG/M |
3300006845|Ga0075421_100341937 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300006847|Ga0075431_100167513 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300006847|Ga0075431_100521637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
3300006871|Ga0075434_100913312 | Not Available | 893 | Open in IMG/M |
3300006871|Ga0075434_102186787 | Not Available | 557 | Open in IMG/M |
3300006880|Ga0075429_100909908 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300006904|Ga0075424_100242048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1918 | Open in IMG/M |
3300006954|Ga0079219_12277258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300007076|Ga0075435_101600427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 572 | Open in IMG/M |
3300007255|Ga0099791_10031521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 2329 | Open in IMG/M |
3300009012|Ga0066710_100092838 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 3998 | Open in IMG/M |
3300009012|Ga0066710_100853325 | Not Available | 1399 | Open in IMG/M |
3300009012|Ga0066710_102673623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 713 | Open in IMG/M |
3300009012|Ga0066710_103436347 | Not Available | 601 | Open in IMG/M |
3300009012|Ga0066710_104505680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 521 | Open in IMG/M |
3300009012|Ga0066710_104518839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 520 | Open in IMG/M |
3300009038|Ga0099829_10227930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1515 | Open in IMG/M |
3300009090|Ga0099827_10443764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1112 | Open in IMG/M |
3300009090|Ga0099827_11289767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 635 | Open in IMG/M |
3300009137|Ga0066709_100409111 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
3300009137|Ga0066709_100836324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1337 | Open in IMG/M |
3300009137|Ga0066709_101381593 | Not Available | 1026 | Open in IMG/M |
3300009137|Ga0066709_101572344 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300009147|Ga0114129_10541770 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1515 | Open in IMG/M |
3300009147|Ga0114129_10656926 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300009147|Ga0114129_11976114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 706 | Open in IMG/M |
3300009147|Ga0114129_12233433 | Not Available | 658 | Open in IMG/M |
3300009147|Ga0114129_13418492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 510 | Open in IMG/M |
3300009156|Ga0111538_12329901 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300009162|Ga0075423_12785189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 535 | Open in IMG/M |
3300009176|Ga0105242_13287742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 502 | Open in IMG/M |
3300009444|Ga0114945_10045352 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
3300009444|Ga0114945_11073628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 501 | Open in IMG/M |
3300009813|Ga0105057_1086312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 564 | Open in IMG/M |
3300009837|Ga0105058_1054137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 901 | Open in IMG/M |
3300010046|Ga0126384_10285977 | Not Available | 1349 | Open in IMG/M |
3300010046|Ga0126384_10300300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1320 | Open in IMG/M |
3300010046|Ga0126384_10302674 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300010046|Ga0126384_10843644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 823 | Open in IMG/M |
3300010046|Ga0126384_11697976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 597 | Open in IMG/M |
3300010046|Ga0126384_11698998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 597 | Open in IMG/M |
3300010046|Ga0126384_12311157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 519 | Open in IMG/M |
3300010047|Ga0126382_10352681 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300010047|Ga0126382_10467214 | Not Available | 1005 | Open in IMG/M |
3300010047|Ga0126382_10539113 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300010047|Ga0126382_11188383 | Not Available | 682 | Open in IMG/M |
3300010047|Ga0126382_11719914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 586 | Open in IMG/M |
3300010047|Ga0126382_12410820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 511 | Open in IMG/M |
3300010048|Ga0126373_12874359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 537 | Open in IMG/M |
3300010301|Ga0134070_10376461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 555 | Open in IMG/M |
