Metagenome Family F026828

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F026828
Family Type	Metagenome
Number of Sequences	196
Average Sequence Length	37 residues
Representative Sequence	MITEELIANAIAFLAGWILKRPDFVQKIISKLFTKKDK
Number of Associated Samples	87
Number of Associated Scaffolds	196

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	6.63 %
% of genes near scaffold ends (potentially truncated)	11.73 %
% of genes from short scaffolds (< 2000 bps)	76.53 %
Associated GOLD sequencing projects	85
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (81.122 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (53.061 % of family members)
Environment Ontology (ENVO)	Unclassified (81.633 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (80.102 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 196 Family Scaffolds
PF03168	LEA_2	11.73
PF01841	Transglut_core	5.61
PF08291	Peptidase_M15_3	3.06
PF00145	DNA_methylase	2.55

COG ID	Name	Functional Category	% Frequency in 196 Family Scaffolds
COG0270	DNA-cytosine methylase	Replication, recombination and repair [L]	2.55

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
All Organisms	root	All Organisms	18.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
cellular organisms	root	All Organisms → cellular organisms	17.35 %
Viruses	superkingdom	All Organisms → Viruses	1.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	17.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	3.57 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.04 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.53 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	3.57 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	2.04 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.53 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Patescibacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group	3.57 %
Epsilonproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria	2.04 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.53 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Parcubacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group	3.57 %
Campylobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales	2.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.51 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Candidatus Falkowbacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria	3.57 %
Campylobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae	2.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.51 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Candidatus Falkowbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	3.57 %
Campylobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter	2.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %
Spirosomaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae	0.51 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Candidatus Falkowbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	3.57 %
Campylobacter coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli	2.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %
Dyadobacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter	0.51 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	81.12 %
Candidatus Falkowbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	3.57 %
Campylobacter coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli	2.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.53 %
Dyadobacter fermentans	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter → Dyadobacter fermentans	0.51 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000736\|JGI12547J11936_1001638	All Organisms → cellular organisms → Bacteria	6313	Open in IMG/M
3300000736\|JGI12547J11936_1002336	Not Available	5336	Open in IMG/M
3300002408\|B570J29032_109924628	Not Available	2804	Open in IMG/M
3300002408\|B570J29032_109938044	Not Available	3491	Open in IMG/M
3300004112\|Ga0065166_10143615	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Dyadobacter → Dyadobacter fermentans	906	Open in IMG/M
3300005527\|Ga0068876_10197549	Not Available	1168	Open in IMG/M
3300005580\|Ga0049083_10164680	Not Available	759	Open in IMG/M
3300005581\|Ga0049081_10018639	Not Available	2632	Open in IMG/M
3300005581\|Ga0049081_10308586	Not Available	544	Open in IMG/M
3300005581\|Ga0049081_10317650	Not Available	534	Open in IMG/M
3300005582\|Ga0049080_10052378	All Organisms → Viruses → Predicted Viral	1410	Open in IMG/M
3300005662\|Ga0078894_10053516	Not Available	3430	Open in IMG/M
3300005662\|Ga0078894_10237677	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1651	Open in IMG/M
3300005662\|Ga0078894_10358178	Not Available	1321	Open in IMG/M
3300005662\|Ga0078894_10375029	Not Available	1287	Open in IMG/M
3300005662\|Ga0078894_11733327	Not Available	511	Open in IMG/M
3300006802\|Ga0070749_10410724	Not Available	746	Open in IMG/M