3300010329|Ga0134111_10544873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 514 | Open in IMG/M |
3300010335|Ga0134063_10440951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 644 | Open in IMG/M |
3300010337|Ga0134062_10485250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 619 | Open in IMG/M |
3300010358|Ga0126370_11046641 | Not Available | 748 | Open in IMG/M |
3300010359|Ga0126376_10300921 | Not Available | 1395 | Open in IMG/M |
3300010359|Ga0126376_10756885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 943 | Open in IMG/M |
3300010359|Ga0126376_11017005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 830 | Open in IMG/M |
3300010359|Ga0126376_12319557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 583 | Open in IMG/M |
3300010359|Ga0126376_12332796 | Not Available | 581 | Open in IMG/M |
3300010359|Ga0126376_12840252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 534 | Open in IMG/M |
3300010360|Ga0126372_10604122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1053 | Open in IMG/M |
3300010360|Ga0126372_11088818 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300010360|Ga0126372_12581714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 559 | Open in IMG/M |
3300010361|Ga0126378_10522410 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300010361|Ga0126378_12228518 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300010361|Ga0126378_12263228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 620 | Open in IMG/M |
3300010361|Ga0126378_13441912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 502 | Open in IMG/M |
3300010362|Ga0126377_10412944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1364 | Open in IMG/M |
3300010362|Ga0126377_10823137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 988 | Open in IMG/M |
3300010362|Ga0126377_11436557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 763 | Open in IMG/M |
3300010362|Ga0126377_11446446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 761 | Open in IMG/M |
3300010362|Ga0126377_11628779 | Not Available | 720 | Open in IMG/M |
3300010362|Ga0126377_12323294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 612 | Open in IMG/M |
3300010362|Ga0126377_12882925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300010366|Ga0126379_10594590 | Not Available | 1191 | Open in IMG/M |
3300010366|Ga0126379_10894530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 990 | Open in IMG/M |
3300010366|Ga0126379_11447504 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300010366|Ga0126379_11474437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 786 | Open in IMG/M |
3300010366|Ga0126379_12655802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 598 | Open in IMG/M |
3300010366|Ga0126379_13210057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 547 | Open in IMG/M |
3300010376|Ga0126381_101007716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1202 | Open in IMG/M |
3300010398|Ga0126383_10548761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1221 | Open in IMG/M |
3300010398|Ga0126383_11970679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 672 | Open in IMG/M |
3300010398|Ga0126383_12491422 | Not Available | 602 | Open in IMG/M |
3300010398|Ga0126383_12739486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 575 | Open in IMG/M |
3300011270|Ga0137391_10944480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
3300011439|Ga0137432_1266728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 549 | Open in IMG/M |
3300012096|Ga0137389_11828196 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012189|Ga0137388_11800801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 544 | Open in IMG/M |
3300012199|Ga0137383_10221919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Endozoicomonadaceae → Endozoicomonas → unclassified Endozoicomonas → Endozoicomonas sp. SM1973 | 1385 | Open in IMG/M |
3300012199|Ga0137383_10869548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 658 | Open in IMG/M |
3300012203|Ga0137399_10046940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 3110 | Open in IMG/M |
3300012205|Ga0137362_10080113 | Not Available | 2722 | Open in IMG/M |
3300012207|Ga0137381_10377384 | Not Available | 1236 | Open in IMG/M |
3300012207|Ga0137381_10730621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 860 | Open in IMG/M |
3300012207|Ga0137381_10734027 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300012209|Ga0137379_10934010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 772 | Open in IMG/M |
3300012209|Ga0137379_11454423 | Not Available | 587 | Open in IMG/M |
3300012210|Ga0137378_11484087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 589 | Open in IMG/M |
3300012285|Ga0137370_11006407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 513 | Open in IMG/M |
3300012349|Ga0137387_11096576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 567 | Open in IMG/M |
3300012350|Ga0137372_10194128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1629 | Open in IMG/M |
3300012350|Ga0137372_10434241 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300012351|Ga0137386_11112622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 557 | Open in IMG/M |
3300012353|Ga0137367_10733710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 687 | Open in IMG/M |
3300012354|Ga0137366_11041580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 567 | Open in IMG/M |
3300012356|Ga0137371_11097945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 598 | Open in IMG/M |
3300012356|Ga0137371_11396983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 514 | Open in IMG/M |
3300012359|Ga0137385_10330582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1307 | Open in IMG/M |
3300012359|Ga0137385_11443314 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012362|Ga0137361_10253662 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300012362|Ga0137361_10981572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 764 | Open in IMG/M |
3300012362|Ga0137361_11513317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 593 | Open in IMG/M |
3300012582|Ga0137358_10444650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 875 | Open in IMG/M |
3300012683|Ga0137398_10209747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1287 | Open in IMG/M |
3300012918|Ga0137396_10019588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 4315 | Open in IMG/M |
3300012918|Ga0137396_10050123 | All Organisms → cellular organisms → Bacteria | 2859 | Open in IMG/M |
3300012925|Ga0137419_10007238 | All Organisms → cellular organisms → Bacteria | 5731 | Open in IMG/M |
3300012927|Ga0137416_10355701 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300012930|Ga0137407_11739758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 594 | Open in IMG/M |
3300012971|Ga0126369_11488111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 767 | Open in IMG/M |
3300012971|Ga0126369_12537995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 598 | Open in IMG/M |
3300012971|Ga0126369_13373553 | Not Available | 523 | Open in IMG/M |
3300012971|Ga0126369_13411399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 521 | Open in IMG/M |
3300012971|Ga0126369_13478154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 516 | Open in IMG/M |
3300013306|Ga0163162_12811940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 560 | Open in IMG/M |
3300014154|Ga0134075_10501025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 544 | Open in IMG/M |
3300014271|Ga0075326_1261185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 534 | Open in IMG/M |
3300014488|Ga0182001_10260695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 676 | Open in IMG/M |
3300015264|Ga0137403_10720944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 856 | Open in IMG/M |
3300016270|Ga0182036_11027217 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300016319|Ga0182033_10405033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1154 | Open in IMG/M |
3300016357|Ga0182032_10810143 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300016371|Ga0182034_10191877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1572 | Open in IMG/M |
3300016371|Ga0182034_11351576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 622 | Open in IMG/M |
3300016422|Ga0182039_11806741 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300017792|Ga0163161_11612108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 573 | Open in IMG/M |
3300018056|Ga0184623_10106043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1299 | Open in IMG/M |
3300018056|Ga0184623_10488099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 527 | Open in IMG/M |
3300021560|Ga0126371_13007768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 571 | Open in IMG/M |
3300022195|Ga0222625_1322288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 990 | Open in IMG/M |
3300022563|Ga0212128_10091285 | Not Available | 1967 | Open in IMG/M |
3300025910|Ga0207684_10545571 | Not Available | 992 | Open in IMG/M |
3300025910|Ga0207684_11147777 | Not Available | 645 | Open in IMG/M |
3300025910|Ga0207684_11669568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 514 | Open in IMG/M |