3300007212\|Ga0103958_1171223	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	5048	Open in IMG/M
3300007542\|Ga0099846_1140588	Not Available	872	Open in IMG/M
3300007544\|Ga0102861_1015703	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1850	Open in IMG/M
3300007544\|Ga0102861_1107034	Not Available	748	Open in IMG/M
3300007640\|Ga0070751_1070535	Not Available	1486	Open in IMG/M
3300007972\|Ga0105745_1015908	Not Available	1825	Open in IMG/M
3300007974\|Ga0105747_1334798	Not Available	516	Open in IMG/M
3300008266\|Ga0114363_1046280	Not Available	1753	Open in IMG/M
3300008448\|Ga0114876_1063378	All Organisms → Viruses → Predicted Viral	1606	Open in IMG/M
3300009009\|Ga0105105_10078950	Not Available	1548	Open in IMG/M
3300009082\|Ga0105099_10032412	Not Available	2695	Open in IMG/M
3300009146\|Ga0105091_10599232	Not Available	569	Open in IMG/M
3300009155\|Ga0114968_10152589	Not Available	1369	Open in IMG/M
3300009164\|Ga0114975_10249021	Not Available	994	Open in IMG/M
3300010160\|Ga0114967_10005930	All Organisms → cellular organisms → Bacteria	9649	Open in IMG/M
3300012012\|Ga0153799_1007332	All Organisms → cellular organisms → Bacteria	2587	Open in IMG/M
3300012012\|Ga0153799_1074167	Not Available	613	Open in IMG/M
3300012013\|Ga0153805_1070138	Not Available	594	Open in IMG/M
3300012017\|Ga0153801_1025438	Not Available	1049	Open in IMG/M
3300012017\|Ga0153801_1037019	Not Available	862	Open in IMG/M
3300012282\|Ga0157136_1000176	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli	4817	Open in IMG/M
3300012282\|Ga0157136_1000732	Not Available	2520	Open in IMG/M
3300012282\|Ga0157136_1003180	Not Available	1172	Open in IMG/M
3300012282\|Ga0157136_1006305	Not Available	752	Open in IMG/M
3300012282\|Ga0157136_1008251	Not Available	641	Open in IMG/M
3300012282\|Ga0157136_1008312	Not Available	638	Open in IMG/M
3300012282\|Ga0157136_1008313	Not Available	637	Open in IMG/M
3300012282\|Ga0157136_1009383	Not Available	596	Open in IMG/M
3300012568\|Ga0157476_102704	Not Available	677	Open in IMG/M
3300013005\|Ga0164292_10521592	Not Available	776	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10208179	Not Available	1325	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10318028	Not Available	996	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10084677	Not Available	2769	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10462502	Not Available	850	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10619938	Not Available	695	Open in IMG/M
3300013372\|Ga0177922_10438056	Not Available	733	Open in IMG/M
3300013372\|Ga0177922_10931807	Not Available	983	Open in IMG/M
3300013372\|Ga0177922_11197293	Not Available	733	Open in IMG/M
3300013372\|Ga0177922_11333222	Not Available	542	Open in IMG/M
3300014258\|Ga0075315_1100039	Not Available	551	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10638878	Not Available	580	Open in IMG/M
3300015050\|Ga0181338_1002101	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	3507	Open in IMG/M
3300015050\|Ga0181338_1002995	Not Available	2950	Open in IMG/M
3300015050\|Ga0181338_1003183	All Organisms → cellular organisms → Bacteria	2865	Open in IMG/M
3300015050\|Ga0181338_1004924	Not Available	2267	Open in IMG/M
3300015050\|Ga0181338_1008812	Not Available	1676	Open in IMG/M
3300015050\|Ga0181338_1009043	Not Available	1654	Open in IMG/M
3300015050\|Ga0181338_1011741	Not Available	1427	Open in IMG/M
3300015050\|Ga0181338_1012943	Not Available	1350	Open in IMG/M
3300015050\|Ga0181338_1024733	Not Available	927	Open in IMG/M
3300015050\|Ga0181338_1025028	Not Available	921	Open in IMG/M
3300015050\|Ga0181338_1025101	Not Available	920	Open in IMG/M
3300015050\|Ga0181338_1025139	Not Available	919	Open in IMG/M
3300015050\|Ga0181338_1027532	Not Available	873	Open in IMG/M
3300015050\|Ga0181338_1028223	Not Available	860	Open in IMG/M
3300015050\|Ga0181338_1031850	Not Available	801	Open in IMG/M
3300015050\|Ga0181338_1033136	Not Available	782	Open in IMG/M
3300015050\|Ga0181338_1035389	Not Available	753	Open in IMG/M
3300015050\|Ga0181338_1036593	Not Available	738	Open in IMG/M
3300015050\|Ga0181338_1038085	Not Available	720	Open in IMG/M
3300015050\|Ga0181338_1042930	Not Available	669	Open in IMG/M
3300015050\|Ga0181338_1051382	Not Available	601	Open in IMG/M
3300015050\|Ga0181338_1051510	Not Available	600	Open in IMG/M
3300015050\|Ga0181338_1055493	Not Available	574	Open in IMG/M
3300015050\|Ga0181338_1061960	Not Available	537	Open in IMG/M
3300017700\|Ga0181339_1019558	Not Available	761	Open in IMG/M
3300017701\|Ga0181364_1001447	All Organisms → cellular organisms → Bacteria	4254	Open in IMG/M
3300017701\|Ga0181364_1017851	Not Available	1176	Open in IMG/M
3300017701\|Ga0181364_1056526	Not Available	610	Open in IMG/M
3300017701\|Ga0181364_1057145	Not Available	607	Open in IMG/M
3300017701\|Ga0181364_1076628	Not Available	510	Open in IMG/M
3300017707\|Ga0181363_1005052	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli	2876	Open in IMG/M
3300017707\|Ga0181363_1080436	Not Available	558	Open in IMG/M
3300017716\|Ga0181350_1013023	Not Available	2358	Open in IMG/M
3300017716\|Ga0181350_1070427	Not Available	899	Open in IMG/M
3300017716\|Ga0181350_1134855	Not Available	585	Open in IMG/M
3300017716\|Ga0181350_1136951	Not Available	578	Open in IMG/M
3300017722\|Ga0181347_1012921	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli	2697	Open in IMG/M
3300017736\|Ga0181365_1054411	Not Available	997	Open in IMG/M
3300017736\|Ga0181365_1122206	Not Available	624	Open in IMG/M
3300017736\|Ga0181365_1124484	Not Available	617	Open in IMG/M
3300017736\|Ga0181365_1163629	Not Available	523	Open in IMG/M
3300017747\|Ga0181352_1049352	Not Available	1227	Open in IMG/M
3300017761\|Ga0181356_1119298	Not Available	843	Open in IMG/M
3300017761\|Ga0181356_1228242	Not Available	539	Open in IMG/M
3300017774\|Ga0181358_1276887	Not Available	519	Open in IMG/M
3300017777\|Ga0181357_1156482	Not Available	837	Open in IMG/M
3300017777\|Ga0181357_1233845	Not Available	644	Open in IMG/M
3300017777\|Ga0181357_1239199	Not Available	634	Open in IMG/M
3300017777\|Ga0181357_1261051	Not Available	599	Open in IMG/M
3300017778\|Ga0181349_1076078	Not Available	1283	Open in IMG/M
3300017778\|Ga0181349_1125148	Not Available	944	Open in IMG/M
3300017778\|Ga0181349_1173788	Not Available	760	Open in IMG/M
3300017780\|Ga0181346_1138491	Not Available	920	Open in IMG/M
3300017780\|Ga0181346_1140913	Not Available	910	Open in IMG/M
3300017780\|Ga0181346_1329844	Not Available	510	Open in IMG/M
3300017784\|Ga0181348_1112126	Not Available	1055	Open in IMG/M
3300017784\|Ga0181348_1312932	Not Available	522	Open in IMG/M
3300017785\|Ga0181355_1281755	Not Available	629	Open in IMG/M
3300017963\|Ga0180437_10448641	Not Available	957	Open in IMG/M
3300017971\|Ga0180438_10837090	Not Available	671	Open in IMG/M
3300019781\|Ga0181360_105419	Not Available	1075	Open in IMG/M
3300019781\|Ga0181360_110048	Not Available	790	Open in IMG/M
3300019781\|Ga0181360_121933	Not Available	516	Open in IMG/M
3300019783\|Ga0181361_100011	All Organisms → cellular organisms → Bacteria	9902	Open in IMG/M
3300019783\|Ga0181361_100012	All Organisms → cellular organisms → Bacteria	9318	Open in IMG/M
3300019783\|Ga0181361_100212	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	2938	Open in IMG/M
3300019783\|Ga0181361_100683	Not Available	2129	Open in IMG/M
3300019783\|Ga0181361_100715	Not Available	2100	Open in IMG/M
3300019783\|Ga0181361_102011	Not Available	1480	Open in IMG/M
3300019783\|Ga0181361_103029	Not Available	1243	Open in IMG/M
3300019783\|Ga0181361_105729	Not Available	948	Open in IMG/M
3300019783\|Ga0181361_108387	Not Available	801	Open in IMG/M
3300019783\|Ga0181361_111402	Not Available	692	Open in IMG/M
3300019783\|Ga0181361_113515	Not Available	641	Open in IMG/M
3300019783\|Ga0181361_120246	Not Available	527	Open in IMG/M
3300019783\|Ga0181361_120317	Not Available	526	Open in IMG/M
3300019783\|Ga0181361_120734	Not Available	521	Open in IMG/M
3300019783\|Ga0181361_120854	Not Available	519	Open in IMG/M
3300019784\|Ga0181359_1003413	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	4862	Open in IMG/M
3300019784\|Ga0181359_1004910	All Organisms → cellular organisms → Bacteria	4295	Open in IMG/M
3300019784\|Ga0181359_1015049	Not Available	2854	Open in IMG/M
3300019784\|Ga0181359_1044799	Not Available	1711	Open in IMG/M
3300019784\|Ga0181359_1082545	Not Available	1202	Open in IMG/M
3300019784\|Ga0181359_1113848	Not Available	976	Open in IMG/M
3300019784\|Ga0181359_1139660	Not Available	844	Open in IMG/M
3300019784\|Ga0181359_1167705	Not Available	737	Open in IMG/M
3300019784\|Ga0181359_1224885	Not Available	587	Open in IMG/M
3300020506\|Ga0208091_1020935	Not Available	760	Open in IMG/M
3300022179\|Ga0181353_1043018	All Organisms → Viruses → Predicted Viral	1192	Open in IMG/M
3300022190\|Ga0181354_1061907	Not Available	1243	Open in IMG/M
3300022190\|Ga0181354_1079444	Not Available	1083	Open in IMG/M
3300022190\|Ga0181354_1175368	Not Available	655	Open in IMG/M
3300022190\|Ga0181354_1180311	Not Available	642	Open in IMG/M
3300022190\|Ga0181354_1212625	Not Available	570	Open in IMG/M
3300022407\|Ga0181351_1103383	Not Available	1097	Open in IMG/M
3300022407\|Ga0181351_1117074	Not Available	1005	Open in IMG/M
3300027468\|Ga0209247_1053354	Not Available	586	Open in IMG/M
3300027644\|Ga0209356_1038746	Not Available	1529	Open in IMG/M
3300027644\|Ga0209356_1177547	Not Available	583	Open in IMG/M
3300027720\|Ga0209617_10003858	All Organisms → cellular organisms → Bacteria	6994	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1009370	All Organisms → cellular organisms → Bacteria	9519	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1010590	All Organisms → cellular organisms → Bacteria	8589	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1079229	Not Available	1686	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1100763	All Organisms → cellular organisms → Bacteria	1390	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1322905	Not Available	538	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1082606	Not Available	1503	Open in IMG/M