3300026295|Ga0209234_1233464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 605 | Open in IMG/M |
3300027874|Ga0209465_10057986 | Not Available | 1862 | Open in IMG/M |
3300027882|Ga0209590_10401109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 886 | Open in IMG/M |
3300027903|Ga0209488_10310761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1176 | Open in IMG/M |
3300028536|Ga0137415_10264948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1525 | Open in IMG/M |
3300030006|Ga0299907_10047741 | All Organisms → cellular organisms → Bacteria | 3398 | Open in IMG/M |
3300031093|Ga0308197_10192072 | Not Available | 688 | Open in IMG/M |
3300031573|Ga0310915_10653762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 743 | Open in IMG/M |
3300031573|Ga0310915_11269356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 508 | Open in IMG/M |
3300031751|Ga0318494_10839053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 538 | Open in IMG/M |
3300031798|Ga0318523_10645363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 520 | Open in IMG/M |
3300031835|Ga0318517_10520110 | Not Available | 536 | Open in IMG/M |
3300031846|Ga0318512_10686110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 525 | Open in IMG/M |
3300031945|Ga0310913_10724771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 703 | Open in IMG/M |
3300031954|Ga0306926_10863307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1086 | Open in IMG/M |
3300031981|Ga0318531_10326281 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 694 | Open in IMG/M |
3300032002|Ga0307416_102961963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 568 | Open in IMG/M |
3300032035|Ga0310911_10898103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 511 | Open in IMG/M |
3300032054|Ga0318570_10548606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 527 | Open in IMG/M |
3300032055|Ga0318575_10712487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 507 | Open in IMG/M |
3300032090|Ga0318518_10546249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 592 | Open in IMG/M |
3300032205|Ga0307472_100099169 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300032261|Ga0306920_102407480 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300034644|Ga0370548_130432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 531 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 26.53% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.12% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.08% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.55% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.02% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.02% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.51% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.51% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.51% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_133373411 | 3300000363 | Soil | MLYVGALMTPAAATYEPRDPSSTVLYNVIAEHLETFLASLHDDPDAKGLPAYVE |
Ga0055468_102924722 | 3300003993 | Natural And Restored Wetlands | MAPAVATYEPRDPSRTVLYKVIAEHLETFLASFDADPDANLNIS* |
Ga0066680_107348572 | 3300005174 | Soil | MGAVMAPAIATYTPRDPSQTGLYHVIVAHLETFLASLDADPDATGLP |
Ga0066680_109249572 | 3300005174 | Soil | MEPAVATYEPRDPSHTVLYHVIADHLETFLASLDADPDAKG |
Ga0065705_108945602 | 3300005294 | Switchgrass Rhizosphere | MAPAVATYVPQDPSQTVLYHVIAEHLETFLASLADDSETTGLAAYVERE |
Ga0066388_1073654222 | 3300005332 | Tropical Forest Soil | MAPAVATYEPRDPSRTVLYHVIADHLETFPASLDADPDTPGLPAYVQREF |
Ga0066388_1078129252 | 3300005332 | Tropical Forest Soil | VATYAPRDPSSTVLYHVIAEHLETFLASLADDPEAQRVF* |
Ga0070708_1016839661 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPAVATYAPRDPSRTVLYQVIADHLATCLASCAADPDTTGLPAYVERKCLPMIILIPVN |
Ga0066689_102288422 | 3300005447 | Soil | MAPAVATYAPRDPSHTVLYTVIAEHLETFLASLEADPDAPGLPAYV* |
Ga0070706_1000253301 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPALATYEPRDPSCTVLYHVIADHLETFLASLDADPEATG |
Ga0070698_1002787432 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPAVATYEPRDPSRTVLYHVIADHLETFLASLDADPEARL* |
Ga0070698_1009540931 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPAVATYEPRDPSHTELYKVIADHLETFLTSLDADPDAKGLPAYVQREF |
Ga0066701_104688852 | 3300005552 | Soil | MAPAVATYAPRDPSHTVLYHVIAEHLETFLASCHDD |
Ga0066701_107694861 | 3300005552 | Soil | MAPVVATYEPRDPSRTVLYTVIADHLETFLASLDADPDA |
Ga0066661_108269902 | 3300005554 | Soil | MAPAIATYEPRDPSRTVLYKVIADHLATFLASFEGDPDATGLPAYVEREFYDYLSTRLKVF* |
Ga0066692_108273943 | 3300005555 | Soil | MAPALATYAPRDPSRTVLYTVIADHLETFLASLDADPEATGLPAY |