3300027759\|Ga0209296_1004209	All Organisms → cellular organisms → Bacteria	9526	Open in IMG/M
3300027785\|Ga0209246_10232424	Not Available	716	Open in IMG/M
3300027897\|Ga0209254_10400263	Not Available	1018	Open in IMG/M
(restricted) 3300028553\|Ga0247839_1106125	All Organisms → cellular organisms → Bacteria	1323	Open in IMG/M
(restricted) 3300028581\|Ga0247840_10292088	Not Available	847	Open in IMG/M
(restricted) 3300028581\|Ga0247840_10465232	Not Available	598	Open in IMG/M
(restricted) 3300029268\|Ga0247842_10543185	Not Available	585	Open in IMG/M
(restricted) 3300029286\|Ga0247841_10570414	Not Available	706	Open in IMG/M
3300031746\|Ga0315293_10502617	Not Available	936	Open in IMG/M
3300031885\|Ga0315285_10376065	Not Available	1027	Open in IMG/M
3300031951\|Ga0315904_11220462	Not Available	576	Open in IMG/M
3300031952\|Ga0315294_10033494	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	5536	Open in IMG/M
3300031952\|Ga0315294_10801118	Not Available	812	Open in IMG/M
3300031999\|Ga0315274_10076238	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	4422	Open in IMG/M
3300031999\|Ga0315274_10140508	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium	3080	Open in IMG/M
3300031999\|Ga0315274_10193166	Not Available	2532	Open in IMG/M
3300032046\|Ga0315289_10049489	Not Available	5267	Open in IMG/M
3300032118\|Ga0315277_10024224	All Organisms → cellular organisms → Bacteria	7326	Open in IMG/M
3300032342\|Ga0315286_11267317	Not Available	718	Open in IMG/M
3300033978\|Ga0334977_0005746	All Organisms → cellular organisms → Bacteria	7067	Open in IMG/M
3300033995\|Ga0335003_0365208	Not Available	628	Open in IMG/M
3300034019\|Ga0334998_0005054	All Organisms → cellular organisms → Bacteria	10307	Open in IMG/M
3300034060\|Ga0334983_0044590	Not Available	2899	Open in IMG/M
3300034060\|Ga0334983_0046658	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli	2831	Open in IMG/M
3300034101\|Ga0335027_0007255	All Organisms → cellular organisms → Bacteria	9701	Open in IMG/M
3300034101\|Ga0335027_0007256	All Organisms → cellular organisms → Bacteria	9700	Open in IMG/M
3300034101\|Ga0335027_0007331	All Organisms → cellular organisms → Bacteria	9652	Open in IMG/M
3300034103\|Ga0335030_0118392	Not Available	1915	Open in IMG/M
3300034106\|Ga0335036_0257118	Not Available	1180	Open in IMG/M
3300034106\|Ga0335036_0865507	Not Available	516	Open in IMG/M
3300034112\|Ga0335066_0302166	Not Available	905	Open in IMG/M
3300034166\|Ga0335016_0541316	Not Available	647	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.49%
Terrestrial	Environmental → Terrestrial	0.51%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	94.90%
Marine	Environmental → Aquatic → Marine	3.57%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	1.02%
Soil	Environmental → Terrestrial → Soil	0.51%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	59.18%
Lake	Environmental → Aquatic → Freshwater → Lake	33.16%
Coastal	Environmental → Aquatic → Marine → Coastal	2.55%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.53%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.02%
Hypersaline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline	1.02%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.51%
Ice	Environmental → Aquatic → Freshwater → Ice	0.51%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	56.63%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	28.06%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	5.10%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	2.55%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.04%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.53%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.02%
Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment	1.02%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.51%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.51%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.51%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	53.06%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	15.82%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	8.67%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	5.10%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.55%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.04%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.53%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment	1.53%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.53%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.02%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.02%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	1.02%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.02%
Hypersaline Lake Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment	1.02%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.51%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.51%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	0.51%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.51%
Surface Ice	Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice	0.51%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.51%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000736	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300004112	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300007212	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects	Environmental	Open in IMG/M
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental	Open in IMG/M
3300007544	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3	Environmental	Open in IMG/M
3300007640	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28	Environmental	Open in IMG/M
3300007972	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012013	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012282	Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m	Environmental	Open in IMG/M
3300012568	Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Top - Depth 1m	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014258	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017700	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017963	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG	Environmental	Open in IMG/M
3300017971	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG	Environmental	Open in IMG/M
3300019781	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D	Environmental	Open in IMG/M
3300019783	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300027468	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes)	Environmental	Open in IMG/M
3300027644	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027720	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027728 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m	Environmental	Open in IMG/M
3300027730 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300028553 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m	Environmental	Open in IMG/M
3300028581 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m	Environmental	Open in IMG/M
3300029268 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m	Environmental	Open in IMG/M
3300029286 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032046	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033995	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056	Environmental	Open in IMG/M
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental	Open in IMG/M
3300034060	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034103	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034166	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12547J11936_10016382	3300000736	Freshwater And Sediment	MNEELIANAIAFLAGWILKRPDFVQKILSKLFAKKDK*
JGI12547J11936_10023368	3300000736	Freshwater And Sediment	MTEELITNAIAFLAGWILKRPDFVQKIISKIFTKK*
B570J29032_1099246283	3300002408	Freshwater	MNEELIASAIAFLAGWILKRPDFVQKIISKIFTKK*
B570J29032_1099380442	3300002408	Freshwater	MHEELIANAIAFLAGWILKRPDFVQKILSKLFAKKDK*
Ga0065166_101436151	3300004112	Freshwater Lake	IQLMTTEELVVNAIVFVAGWILKRPALVEKFVDKLFKKK*
Ga0068876_101975492	3300005527	Freshwater Lake	MITEELVVNAIVFVAGWILKRPAIVEKLVEKLFAKKAK*
Ga0049083_101646803	3300005580	Freshwater Lentic	MITEELITSAIAFLAGLVLKRPDFVQKIISKLFTKKAK*
Ga0049081_100186395	3300005581	Freshwater Lentic	MTTQELIVNAIVFVAGWILKRPAFVEQAVAKLFKKKEK*
Ga0049081_103085863	3300005581	Freshwater Lentic	MTEELITSAIAFLAGWVLKRPDFVQKIISKIFTKK*
Ga0049081_103176502	3300005581	Freshwater Lentic	MTEELIVNAIAFVAGWILKRPDFVQKIVSKLFAKKDK*
Ga0049080_100523783	3300005582	Freshwater Lentic	MNEELIVNAIAFVAGWILKRPDFVQKIVSKLFAKKDK*
Ga0078894_100535164	3300005662	Freshwater Lake	MITEELIVNAIVFLAGWILKRPAAVEAVVSKLFKKKGE*
Ga0078894_102376774	3300005662	Freshwater Lake	MITEELVVNAIVFVAGWILKRPALVEKFVDKLFKKK*
Ga0078894_103581783	3300005662	Freshwater Lake	MTKEEIIVNAIVFVAGWILKRPALVEKFVDKLFKKK*
Ga0078894_103750293	3300005662	Freshwater Lake	MTTEELVVNAIVFVAGWILKRPALVEKFVDKLFKKK*
Ga0078894_117333272	3300005662	Freshwater Lake	MTKEEIIVNAIVFVAGWILKRPALVEKFVDKLFKKKA*
Ga0070749_104107241	3300006802	Aqueous	MITEELVVNAIVFIAGWILKRPALVEKFVDKIFKKKN*
Ga0103958_11712234	3300007212	Freshwater Lake	MITEELVVNAIVFIAGWILKRPALVEKFVDKLFKKKD*
Ga0099846_11405881	3300007542	Aqueous	ITEELVVNAIVFIAGWILKRPALVEKFVDKLFKKKN*
Ga0102861_10157031	3300007544	Estuarine	QSLMTEELIGNAIAFLAGWILKRPDFVQKILSKLFAKKDK*
Ga0102861_11070342	3300007544	Estuarine	MTEELIGNAIAFLAGWILKRPDFVQKILSKLFTKKDK*
Ga0070751_10705354	3300007640	Aqueous	MITEELVVNAIVFIAGWILKRPALVEKFVDKLFKKK*
Ga0105745_10159083	3300007972	Estuary Water	MTEELIGNAIAFLAGWILKRPDFVQKILSKLFAKKDK*