Ga0066700_110713681 | 3300005559 | Soil | MAPAVATYAPRDPSHTVLYTVIAEHLETFLASLADDPD |
Ga0066691_107426021 | 3300005586 | Soil | MAPAVATYEPRDPSRTVLYTVIADHLETFLASLDADPDA |
Ga0066905_1009850822 | 3300005713 | Tropical Forest Soil | MAPAVATYAPRDPSQTVLYHVIAEHLETFLASCHDDPDGSGLPAYV |
Ga0066903_1002949991 | 3300005764 | Tropical Forest Soil | MAPAVATYEPRDPSRTVLYKVIAEHLETFLASFDA |
Ga0066903_1016603963 | 3300005764 | Tropical Forest Soil | MAPAVATYQPWDPSSTVLYHVIAEHLETFLASLDADPDATGMPAYVQREF* |
Ga0066903_1045244422 | 3300005764 | Tropical Forest Soil | MAPAVATYEPRDPSRTVLYKVIAEHLETFLASFDADPDAKRLPD* |
Ga0066903_1084664221 | 3300005764 | Tropical Forest Soil | MAPTLATYAPRDPSRTVLSHVIADHLETFLASLHDDPDATGL |
Ga0066665_108994301 | 3300006796 | Soil | MAPALATYEPHDPSRTVLYKVIADQPETFLASFEADPDA |
Ga0066665_109524311 | 3300006796 | Soil | MAPAVATYEPHDPSSTVLSKVIAEHFETFLVSLDEDPDAKGLPAYVQREFYDY |
Ga0066659_112050891 | 3300006797 | Soil | MAPAVATYAPRDPSHTVLYTVIAEHLETFLASLADDPDAPGLPAYV |
Ga0075428_1008367801 | 3300006844 | Populus Rhizosphere | MTPSLQPAPSSYVPRDPSTTVLYHVIADYLETFLASLDADLNAKGLPAYI |
Ga0075421_1003419374 | 3300006845 | Populus Rhizosphere | MAPAVATYEPRDPSRTVLHRVIAEHLETFLTLLDDDPDAKGL |
Ga0075431_1001675133 | 3300006847 | Populus Rhizosphere | MAPAMATYEPRDPSRTVLYKVIANHLETFLAALDTDPAATGLPAYVHSLGFFIFCA* |
Ga0075431_1005216372 | 3300006847 | Populus Rhizosphere | MAPAVANYAPRDPSHTVLYHVIAEHLETFLASFHDDPDGSGLPAYVE |
Ga0075434_1009133121 | 3300006871 | Populus Rhizosphere | MAPAVATYAPRDPSQTVLYHVIAEHLETFLASLADDPEATGLPA |
Ga0075434_1021867872 | 3300006871 | Populus Rhizosphere | MASAVATYELRDPSSTVLDNVIAEHFETFLASLTDDPDAKGLLAYVQHEFYDY |
Ga0075429_1009099081 | 3300006880 | Populus Rhizosphere | MAPAVPTYAPRDSGDTVLYKVIAEHLETFLASCHDDPE |
Ga0075424_1002420483 | 3300006904 | Populus Rhizosphere | MAPDVATYAPRDPSQTVLYHVIAEHLETFLASCHDDPD |
Ga0079219_122772581 | 3300006954 | Agricultural Soil | MAPAVATYAPRDPSSTVLYHVIAEHLETLLASLDADPDATG |
Ga0075435_1016004273 | 3300007076 | Populus Rhizosphere | MATYEPRDPSRTVLYKVIANHLETFLAALDTDPAATGLPA |
Ga0099791_100315211 | 3300007255 | Vadose Zone Soil | RMAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQREFCNYL* |
Ga0066710_1000928385 | 3300009012 | Grasslands Soil | MPPAMATYEPRDPSSTVLSKVIAEHFETFLVSLDDDPDAKGLPAYV |
Ga0066710_1008533253 | 3300009012 | Grasslands Soil | MRDKKPANMAPAVATYEPRDPSHTVLYKVIADHLETFLASLDADPDAKGL |
Ga0066710_1026736231 | 3300009012 | Grasslands Soil | MAPAVATYEPRDPSSTVLSKVIAEHFETFLVSLDDDPDAKGLPAYV |
Ga0066710_1034363472 | 3300009012 | Grasslands Soil | MAPAVATYTPRDPSRTVLYHVIADHLETFLASLDADPDA |
Ga0066710_1045056801 | 3300009012 | Grasslands Soil | MAPDVATYAPRDPSRTVLYTVIADQLETLLASCEADPDAPGLPAS |
Ga0066710_1045188392 | 3300009012 | Grasslands Soil | MAPATATYEPRDPSSTVLYKVIAEHLETFLASFDADPDAKGLPAYVHENFTALWYFPVFITL |
Ga0099829_102279303 | 3300009038 | Vadose Zone Soil | MAPAIATYTPRDPSQTVLYHVIAEHLETFLASLNAA |
Ga0099827_104437642 | 3300009090 | Vadose Zone Soil | MAPAVATYEPRDPSHTVLYRVIAAHLETFLASCAADPERH* |
Ga0099827_112897672 | 3300009090 | Vadose Zone Soil | MAPALATYEPRDPSRTVLYTVIADPLETFLASLDADPDATGLPAYV |
Ga0066709_1004091113 | 3300009137 | Grasslands Soil | MAPAVATYELRDPSRTVLYHVIADHLETFLASLDADPDAAGLP |
Ga0066709_1008363242 | 3300009137 | Grasslands Soil | MAPATATYEPRDPSSTVLYKVIAEHLETFLASFDADPDAKGLPAYV |
Ga0066709_1013815931 | 3300009137 | Grasslands Soil | MAPAVATYEPRDPSRTVLYTVIADHLETFLASCEADP |
Ga0066709_1015723441 | 3300009137 | Grasslands Soil | MATYEPRDPSRTVLYKVVADHLETFLASLDADPDAKGLPAYV |
Ga0114129_105417702 | 3300009147 | Populus Rhizosphere | MAPAVATYAPRDPSSTVLYHVIAEHLETFLASLHDDPEA |
Ga0114129_106569263 | 3300009147 | Populus Rhizosphere | MAPAVPTYAPRDSGDTVLYKVIAEHLETFLALCNDAPEATGLPVYVER |
Ga0114129_119761142 | 3300009147 | Populus Rhizosphere | MAPAVPTYAPRDPSRTVLYHVIAEHLETFLASLADDPEA |
Ga0114129_122334332 | 3300009147 | Populus Rhizosphere | MAPALATYEPRDPSPTLLSQVVADHLETLLASLDADLDARGLPAYVERECYD |
Ga0114129_134184921 | 3300009147 | Populus Rhizosphere | MAPAVATYQPRDPSRTVLYHVIADHLETFLASLDAD |
Ga0111538_123299012 | 3300009156 | Populus Rhizosphere | MAPAVPTYTPRDPSQTVLYQVIAERLETFLASCHNDP |
Ga0075423_127851891 | 3300009162 | Populus Rhizosphere | MAPAVATYEPRDPSRTVLYKVIAEHLETFLASFDADPD |
Ga0105242_132877421 | 3300009176 | Miscanthus Rhizosphere | MAPAVATYVPQDPSQTVLYHVIAEHLETFLASLADDSETT |
Ga0114945_100453522 | 3300009444 | Thermal Springs | MALAVATYEPRDPSPTVLYRVIAAYLETFLASFDADPDAKGLPAYVEREFWVVSVPMPLRY* |
Ga0114945_110736281 | 3300009444 | Thermal Springs | MAPAVATYEPRDPSHTVLYKVIADHLETFLASLDADPDAKGLPAYVQR |
Ga0105057_10863121 | 3300009813 | Groundwater Sand | MAPAVTTYEPRDPSRTILYKVIAAHLDTLLASLDADPAATGLPAYVAREFSDYLPGGLLA |
Ga0105058_10541372 | 3300009837 | Groundwater Sand | MAPTVATYEPRDPSRTVLYKVIAEHLETFLASLDA |
Ga0126384_102859773 | 3300010046 | Tropical Forest Soil | MEGARMAPAVATYEPRDPSRTVLYTVIADHLETFLASLDADPDATGLPAYV |
Ga0126384_103003001 | 3300010046 | Tropical Forest Soil | MNPATPSRTVLYTVIADHLETFLASLDADPEATGLPAYV |
Ga0126384_103026741 | 3300010046 | Tropical Forest Soil | MAPAVATYAPRDPSQTVLYHAVADHLETLLTSLNTDPDATGLPAY |
Ga0126384_108436441 | 3300010046 | Tropical Forest Soil | MAPALATYAPREPSRTVLYTVIADHLETFLAALDADPDTT |
Ga0126384_116979761 | 3300010046 | Tropical Forest Soil | MAPAVATYEPRDPSHTVLYTVIADHLETFLAALDADPDATGLPAY |
Ga0126384_116989981 | 3300010046 | Tropical Forest Soil | MLYAGALMAPVAVTYVPRDPSSIVLYNVIAEHLETFLASLHDDPDAKGLPAYVER |
Ga0126384_123111571 | 3300010046 | Tropical Forest Soil | MAPAVATYAPRDPSRTVLYTVIADHLETFLASLDADPDAT |
Ga0126382_103526811 | 3300010047 | Tropical Forest Soil | MAPALAPVEARAPSRTVLYKVIADHLETLLASLDAAPAATGLPAYVQREF* |
Ga0126382_104672141 | 3300010047 | Tropical Forest Soil | MAPAVPTYAPRDPSQTVLSTVIAEHLETFLASLADDPEASGLPAS |
Ga0126382_105391132 | 3300010047 | Tropical Forest Soil | MAPAVTTYVPRDPRRTVLYHVIVDHLATLLASLDDGTS |
Ga0126382_111883832 | 3300010047 | Tropical Forest Soil | MAPAVATYAPRDPSHTVLYTVIAEHLETFLASLADDPEATGLPAYVQ |
Ga0126382_117199142 | 3300010047 | Tropical Forest Soil | MLYVGALMTPAAATYEPRDPRSTVLYNVIAAPLETFLASLHDDPDAKGLPA* |
Ga0126382_124108201 | 3300010047 | Tropical Forest Soil | MAPAVATYAPRDPSGTVLYHVIAEHLETFLASCDDDPEATGWPAYVQREFY |
Ga0126373_128743591 | 3300010048 | Tropical Forest Soil | RMAPAVATYEPRDPSHTVLYTVIADHLETFLASLADR* |
Ga0134070_103764611 | 3300010301 | Grasslands Soil | MAPAVATYEPHDPSRTVLYHVIAEHLETFLASLDADPEATGLPA |
Ga0134111_105448731 | 3300010329 | Grasslands Soil | MAHALATYEPRDPSCTVLYHVIADHLETFLASLDADPAAPG |
Ga0134063_104409511 | 3300010335 | Grasslands Soil | RTRDPSRTVLYKVIADHLATFLASFEGDPDATGLPAYVEREFYDYLSTRLKVF* |
Ga0134062_104852501 | 3300010337 | Grasslands Soil | MAPAVATYEPRDPSHTVLYHVIADHLATFLASLDADPDAKGFPAYVQREFDAY* |
Ga0126370_110466412 | 3300010358 | Tropical Forest Soil | MAPAVATYAPRDPSQTVLDNVIAEHLETFLASCHDAPEATGFPAYV |
Ga0126376_103009213 | 3300010359 | Tropical Forest Soil | MPPAVAPSAPRDPNGTVLYHVSAEHLETFLASVEADPDAAGLPA* |
Ga0126376_107568851 | 3300010359 | Tropical Forest Soil | MAPAVATYAPRDPSRTVLYHVSADHLETFLASLDAAPEATG |
Ga0126376_110170051 | 3300010359 | Tropical Forest Soil | MAPAVATDAPREPSQTVLYTVLAEHLETLLASLADAPEAPGFPAYVQREVDAY* |
Ga0126376_123195571 | 3300010359 | Tropical Forest Soil | MATYEPRAPSRTGLYQVSAAHLETLLVLRDDDPEVTGLPAYMR* |
Ga0126376_123327962 | 3300010359 | Tropical Forest Soil | MAPAVATYEPRDPSRTVLYTVIADHLETFLAALDADP |
Ga0126376_128402521 | 3300010359 | Tropical Forest Soil | MAPAVATYEPRDPSHTVLYTVIADHLATFLASLDADPDATGLPAYVER |
Ga0126372_106041221 | 3300010360 | Tropical Forest Soil | MAPAVATYEPRDPSHTVLYQVIADHLETFLAALDADPDATGLP |
Ga0126372_110888181 | 3300010360 | Tropical Forest Soil | MAPAFTTYEPRDPSRTVLYNVIADHLETFLASCEADPDAPGLP |
Ga0126372_125817141 | 3300010360 | Tropical Forest Soil | MAPTLATYAPRDPSRTVLYHVIADHLETFLASLHDDPDATGLPA |
Ga0126378_105224102 | 3300010361 | Tropical Forest Soil | MAPAVPTYAPRDSGDTVLYKVIAEHLETFLASGHDDPEATGL |
Ga0126378_122285181 | 3300010361 | Tropical Forest Soil | MAPAVATYAPRDPRGTVRYHVSAEHLETLLAALADAPEATGFPAYVQREF* |
Ga0126378_122632282 | 3300010361 | Tropical Forest Soil | MAPAAATYEPRDPSHTVLYTVIADHLETFLAALDA |
Ga0126378_134419121 | 3300010361 | Tropical Forest Soil | MAPAVATYAPRDPSQTVLYTVIAEHLETFLASLADDPEATGLPAY |
Ga0126377_104129443 | 3300010362 | Tropical Forest Soil | MAPAIATYEPRDPSSTVLYKVIADHLETFLASCEADPDAKGL |
Ga0126377_108231372 | 3300010362 | Tropical Forest Soil | MAPAVATYEPREPSSMVLYKVITEHLETFLASLYDDPDAKGLPDYVQREF* |
Ga0126377_114365572 | 3300010362 | Tropical Forest Soil | MAPALATYEPRDPSRTVLYHVIADHLETFLASLDD |
Ga0126377_114464461 | 3300010362 | Tropical Forest Soil | MAPALATYAPREPSRTVLSTVIADHLETFLASCEADPDAPGLPAYMQRELPQGRTSRL* |
Ga0126377_116287791 | 3300010362 | Tropical Forest Soil | MAPAVATYAPRDPSRTVLYTVIADHLETFLAALNADPDATGLPAYV |
Ga0126377_123232942 | 3300010362 | Tropical Forest Soil | MLYVGALMATVVAAYEPRDLSSPTLYKVIAEHLETFLALLDDDPDAKDLPAYV |
Ga0126377_128829252 | 3300010362 | Tropical Forest Soil | MAPAVATYAPRDPSRTVLYHVIAEHLETFLASLHD |
Ga0126379_105945901 | 3300010366 | Tropical Forest Soil | MAPAVATYAPRDPSGTVLYHVIAEHLETFLASCHDDPEATAIPAYVEREFYA |
Ga0126379_108945302 | 3300010366 | Tropical Forest Soil | MAPAVATYAPRDPRGTVRYHVSAEHLETLLASLADAPEATGFPAYVQREF* |
Ga0126379_114475042 | 3300010366 | Tropical Forest Soil | MAPAVATYAPRDPSGTVLYHVIAEHLETFLASCHDDPEA |
Ga0126379_114744372 | 3300010366 | Tropical Forest Soil | MAPAVATYAPRDPSGTVLYHVIAEHLETFLASLAD |