Ga0105747_13347981	3300007974	Estuary Water	MNEELIGNAIAFLAGWILKRPDFVQKILSKLFAKKDK*
Ga0114363_10462802	3300008266	Freshwater, Plankton	MITEELIVNAIVFLAGWILKRPAAVEVIVSKLFKKKAE*
Ga0114876_10633783	3300008448	Freshwater Lake	MITEELVVNAIVFVAGWILKRPALVEKLVEKLFSKKAK*
Ga0105105_100789502	3300009009	Freshwater Sediment	MNTEEIIVNAIVFIAGWILKRPAAVEAIVSNLFKKKAE*
Ga0105099_100324126	3300009082	Freshwater Sediment	MNTEEIIVNAIVFIAGWILKRPAAVEAIVSKLFKKKAE*
Ga0105091_105992322	3300009146	Freshwater Sediment	MNTEEIIVNAIVFIAGWILKRPAAVETIVSKLFKKKAE*
Ga0114968_101525893	3300009155	Freshwater Lake	MITEELITSAIAFLAGWILKRPEFVQKIISKLFTKKVK*
Ga0114975_102490213	3300009164	Freshwater Lake	MITEELISSAIAFLAGWILKRPDFVQKIISKIFTKK*
Ga0114967_1000593023	3300010160	Freshwater Lake	MITEELITSAIAFLAGWILKRPEFVQKIISKLFTKK
Ga0153799_10073326	3300012012	Freshwater	MNEELIANAIAFLAGWVLKRPDFVQKIISKLFTKKVK*
Ga0153799_10741672	3300012012	Freshwater	MTEELIANAIAFLAGWILKRPDFVQKIVSKLFAKKDK*
Ga0153805_10701382	3300012013	Surface Ice	MITEELITSAIAFLAGWILKRPDFVQKIISKIFTKK*
Ga0153801_10254383	3300012017	Freshwater	MTEELIANAIAFLAGLVLKRPDFVQKIVSKLFAKKDK*
Ga0153801_10370192	3300012017	Freshwater	MTEELIANAIAFLAGWVLKRPDFVQKIISKIFTKK*
Ga0157136_10001765	3300012282	Freshwater	MTTQELIVNAIVFVAGWILKRPAFVEQAVAKLFKKKDK*
Ga0157136_10007327	3300012282	Freshwater	MITEELIVNAIAFLAGLVLKRPDFVQKIISKLFTKKVK*
Ga0157136_10031802	3300012282	Freshwater	MITEELIGNAIAFLAGWILKRPDFVQKILSKLFAKKDK*
Ga0157136_10063052	3300012282	Freshwater	MITEELIANAIAFLAGWILKRPDFVQKIISKIFTKK*
Ga0157136_10082512	3300012282	Freshwater	MSEELIANAIAFLAGWILKRPDFVQKIISKIFTKK*
Ga0157136_10083122	3300012282	Freshwater	MNEEIIANAIAFLAGWILKRPDFVQKIISKIFTKK*
Ga0157136_10083131	3300012282	Freshwater	MITEELIANAIAFLAGLVLKRPDFVQKILSKLFAKKD
Ga0157136_10093832	3300012282	Freshwater	MNEELIANAIAFLAGWILKRPDFVQKIISKIFTKK*
Ga0157476_1027041	3300012568	Freshwater	MITEELIGNAIAFLAGWILKRPDFVQKIVSKLFAKKDK*
Ga0164292_105215921	3300013005	Freshwater	MITEELIANAIAFLAGLILKRPDFVQKIVSKLFAKKDK*
(restricted) Ga0172373_102081795	3300013131	Freshwater	MTTEELVVNAIVFIAGWILKRPALVEKFVDKLFKKKD*
(restricted) Ga0172373_103180282	3300013131	Freshwater	MITEELIVNAIVFVAGWILKRPAAVEAIVSKLFKKKA*
(restricted) Ga0172372_100846777	3300013132	Freshwater	MITEELIVNAIVFVAGWILKRPAAVEAIVGKLFKKKA*
(restricted) Ga0172372_104625023	3300013132	Freshwater	MITEELVVNAIVFIAGWILKRPALVEKFVDKLFKKKN*
(restricted) Ga0172372_106199382	3300013132	Freshwater	MTTQEIIVNAIVFVCGWVLKRPSLVESVVAKLLTKKE
Ga0177922_104380563	3300013372	Freshwater	TEELIGNAIAFLAGWILKRPDFVQKIVSKLFAKKDK*
Ga0177922_109318073	3300013372	Freshwater	MITEELIANAIAFLAGLVLKRPDFVQKILSKLFAKKDK*
Ga0177922_111972932	3300013372	Freshwater	MSEELIANAIAFLAGWILKRPDFVQKILSKLFAKKDK*
Ga0177922_113332221	3300013372	Freshwater	MTEELIANAIAFLAGWVLKRPDFVQKIVSKLFAKKDK*
Ga0075315_11000393	3300014258	Natural And Restored Wetlands	GKMTTQEIIVNAIVFVAGWILKRPAAVEAIVGKLFKKKAE*
(restricted) Ga0172376_106388782	3300014720	Freshwater	MTTEELVVNAIVFLAGWILKRPALVEKFVDKLFKKKD*
Ga0181338_10021013	3300015050	Freshwater Lake	MITEELIVNAIAFLAGLVLKRPDFVQKIISKLFAKK*
Ga0181338_10029957	3300015050	Freshwater Lake	MTEELITNAIAFLAGLVLKRPDFVQKIVSKLFAKKGK*
Ga0181338_10031834	3300015050	Freshwater Lake	MITEELIVNAIAFLAGLVLKRPDFVQKIVSKLFAKKDK*
Ga0181338_10049244	3300015050	Freshwater Lake	MTEELITNAIVFLAGWILKRPEFVQKIISKLFTKKVK*
Ga0181338_10088122	3300015050	Freshwater Lake	MSEELIVNAIAFVAGWILKRPDFVQKIVSKLFAKKDK*
Ga0181338_10090432	3300015050	Freshwater Lake	MITEELITSAIAFLAGWILKRPDFVQKIITKLFTKKVK*
Ga0181338_10117413	3300015050	Freshwater Lake	MTEELITSAIAFLAGLVLKRPDFVQKIISKLFTKKAK*
Ga0181338_10129433	3300015050	Freshwater Lake	MTTQELIVNAIVFVAGWILKRPAFVENAVAKLFKKKDK*
Ga0181338_10247332	3300015050	Freshwater Lake	MTEELIFNAIAFLAGLVIKRPDFVQKIISKLFAKKDK*
Ga0181338_10250282	3300015050	Freshwater Lake	MTEELITNAIVFLAGWILKRPDFVQKIISKLFTKKVK*
Ga0181338_10251012	3300015050	Freshwater Lake	MITEELIFNAIAFLAGWVLKRPDFVQKIISKLFTKKVK*
Ga0181338_10251392	3300015050	Freshwater Lake	MITEELITSAIAFLAGWVLKRPDFVQKIITKLFTKKAK*
Ga0181338_10275322	3300015050	Freshwater Lake	MITEELIANAIAFLAGLVLKRPDFVQKIISKLFTKKVK*
Ga0181338_10282232	3300015050	Freshwater Lake	MITEEIITSAIAFLAGWILKRPDFVQKIISKLFTKKVK*
Ga0181338_10318503	3300015050	Freshwater Lake	MITEELITSAIAFLAGWVLKRPDFVQKIISKLFAKKDK*
Ga0181338_10331362	3300015050	Freshwater Lake	MITEELITSAIAFLAGWVLKRPDFVQKIISKIFTKK*
Ga0181338_10353892	3300015050	Freshwater Lake	MITEELIANAIAFLAGWVLKRPDFVQKIITKLFTKKVK*
Ga0181338_10365932	3300015050	Freshwater Lake	MTEELITSAIAFLAGWILKRPDFVQKIISKLFTKKDK*
Ga0181338_10380852	3300015050	Freshwater Lake	MNEELIANAIAFLAGWILKRPDFVQKIVSKLFAKKDK*
Ga0181338_10429302	3300015050	Freshwater Lake	MTEELITSAIAFLAGWVLKRPDFVQKIISKLFTKKDK*
Ga0181338_10513822	3300015050	Freshwater Lake	MITEELITSVIAFLAGWVLKRPDFVQKIISKLFTKKVK*
Ga0181338_10515102	3300015050	Freshwater Lake	MITEELIVNAIAFLAGLVLKRPDFVQKIVSKLFAKKTK*
Ga0181338_10554932	3300015050	Freshwater Lake	MTEELIFNAIAFLAGLVLKRPDFVQKIVSKLFAKKTK*