Ga0126379_126558021 | 3300010366 | Tropical Forest Soil | MAPAVATYEPRDPSQTVLYHAVADHLETLLASLNTDPDATGLPAYPYNVTFVC* |
Ga0126379_132100571 | 3300010366 | Tropical Forest Soil | MAPAVATYAPRDPSQTVLYHGIAEHLETFLASCEADPEATGLPAYVER |
Ga0126381_1010077162 | 3300010376 | Tropical Forest Soil | MAPAVATYEPRDPSRTVLSTVIADHLETLLASLDAD |
Ga0126383_105487612 | 3300010398 | Tropical Forest Soil | MAPALATYEPRDPNSTVLYKVIADHLETFLASLDADP |
Ga0126383_119706792 | 3300010398 | Tropical Forest Soil | MAPAVPTYTPRDRSQTVLYHVIAEHLEPFLASCRDDPEATGFPAYVEREFYD |
Ga0126383_124914221 | 3300010398 | Tropical Forest Soil | MAPALATYAPRDPSHTVLSTVIADHLETFLASLDADPDATGLP |
Ga0126383_127394861 | 3300010398 | Tropical Forest Soil | MAPAVPTYTPRDPSQTVLYQVIAEHLETFLASCHDDPEATG |
Ga0137391_109444801 | 3300011270 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLP |
Ga0137432_12667282 | 3300011439 | Soil | MAPAIATYTPRDPSQTVLYTVIAEHLETFLASCHDDPEATGFPAY |
Ga0137389_118281961 | 3300012096 | Vadose Zone Soil | MAPAIATYTPRDPSHTVLYHVIAEHLETFLASLADDPEATGLP |
Ga0137388_118008011 | 3300012189 | Vadose Zone Soil | MAPAVATYESRDPSRTVLYKVVAAHLETFLASLNAEPDARGLPAYV |
Ga0137383_102219191 | 3300012199 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVIAEHLETFLASFDADPDAKRLPDY |
Ga0137383_108695481 | 3300012199 | Vadose Zone Soil | MAPAIATYTPRDPSQTVLYHVIAEHLETFLASLDTDPEATGLPAYVQRAFYD* |
Ga0137399_100469403 | 3300012203 | Vadose Zone Soil | MAPAVATYESRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQREFCNCL* |
Ga0137362_100801131 | 3300012205 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQRESCNYL* |
Ga0137381_103773841 | 3300012207 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYHVIADHLETFLASLDADPDA |
Ga0137381_107306212 | 3300012207 | Vadose Zone Soil | MAPAIATYEPREPSSTVLYKVIADHLETLLASFEADLDAKGLPAYVERAFACRWTEKRML |
Ga0137381_107340271 | 3300012207 | Vadose Zone Soil | MAPALATYEPHDPSRTVLYKVIADHLETFLASCEAD |
Ga0137379_109340102 | 3300012209 | Vadose Zone Soil | MAPALATYEPRDPSRTVLSTVIADHLETFLASLDADPDAT |
Ga0137379_114544232 | 3300012209 | Vadose Zone Soil | MAPAVATYIPRDPSGTVLYHVIAEHLETFLASLADDPEATGLPAYVHSLGIFIFCV* |
Ga0137378_114840872 | 3300012210 | Vadose Zone Soil | MAPALATYEPRDPSRTVLYTVIADHLETFLASLDA |
Ga0137370_110064072 | 3300012285 | Vadose Zone Soil | MAPALATYAPRDPSRTVLYTVIADHLETFLASCEADPDAPGLPAYVQ |
Ga0137387_110965761 | 3300012349 | Vadose Zone Soil | MAPAVATYEPRDPSHTVLYTVIADPLETFLASLDADPDATGLPAYVERE |
Ga0137372_101941284 | 3300012350 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYHVIADHLETLLASLDADPDAAGLPASVQREFDAY* |
Ga0137372_104342411 | 3300012350 | Vadose Zone Soil | MAPALATYEPRDPSRTVLSHVIADHLETFLAALDADPEAPGLPASVQREFYAYL |
Ga0137386_111126221 | 3300012351 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYTVIADHLETFLASLDADPDATGLPAY |
Ga0137367_107337102 | 3300012353 | Vadose Zone Soil | MAPAVATYAPRDLSRTVLYKVIAEHLETFLASLADDPEATGLPAYV |
Ga0137366_110415801 | 3300012354 | Vadose Zone Soil | MAPALATYEPRDPSHTVLYHVIADHLETFLASCEADPDAPGLPAYVQ |
Ga0137371_110979451 | 3300012356 | Vadose Zone Soil | MAPAIATYTPRDPSQTVLYTVIAEHLETFLASCNDSPEAIGLPAYVELACYDY |
Ga0137371_113969832 | 3300012356 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYTVIADHLETFLASLDADPEATGLPA |
Ga0137385_103305821 | 3300012359 | Vadose Zone Soil | MAPAVATYEPRDPSSTVLYKVIAEHFETFLASLDDEPDAKGLPADVQDES* |
Ga0137385_114433141 | 3300012359 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYHVIADHLETFLASCEAEPDAPGLP |
Ga0137361_102536625 | 3300012362 | Vadose Zone Soil | MAPAIATYEPRDPSSTVLYKVIADHLETFLASFEADLDARGLPAYVQCEF* |
Ga0137361_109815721 | 3300012362 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQRESYNYL* |
Ga0137361_115133171 | 3300012362 | Vadose Zone Soil | MAPAVTTYEPRDPSRTVLYHVIADHLETFLASLDA |
Ga0137358_104446502 | 3300012582 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQRES* |
Ga0137398_102097472 | 3300012683 | Vadose Zone Soil | VPRDPSQTVLYHVVADYLETFLASLDADPDARGLPAYAEIFWG* |
Ga0137396_100195884 | 3300012918 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQRDFCNYL* |
Ga0137396_100501231 | 3300012918 | Vadose Zone Soil | MAPAVATYEPRDPSSTVLYKVIAEHLETFLATLAA |
Ga0137419_100072383 | 3300012925 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQREFCNCL* |
Ga0137416_103557012 | 3300012927 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQREFCNYL* |
Ga0137407_117397581 | 3300012930 | Vadose Zone Soil | MAPAIATYEPRDPSSTVLYKVIADHLETFLASFEADLDAKGLPAYVQCEF* |
Ga0126369_114881112 | 3300012971 | Tropical Forest Soil | MAPALATYAPRDPSHTVLYTVIADHLETFLASLDADPDAPGL |
Ga0126369_125379951 | 3300012971 | Tropical Forest Soil | MAPAVATYAPRDPISTVLYHTIAEHLETFLALLEADPEATGLPAYVQREFYDYLRHLSKQGKSS* |
Ga0126369_133735531 | 3300012971 | Tropical Forest Soil | MAPAVPTSTPQDPSQTVLYTVNASHRETLLASCPDAPEATGLPDYVQREFYDYLRC |
Ga0126369_134113991 | 3300012971 | Tropical Forest Soil | MAPALATYAPRDPSHTVLYTVIADHLETFLASLDADPDA |
Ga0126369_134781541 | 3300012971 | Tropical Forest Soil | MAPALATYEPRDRSRTVLYTVIADHLETFLASCEADPDAKGLPAYVQNS* |
Ga0163162_128119402 | 3300013306 | Switchgrass Rhizosphere | MAPALATYEPRDPSRTVLYTVIAAHLETFLASWEAAPDAKGLPACV |
Ga0134075_105010252 | 3300014154 | Grasslands Soil | MAPAVATYEPRDPSRTVLYHVIADHLETCLASLEADPDAPGLPAYVQREFD |
Ga0075326_12611851 | 3300014271 | Natural And Restored Wetlands | MAPAVATYEPRDPSRTVLYNAIAEHLETFLASLDDDPDAK |
Ga0182001_102606952 | 3300014488 | Soil | MAPAVATYAPRDPSQTVLYHVIAEHLETFLASLADG |
Ga0137403_107209442 | 3300015264 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYHVIADHLETFLASLDADP |
Ga0182036_110272172 | 3300016270 | Soil | MAPAVATYAPRDPSRTVLYTVIADHLETFLASCEADPDAIGLPAYV |
Ga0182033_104050331 | 3300016319 | Soil | MAPAVATYEPRDPSHTVLYHVIADHLETVLASFDAAPDATGLPASVQ |
Ga0182032_108101431 | 3300016357 | Soil | EGTRMAPAVATYAPRDPSRTVLYHVIADHLETFLASLDADPDAPGLPAYVHRQGICILRL |
Ga0182034_101918771 | 3300016371 | Soil | MAPAVATYEPRDPSHTVLYHVIADHLETVLASFDAAPDATGLPA |
Ga0182034_113515761 | 3300016371 | Soil | MAPAVATYVPRDPSGTVLDHVIAEHLETFLASLADDP |
Ga0182039_118067411 | 3300016422 | Soil | MAPAVATYAPRDPSGTVLYHVIAEHLETFLASLADDP |
Ga0163161_116121082 | 3300017792 | Switchgrass Rhizosphere | MAPAIATYTPRDPSQTVLYTVIAEHLETFLASLADDP |
Ga0184623_101060433 | 3300018056 | Groundwater Sediment | MAPAVATYEPRDPSRTVLYKVIADHLETFLASLDADPDAKGLPAYV |
Ga0184623_104880991 | 3300018056 | Groundwater Sediment | MAPAIATYEPRDPSRTILYKVIAEHLETFLASIDADPD |
Ga0126371_130077681 | 3300021560 | Tropical Forest Soil | MAPALATYAPRDPSRTVLYHVIADHLETFLASLHDDPDATGLP |
Ga0222625_13222882 | 3300022195 | Groundwater Sediment | MAPAIATYEPRDPSSTVLYKVIADHLETFLASFEADLDAKGLPA |
Ga0212128_100912852 | 3300022563 | Thermal Springs | MALAVATYEPRDPSPTVLYRVIAAYLETFLASFDADPDAKGLPAYVEREFWVVSVPMPLR |
Ga0207684_105455711 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPAVATYEPRNPSRTVLYTVIADHLETVLASLDADPDAT |
Ga0207684_111477772 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPAVATYAPRDPSHTVLYKVIADHLETFLASLDA |
Ga0207684_116695682 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPAVATYEPRDPSHTVLYTVIADHLETFLASLDADPDATGLPAYV |
Ga0209234_12334642 | 3300026295 | Grasslands Soil | MAPALATYEPRDPSRTVLYHVIADHLETFLAALDADPDAPG |
Ga0209465_100579861 | 3300027874 | Tropical Forest Soil | MVPTVATYEPRDPSRTVLYHVIADHLETFLASLDADPAATGLPAYV |
Ga0209590_104011091 | 3300027882 | Vadose Zone Soil | MAPAIATYEPRDPSRTVLYKVIADHLETFLASLDADPDA |
Ga0209488_103107613 | 3300027903 | Vadose Zone Soil | MAPAVATYTPRDPSGTVLYHVIAEHLETFLASLADDPEATGLPAYVG |
Ga0137415_102649482 | 3300028536 | Vadose Zone Soil | MAPAVATYEPRDPSRTVLYKVVADHPETFLASLDADPDAKGLPAYVQREFCNYL |
Ga0299907_100477413 | 3300030006 | Soil | MAPAVATYEPRDPSRTVLYRVIAAHLETFLALLDDDPDAKGLPAYGLPR |
Ga0308197_101920722 | 3300031093 | Soil | SYVPRDPSHTVLYTVVADYLETFLAALEADPEATGLPAYVERELYDRSIR |
Ga0310915_106537622 | 3300031573 | Soil | MAPAVATYEPRDPSHTVLYHVIADHLETVLASFDA |
Ga0310915_112693562 | 3300031573 | Soil | MAPAVATYVPRDPSGTVLDHVIAEHLETFLASLADAPEATGLPP |
Ga0318494_108390531 | 3300031751 | Soil | MAPAVATYEPRDPSHTVLYHVIADHLETVLASFDADPDATGLP |
Ga0318523_106453631 | 3300031798 | Soil | MAPAVATYEPRDPSHTVLYHVIADHLETVLASFDADPDATGLPASVQREFYAYVQCGILA |
Ga0318517_105201102 | 3300031835 | Soil | MAPAVATYAPRTPSGTVLYHVIAEHLETFLASCHDGPEATSFSAYVERELYD |
Ga0318512_106861102 | 3300031846 | Soil | MAPAVATYAPRDPSGTVLYHVIAEHLETFRASLADDPEAAGLPA |
Ga0310913_107247711 | 3300031945 | Soil | MAPAVATYAPRDPSGTVLYHVIAEHLETFLASLADDPEAAGLPAYVQ |
Ga0306926_108633072 | 3300031954 | Soil | MATYEPRDPSRTVLYKVIANHLETFLAALDTDPAATGL |
Ga0318531_103262811 | 3300031981 | Soil | MAPALATYAPRDPSRTVLYTVIADHLETFLASCEADPDASG |
Ga0307416_1029619631 | 3300032002 | Rhizosphere | MAPALATYEPRDPSSTLLYKVIADHLETFLASLDADPDAKGLPAY |
Ga0310911_108981031 | 3300032035 | Soil | MAPALATYAPRDPSRTVLYTVIADHLETFLASCEADPDASGLPAYVQ |
Ga0318570_105486061 | 3300032054 | Soil | MAPAVATYEPRDPSHTVLYHVIADHLETVLASFDADPDATGLPAYVQREFY |
Ga0318575_107124871 | 3300032055 | Soil | MAPAVATYEPRDPSHTVLYHVIADHLETVLASFDAAPDATGLPASVQREFYAYVQ |
Ga0318518_105462491 | 3300032090 | Soil | MAPAVATYEPRDPSHTVLYHVIADHLETVLASFDADPDAIGLP |
Ga0307472_1000991691 | 3300032205 | Hardwood Forest Soil | MAPAVATYTPRDPSGTVLYHVIAEHLETFLASLADDPEATGLPAYVHSLGFFIFCA |
Ga0306920_1024074802 | 3300032261 | Soil | MAPAVATYAPRDPSGTVLYHVIAEHLETFRASLND |
Ga0370548_130432_419_529 | 3300034644 | Soil | MAPAIATYEPRDPSRTVLYKVIADHLATFLASFEADP |
⦗Top⦘ |