Ga0181338_10619602	3300015050	Freshwater Lake	MSEELIANAIAFLAGWVLKRPDFVQKIISKLFTKKDK*
Ga0181339_10195582	3300017700	Freshwater Lake	MTEELITSAIAFLAGWILKRPDFVQKIISKLFTKKDK
Ga0181364_10014476	3300017701	Freshwater Lake	MTTQELIVNAIVFVAGWILKRPAFVEHAVAKLFKKKDK
Ga0181364_10178512	3300017701	Freshwater Lake	MITEELITSVIAFLAGWVLKRPDFVQKIISKIFTKK
Ga0181364_10565262	3300017701	Freshwater Lake	MITEELIANAIAFLAGWVLKRPDFVQKIISKLFTKKVK
Ga0181364_10571452	3300017701	Freshwater Lake	MNEELIGNAIAFLAGWILKRPDFVQKILSKLFTKKDK
Ga0181364_10766282	3300017701	Freshwater Lake	MTEELIFNAIAFLAGLVLKRPDFVQKIVSKLFAKK
Ga0181363_10050529	3300017707	Freshwater Lake	MITEELITSAIAFLAGWVLKRPDFVQKIISKLFTKKV
Ga0181363_10804362	3300017707	Freshwater Lake	MITEELVVNAIVFIAGWILKRPALVEKFVDKLFKKK
Ga0181350_10130235	3300017716	Freshwater Lake	MTEELITSVISFLAGWVLKRPDFVQKIISKLFTKKVK
Ga0181350_10704272	3300017716	Freshwater Lake	MITEELIANAIAFLAGWVLKRPDFVQKIITKLFTKKVK
Ga0181350_11348552	3300017716	Freshwater Lake	MITEELIANAIAFLAGLVLKRPDFVQKIISKLFTKKVK
Ga0181350_11369511	3300017716	Freshwater Lake	MNEELITSAIAFLAGWILKRPDFVQKIISKLFTKKVK
Ga0181347_10129217	3300017722	Freshwater Lake	MTTQELIVNAIVFVAGWILKRPAFVENAVAKLFKKKDK
Ga0181365_10544112	3300017736	Freshwater Lake	MSEELIANAIAFLAGWILKRPDFVQKIISKIFTKK
Ga0181365_11222062	3300017736	Freshwater Lake	MTEELITNAIAFLAGWILKRPDFVQKIISKLFTKKDK
Ga0181365_11244841	3300017736	Freshwater Lake	MITEELIVNAIAFLAGWVLKRPDFVQKIVSKLFAKKTK
Ga0181365_11636292	3300017736	Freshwater Lake	MITEELIVNAIAFLAGWVLKRPEIVQKIISKLFAKK
Ga0181352_10493523	3300017747	Freshwater Lake	MITEELIFNAIAFLAGLVLKRPDFVQKIVSKLFAKKDK
Ga0181356_11192983	3300017761	Freshwater Lake	MTEELIANAIAFLAGLVLKRPDFVQKIISKLYAKKDK
Ga0181356_12282421	3300017761	Freshwater Lake	MTEELITNAIVFLAGWILKRPDFVQKIITKLFTKKVK
Ga0181358_12768872	3300017774	Freshwater Lake	MITEELITNAIVFLAGWILKRPDFVQKILTKLFAKKDK
Ga0181357_11564822	3300017777	Freshwater Lake	MITEELIASAIAFLAGWVLKRPDFVQKIITKLFTKKVK
Ga0181357_12338452	3300017777	Freshwater Lake	MSEELIANAIAFLAGWVLKRPDFVQKIISKLFTKKDK
Ga0181357_12391992	3300017777	Freshwater Lake	MIEELIFNAIAFLAGLVLKRPDFVQKIVSKLFAKKTK
Ga0181357_12610513	3300017777	Freshwater Lake	MTEELIANAIAFLAGLVLKRPDFVQKIISKLFAKK
Ga0181349_10760781	3300017778	Freshwater Lake	MLTEELIFNAIAFLAGLVLKRPDFVQKIISKIFTKK
Ga0181349_11251482	3300017778	Freshwater Lake	MTEELISSAIAFLAGWILKRPDFVQKIISKIFTKK
Ga0181349_11737882	3300017778	Freshwater Lake	MSEELIFNAIAFLAGLVLKRPDFVQKIISKLFTKKVK
Ga0181346_11384914	3300017780	Freshwater Lake	MMNEELISSAIAFLAGWVLKRPDFVQKILSKLFAKKDK
Ga0181346_11409134	3300017780	Freshwater Lake	LMTEELIGNAIAFLAGWILKRPDFVQKIISKIFTKK
Ga0181346_13298442	3300017780	Freshwater Lake	MNEELITSVIAFLAGWVLKRPDFVQKIISKLFTKKV
Ga0181348_11121263	3300017784	Freshwater Lake	MSEELIANAIAFLAGWVLKRPDLVQKIISKLFTKKDK
Ga0181348_13129322	3300017784	Freshwater Lake	MSEELIANAIAFLAGWILKRPDFVQKIISKLFAKKVK
Ga0181355_12817551	3300017785	Freshwater Lake	MSEELIANAIAFLAGWILKRPDFVQKIISKLFTKKAK
Ga0180437_104486413	3300017963	Hypersaline Lake Sediment	MITEEIIVNAIVFVAGWILKRPAAVEAIVSKLFKKKAE
Ga0180438_108370901	3300017971	Hypersaline Lake Sediment	EIGNMITEEIIVNAIVFVAGWILKRPAAVEAIVSKLFKKKAE
Ga0181360_1054192	3300019781	Freshwater Lake	MITEELIVNAIAFLAGLVLKRPDFVQKIVSKLFAKKDK
Ga0181360_1100482	3300019781	Freshwater Lake	MTEELITNAIVFLAGWILKRPEFVQKIISKLFTKKVK
Ga0181360_1219332	3300019781	Freshwater Lake	MTEELITNAIAFLAGLVLKRPDFVQKIVSKLFAKKGK
Ga0181361_10001112	3300019783	Freshwater Lake	MITEELIFNAIAFLAGLVLKRPDFVQKIVSKLFAKKTK
Ga0181361_10001217	3300019783	Freshwater Lake	MITEELITSAIAFLAGWILKRPDFVQKIISKIFTKK
Ga0181361_1002122	3300019783	Freshwater Lake	MTTQELIVNAIVFVAGWILKRPAFVEQAVAKLFKKKDK
Ga0181361_1006832	3300019783	Freshwater Lake	MITEELITSAIAFLAGWILKRPDFVQKIITKLFTKKVK
Ga0181361_1007152	3300019783	Freshwater Lake	MITEELIVNAIAFLAGLVLKRPDFVQKIISKLFAKK
Ga0181361_1020116	3300019783	Freshwater Lake	MITEELITSAIAFLAGWVLKRPDFVQKIISKLFTKKDK
Ga0181361_1030295	3300019783	Freshwater Lake	MITEELITSAIAFLAGLVLKRPDFVQKIISKLFTKKVK
Ga0181361_1057292	3300019783	Freshwater Lake	MITEELITSAIAFLAGWVLKRPDFVQKIITKLFTKKAK
Ga0181361_1083873	3300019783	Freshwater Lake	MTEELIFNAIAFLAGLVLKRPDFVQKIISKLFTKKVK
Ga0181361_1114023	3300019783	Freshwater Lake	MITEELITSVIAFLAGWVLKRPDFVQKIISKLFTKKVK
Ga0181361_1135152	3300019783	Freshwater Lake	MITEEIITSAIAFLAGLVLKRPDFVQKIISKLFTKKAK
Ga0181361_1202461	3300019783	Freshwater Lake	MITEELITSAIAFLAGLVLKRPDFVQKIISKLFTKKAK
Ga0181361_1203172	3300019783	Freshwater Lake	MITEELITSAIAFLAGWVLKRPDFVQKIISKIFTKK
Ga0181361_1207342	3300019783	Freshwater Lake	MITEELIFNAIAFLAGLVLKRPDFVQKIISKLFTKKVK
Ga0181361_1208542	3300019783	Freshwater Lake	MTEELIFNAIAFLAGLVLKRPDFVQKIVSKLFAKKTK
Ga0181359_100341310	3300019784	Freshwater Lake	MTEELIFNAIAFLAGLVIKRPDFVQKIISKLFAKKDK
Ga0181359_10049102	3300019784	Freshwater Lake	MTTEELIVNAIVFVAGWILKRPALVEKFVDKLFKKK
Ga0181359_10150493	3300019784	Freshwater Lake	MTEELITSAIAFLAGWVLKRPDFVQKIISKIFTKK
Ga0181359_10447995	3300019784	Freshwater Lake	MLTEELIFNAIAFLAGLVLKRPDFVQKIISKIFTK
Ga0181359_10825453	3300019784	Freshwater Lake	MITEELITNAIAFLAGWILKRPDFVQKIISKIFTKK
Ga0181359_11138482	3300019784	Freshwater Lake	MTEELITSAIAFLAGLVLKRPDFVQKIISKLFTKKAK
Ga0181359_11396603	3300019784	Freshwater Lake	MNEELIGNAIAFLAGWILKRPDFVQKILSKLFAKKDK
Ga0181359_11677052	3300019784	Freshwater Lake	MTEELIANAIAFLAGLVLKRPDFVQKIISKLFAKKDK
Ga0181359_12248852	3300019784	Freshwater Lake	MITEELIVNAIAFLAGLVLKRPDFVQKIVSKLFAKKTK
Ga0208091_10209353	3300020506	Freshwater	MHEELIANAIAFLAGWILKRPDFVQKILSKLFAKKDK
Ga0181353_10430182	3300022179	Freshwater Lake	MITEELIVNAIVFLAGWILKRPAAVEVIVSKLFKKKAE
Ga0181354_10619072	3300022190	Freshwater Lake	MITEELIFNAIAFLAGWVLKRPDFVQKIISKLFTKKVK
Ga0181354_10794444	3300022190	Freshwater Lake	MNEELIANAIAFLAGWILKRPDFVQKIVSKLFAKKDK
Ga0181354_11753682	3300022190	Freshwater Lake	MNEELITSVIAFLAGWVLKRPDFVQKIISKLFTKKVK
Ga0181354_11803111	3300022190	Freshwater Lake	MTEELITNAIVFLAGWILKRPDFVQKIISKLFTKKVK
Ga0181354_12126252	3300022190	Freshwater Lake	MITEELISSAIAFLAGWVLKRPDFVQKIISKIFTKK
Ga0181351_11033832	3300022407	Freshwater Lake	MTEELITSVISFLAGWVLKRPDFVQKIITKLFTKKVK
Ga0181351_11170742	3300022407	Freshwater Lake	MITEEIITSAIAFLAGWILKRPDFVQKIISKLFTKKVK
Ga0209247_10533542	3300027468	Freshwater Lake	MITEELIFNAIAFLAGLVLKRPDFVQKIVSKLFAKK
Ga0209356_10387466	3300027644	Freshwater Lake	SMTEELIFNAIAFLAGLVLKRPDFVQKIISKIFTKK
Ga0209356_11775473	3300027644	Freshwater Lake	TIMITEELIVNAIAFLAGLVLKRPDFVQKIVSKLFAKKDK
Ga0209617_100038584	3300027720	Freshwater And Sediment	MTEELITNAIAFLAGWILKRPDFVQKIISKIFTKK
(restricted) Ga0247836_10093707	3300027728	Freshwater	MTTQELIVNAIVFVAGWILKRPAVVEAAVAKLFKKKEK
(restricted) Ga0247836_101059014	3300027728	Freshwater	MNEELIANAIAFLAGWILKRPDFVQKIISKLFAKK
(restricted) Ga0247836_10792292	3300027728	Freshwater	MITEELIANAIAFLAGLVLKRPDFVQKIVSKLFAKK
(restricted) Ga0247836_11007632	3300027728	Freshwater	MTEELIANAIAFLAGLVLKRPDFVQKIVSKLFAKKTK
(restricted) Ga0247836_13229052	3300027728	Freshwater	MITEELIANAIAFLAGLVLKRPDFVQKILSKLFAKKQK
(restricted) Ga0247833_10826062	3300027730	Freshwater	MITEELIANAIAFLAGLVLKRPDFVQKIISKLFAKK
Ga0209296_100420918	3300027759	Freshwater Lake	MITEELISSAIAFLAGWILKRPDFVQKIISKIFTKK
Ga0209246_102324242	3300027785	Freshwater Lake	MTEELIFNAIAFLAGLVLKRPDFVQKIISKLFTKK
Ga0209254_104002634	3300027897	Freshwater Lake Sediment	MITEELIVNAIAFLAGWILKRPDFVQKIISKLFAKK
(restricted) Ga0247839_11061254	3300028553	Freshwater	MTEELIANAIAFLAGLVLKRPDFVQKLLSKLFAKK
(restricted) Ga0247840_102920882	3300028581	Freshwater	MITEELIANAIAFLAGLVLKRPDFVQKIISKLFAKKEK
(restricted) Ga0247840_104652322	3300028581	Freshwater	MNEELIANAIAFLAGLVLKRPDFVQKLLSKLFAKK
(restricted) Ga0247842_105431852	3300029268	Freshwater	MITEELIANAIAFLAGLVLKRPDFVQKIISKIFTKK
(restricted) Ga0247841_105704143	3300029286	Freshwater	MNTEELIANAIAFLAGLVLKRPDFVQKIISKLFAKK
Ga0315293_105026172	3300031746	Sediment	MITEELIANAIAFLAGWILKRPDFVQKILSKLFAKKDK
Ga0315285_103760651	3300031885	Sediment	MITEELIANAIAFLAGWILKRPDFVQKILSKLFTKKDK
Ga0315904_112204621	3300031951	Freshwater	MITEELIVNAIVFVAGWILKRPTAVEAIVEKLFKKKAK
Ga0315294_100334949	3300031952	Sediment	MTEELIGNAIAFLAGWILKRPDFVQKILSKLFTKKYK
Ga0315294_108011183	3300031952	Sediment	MITEELIANAIAFLAGWILKRPDFVQKILTKLFTKKVK
Ga0315274_100762381	3300031999	Sediment	RQSLMTEELIGNAIAFLAGWILKRPDFVQKILSKLFTKKDK
Ga0315274_101405083	3300031999	Sediment	MTEELITSAIAFIAGWILKRPDFVQKIISKIFTKKVK
Ga0315274_101931666	3300031999	Sediment	MNEELIANAIAFLAGWVLKRPDFVQKIVSKLFAKKTK
Ga0315289_1004948910	3300032046	Sediment	MITEELIANAIAFLAGWILKRPDFVQKIISKLFTKKDK
Ga0315277_1002422417	3300032118	Sediment	MITEELIANAIAFLAGWILKRPDFVQKILSKLFTKKHK
Ga0315286_112673173	3300032342	Sediment	MITEELITSAIAFLAGWILKRPDFVQKIISKLFTKKDK
Ga0334977_0005746_2466_2582	3300033978	Freshwater	MITEELIGNAIAFLAGWILKRPDFVQKILSKLFAKKDK
Ga0335003_0365208_416_529	3300033995	Freshwater	MNEELIGNAIAFLAGWILKRPDFVQKILTKLFAKKVK
Ga0334998_0005054_6916_7029	3300034019	Freshwater	MSEELIANAIAFLAGWILKRPDFVQKILSKLFAKKDK
Ga0334983_0044590_1448_1555	3300034060	Freshwater	MNEELIGNAIAFLAGWILKRPDFVQKIISKIFTKK
Ga0334983_0046658_564_671	3300034060	Freshwater	MSEELIANAIAFIAGWILKRPDFVQKILSKIFTKK
Ga0335027_0007255_6734_6841	3300034101	Freshwater	MSEELIANAIAFLAGWILKRPDFVQKILSKIFTKK
Ga0335027_0007256_6745_6858	3300034101	Freshwater	MTEELIANAIAFLAGWVLKRPDFVQKILSKLFAKKDK
Ga0335027_0007331_4768_4875	3300034101	Freshwater	MNEELITSAIAFLAGWILKRPDFVQKIISKIFTKK
Ga0335030_0118392_854_967	3300034103	Freshwater	MTEELIANAVAFLAGWILKRPDFVQKILSKLFAKKDK
Ga0335036_0257118_222_335	3300034106	Freshwater	MTQELITSAIAFLAGWILKRPDFVQKILTKLFAKKVK
Ga0335036_0865507_1_117	3300034106	Freshwater	MTTQEIIVNAIVFVCGWVLKRPALVESVVAKLFTKKAEA
Ga0335066_0302166_565_678	3300034112	Freshwater	MNEELIANAIAFLAGWILKRPDFVQKILSKLFAKKEK
Ga0335016_0541316_1_114	3300034166	Freshwater	ITEELITSAIAFLAGWILKRPDFAQKILSKLFAKKDK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters