Basic Information | |
---|---|
Family ID | F026670 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 197 |
Average Sequence Length | 40 residues |
Representative Sequence | PSLIVLLVILALAALVTLLGSAIPLRRASRIEPAPILRGE |
Number of Associated Samples | 169 |
Number of Associated Scaffolds | 197 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.51 % |
% of genes near scaffold ends (potentially truncated) | 98.48 % |
% of genes from short scaffolds (< 2000 bps) | 91.37 % |
Associated GOLD sequencing projects | 158 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.416 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.335 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.949 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.315 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 197 Family Scaffolds |
---|---|---|
PF12704 | MacB_PCD | 14.21 |
PF02687 | FtsX | 12.18 |
PF00005 | ABC_tran | 4.57 |
PF06155 | GBBH-like_N | 1.52 |
PF13520 | AA_permease_2 | 0.51 |
PF02742 | Fe_dep_repr_C | 0.51 |
PF00977 | His_biosynth | 0.51 |
PF01619 | Pro_dh | 0.51 |
COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
---|---|---|---|
COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 1.52 |
COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.51 |
COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.42 % |
Unclassified | root | N/A | 5.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101415590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
3300000559|F14TC_101922556 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300001490|JGI12186J15620_100352 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300001661|JGI12053J15887_10118809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
3300002886|JGI25612J43240_1020998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
3300002910|JGI25615J43890_1055507 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300003352|JGI26345J50200_1013180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300003367|JGI26338J50219_1008477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
3300003368|JGI26340J50214_10042056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1300 | Open in IMG/M |
3300004082|Ga0062384_100027382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2522 | Open in IMG/M |
3300004092|Ga0062389_101584532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
3300004114|Ga0062593_100999718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
3300005446|Ga0066686_10363126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
3300005569|Ga0066705_10052603 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
3300005610|Ga0070763_10557079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300005764|Ga0066903_105512938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae | 667 | Open in IMG/M |
3300005842|Ga0068858_100036671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4546 | Open in IMG/M |
3300005842|Ga0068858_101284091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300006052|Ga0075029_100178648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
3300006173|Ga0070716_101433775 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300006914|Ga0075436_101209876 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300007076|Ga0075435_101131865 | Not Available | 684 | Open in IMG/M |
3300007255|Ga0099791_10090487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1401 | Open in IMG/M |
3300007265|Ga0099794_10237546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
3300009012|Ga0066710_104208664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 538 | Open in IMG/M |
3300009089|Ga0099828_10190737 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
3300009089|Ga0099828_11129581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300009101|Ga0105247_10247901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
3300009143|Ga0099792_10280408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
3300009174|Ga0105241_12386441 | Not Available | 528 | Open in IMG/M |
3300009519|Ga0116108_1002334 | All Organisms → cellular organisms → Bacteria | 9214 | Open in IMG/M |
3300009522|Ga0116218_1400662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300009545|Ga0105237_12231845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300009615|Ga0116103_1009423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3353 | Open in IMG/M |
3300009698|Ga0116216_10239044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
3300009792|Ga0126374_10053166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2068 | Open in IMG/M |
3300010043|Ga0126380_11082055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300010046|Ga0126384_11089531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300010046|Ga0126384_11808039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300010159|Ga0099796_10144342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300010337|Ga0134062_10437017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300010339|Ga0074046_10427668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
3300010339|Ga0074046_10906121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300010343|Ga0074044_10042803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3138 | Open in IMG/M |
3300010358|Ga0126370_12062056 | Not Available | 559 | Open in IMG/M |
3300010360|Ga0126372_10804440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300010361|Ga0126378_10932124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
3300010376|Ga0126381_101625936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
3300010379|Ga0136449_100605094 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
3300010379|Ga0136449_104179255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300011269|Ga0137392_10170900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1765 | Open in IMG/M |
3300011269|Ga0137392_10610963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300011271|Ga0137393_11649373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300012096|Ga0137389_10687040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300012189|Ga0137388_11576015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300012202|Ga0137363_10352685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
3300012203|Ga0137399_11682708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300012206|Ga0137380_10359013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
3300012206|Ga0137380_10633447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
3300012206|Ga0137380_11080186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
3300012361|Ga0137360_11655441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300012362|Ga0137361_10728355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300012582|Ga0137358_10629203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300012917|Ga0137395_10466851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
3300012924|Ga0137413_11061177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300012924|Ga0137413_11550748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300012925|Ga0137419_10398445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
3300012925|Ga0137419_10467166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
3300012927|Ga0137416_10132759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1924 | Open in IMG/M |
3300012927|Ga0137416_10636712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300012964|Ga0153916_10694856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
3300012971|Ga0126369_10729452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300012972|Ga0134077_10384162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300013306|Ga0163162_10216432 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
3300014157|Ga0134078_10417947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300014166|Ga0134079_10517464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300015051|Ga0137414_1047487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
3300015051|Ga0137414_1048594 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
3300015051|Ga0137414_1054186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
3300015264|Ga0137403_10092250 | All Organisms → cellular organisms → Bacteria | 3044 | Open in IMG/M |
3300016270|Ga0182036_11042853 | Not Available | 675 | Open in IMG/M |
3300016294|Ga0182041_10092657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2194 | Open in IMG/M |
3300016371|Ga0182034_11680342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300016404|Ga0182037_10950469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300016422|Ga0182039_12013880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300017823|Ga0187818_10164091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
3300017933|Ga0187801_10030764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1883 | Open in IMG/M |
3300017934|Ga0187803_10255416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
3300017961|Ga0187778_10828308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300017972|Ga0187781_10454718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
3300017974|Ga0187777_11063045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300017975|Ga0187782_10323290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
3300017975|Ga0187782_11458136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300018012|Ga0187810_10292374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300018088|Ga0187771_11097553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300018433|Ga0066667_11474862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300019361|Ga0173482_10651144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300019999|Ga0193718_1024087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
3300020002|Ga0193730_1186193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300020579|Ga0210407_10383076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
3300020580|Ga0210403_10831267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300020581|Ga0210399_10214915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
3300020581|Ga0210399_10780965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300020581|Ga0210399_11513316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300020583|Ga0210401_10359336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1318 | Open in IMG/M |
3300020583|Ga0210401_10928268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300021086|Ga0179596_10031587 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
3300021088|Ga0210404_10367037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300021168|Ga0210406_11205773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300021170|Ga0210400_10307267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
3300021405|Ga0210387_11500869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300021407|Ga0210383_10485231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
3300021420|Ga0210394_10880066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
3300021420|Ga0210394_11575883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300021433|Ga0210391_10503291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
3300021433|Ga0210391_10518971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 935 | Open in IMG/M |
3300021433|Ga0210391_11111071 | Not Available | 614 | Open in IMG/M |
3300021474|Ga0210390_11038200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
3300021475|Ga0210392_11322594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300021475|Ga0210392_11481076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300021478|Ga0210402_11842802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300021479|Ga0210410_10820532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300021479|Ga0210410_11782678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300021559|Ga0210409_11610037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300021560|Ga0126371_11689501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300022508|Ga0222728_1022018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
3300024283|Ga0247670_1114234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300024288|Ga0179589_10337485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300024325|Ga0247678_1013558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
3300024331|Ga0247668_1020128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1379 | Open in IMG/M |
3300025477|Ga0208192_1025970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
3300025480|Ga0208688_1009102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2957 | Open in IMG/M |
3300025914|Ga0207671_11154229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300025922|Ga0207646_11344420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300025923|Ga0207681_11012464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300026297|Ga0209237_1051013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2080 | Open in IMG/M |
3300026298|Ga0209236_1134287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
3300026300|Ga0209027_1149116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300026319|Ga0209647_1108674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
3300026333|Ga0209158_1149984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300026355|Ga0257149_1027154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
3300026359|Ga0257163_1023921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 953 | Open in IMG/M |
3300026360|Ga0257173_1033431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300026529|Ga0209806_1262310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300026530|Ga0209807_1271981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300026557|Ga0179587_10219770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
3300026557|Ga0179587_10233062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
3300026557|Ga0179587_10418327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300026845|Ga0207760_116142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300027069|Ga0208859_1046203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300027105|Ga0207944_1002922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
3300027629|Ga0209422_1140787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300027643|Ga0209076_1094213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
3300027643|Ga0209076_1144582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300027651|Ga0209217_1164249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300027660|Ga0209736_1043997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1287 | Open in IMG/M |
3300027667|Ga0209009_1068081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 895 | Open in IMG/M |
3300027667|Ga0209009_1166408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300027669|Ga0208981_1184124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300027671|Ga0209588_1195951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300027698|Ga0209446_1171602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300027768|Ga0209772_10149806 | Not Available | 732 | Open in IMG/M |
3300027812|Ga0209656_10162992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
3300027846|Ga0209180_10682104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300027862|Ga0209701_10406143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300027884|Ga0209275_10506047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300027903|Ga0209488_10309273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
3300027910|Ga0209583_10446027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300030580|Ga0311355_10008119 | All Organisms → cellular organisms → Bacteria | 13760 | Open in IMG/M |
3300031057|Ga0170834_110421263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300031057|Ga0170834_112879767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
3300031679|Ga0318561_10795779 | Not Available | 519 | Open in IMG/M |
3300031681|Ga0318572_10194117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
3300031718|Ga0307474_10150987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1753 | Open in IMG/M |
3300031719|Ga0306917_11422123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300031720|Ga0307469_10732372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
3300031736|Ga0318501_10072006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1671 | Open in IMG/M |
3300031747|Ga0318502_10819128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300031754|Ga0307475_10027664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4072 | Open in IMG/M |
3300031754|Ga0307475_10210161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1556 | Open in IMG/M |
3300031764|Ga0318535_10281576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300031771|Ga0318546_10757249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300031798|Ga0318523_10624592 | Not Available | 530 | Open in IMG/M |
3300031820|Ga0307473_11184237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300031833|Ga0310917_11160712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300031910|Ga0306923_11531458 | Not Available | 696 | Open in IMG/M |
3300031912|Ga0306921_12128942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300031942|Ga0310916_10527390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
3300031946|Ga0310910_11576475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300032001|Ga0306922_11009207 | Not Available | 858 | Open in IMG/M |
3300032008|Ga0318562_10486227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300032051|Ga0318532_10027086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1891 | Open in IMG/M |
3300032174|Ga0307470_10989689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
3300032783|Ga0335079_11763480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300033158|Ga0335077_10965009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300034125|Ga0370484_0062716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 936 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.34% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.57% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.57% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.06% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.05% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.05% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.05% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.03% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.02% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.02% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.02% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.02% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.02% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.02% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.02% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Forest Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300001490 | Fosmid Clones Derived from Amazon Forest Soil Microbial Communities | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
3300003367 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1014155902 | 3300000364 | Soil | GVPPEPSLLVLCVVLVLAAGVTLLGSALPLRRAARFDPAPXLRGE* |
F14TC_1019225561 | 3300000559 | Soil | APSLLVLGVILVLAAGVTLLGSALPLRRAANYDPAPILRGE* |
JGI12186J15620_1003522 | 3300001490 | Forest Soil | ALLIILALAALITLLGSAFPLRQAAQYDPAPILRGE* |
JGI12053J15887_101188091 | 3300001661 | Forest Soil | GAAPEPSLIVFFVIIALAAGVTILGSALPLHRASRYEPAPILRGE* |
JGI25612J43240_10209982 | 3300002886 | Grasslands Soil | PEPSLIVFLVIIALATGVTLLGSAIPLRRASRYKPAPILRGE* |
JGI25615J43890_10555072 | 3300002910 | Grasslands Soil | EPKLFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE* |
JGI26345J50200_10131802 | 3300003352 | Bog Forest Soil | SLLVLVAILALAAGVTLLGSAIPLRRASRYEPAPILRGE* |
JGI26338J50219_10084772 | 3300003367 | Bog Forest Soil | APSLLVLVAILALAAGVTLLGSAIPLRRASRYEPAPILRGE* |
JGI26340J50214_100420561 | 3300003368 | Bog Forest Soil | FAPEPKLFVLLIILALAASITLLGSAFPLRKASRYEPAPILRGE* |
Ga0062384_1000273823 | 3300004082 | Bog Forest Soil | PKLFVLLIILGLAAAVTLLGSAFPLRQASRYDPAPILRGE* |
Ga0062389_1015845321 | 3300004092 | Bog Forest Soil | KLFVLLLILCLAALITLLGSAIPLRRASRYEPAPILRGE* |
Ga0062593_1009997182 | 3300004114 | Soil | APSLLVLVAVLALAAGVTLLGSAIPLRRASRYEPAPILRGE* |
Ga0066686_103631262 | 3300005446 | Soil | PEPTLLVFLVVIGLAAIVTLLGSAIPLRRASRIEPAPILRGE* |
Ga0066705_100526031 | 3300005569 | Soil | AAPEPSLMVFFVIIALAGGVTILGSALPLRRASRYEPAPILRGE* |
Ga0070763_105570791 | 3300005610 | Soil | VLVTVLALAAGVTLLGSAIPLRRASRYEPAPILRGE* |
Ga0066903_1055129382 | 3300005764 | Tropical Forest Soil | LGVVLVLAAGVTLLGSALPLRRAANYDPAPILRGE* |
Ga0068858_1000366716 | 3300005842 | Switchgrass Rhizosphere | LGIVLVLAAGVTLLGSALPLRRAANYEPAPILRGE* |
Ga0068858_1012840912 | 3300005842 | Switchgrass Rhizosphere | PKLFVLLIILVLAALITLLGSALPLRRASRYDPAPILRGE* |
Ga0075029_1001786482 | 3300006052 | Watersheds | KLFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE* |
Ga0070716_1014337752 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PSLLVLVVIVGLAGGVTLLGSAIPLRRAARYEPAPILRGE* |
Ga0075436_1012098762 | 3300006914 | Populus Rhizosphere | GVPPAPSFLVLGIVLALAAGVTLLGSALPLRRAANYEPAPILRGE* |
Ga0075435_1011318651 | 3300007076 | Populus Rhizosphere | LGVVLVLAAAVTLAGSALPLRRAANYDPAPILRGE* |
Ga0099791_100904871 | 3300007255 | Vadose Zone Soil | AAPEPSLIVFFVIIALAAGVTILGSALPLRRASRYGPAPILRGE* |
Ga0099794_102375462 | 3300007265 | Vadose Zone Soil | EFSFLVLAVIVGLAAVVTLLGSAIPLRRASRYEPAPILRGE* |
Ga0066710_1042086642 | 3300009012 | Grasslands Soil | GAAPGASVLVFVVVLGLAAVVTLGGCAVSLLRAARFQPAPILRGE |
Ga0099828_101907373 | 3300009089 | Vadose Zone Soil | VPEPSLIVFLVGIALAAGVTLLGSALPLRRASRYQPAPILRGE* |
Ga0099828_111295812 | 3300009089 | Vadose Zone Soil | SFLVLAVIIALAAAVTLLGSAIPLRRAARYEPAAILRGE* |
Ga0105247_102479012 | 3300009101 | Switchgrass Rhizosphere | LVILALAAIVTLLGSAVPLRRAARYEPAPILRGE* |
Ga0099792_102804082 | 3300009143 | Vadose Zone Soil | IVFFAIIALASGVTILGSALPLRRASRIEPAPILRGE* |
Ga0105241_123864412 | 3300009174 | Corn Rhizosphere | SLLVLGVVLALAAGVTLLGSALPLRRAAKYDPAPILRGE* |
Ga0116108_10023347 | 3300009519 | Peatland | FVLLIILGLAALITLLGSAFPLRRASRYDPAPILRGE* |
Ga0116218_14006622 | 3300009522 | Peatlands Soil | PAPKLFVLLIILGLAALITLLGSAFPLRRASRYDPAPILRGE* |
Ga0105237_122318451 | 3300009545 | Corn Rhizosphere | VLAVILGLAATVTLAGSAIPLRRAARYEPAPILRGE* |
Ga0116103_10094234 | 3300009615 | Peatland | FFVLLIILVLAALITLLGSAFPLRRASRYDPALILRGE* |
Ga0116216_102390441 | 3300009698 | Peatlands Soil | PSLIVFFVILALAAAVTILGSAIPLRRASRYEPAPILRGE* |
Ga0126374_100531663 | 3300009792 | Tropical Forest Soil | PSLLALGVVLALATLVTLLGSALPLRRATRCEPAPILRGE* |
Ga0126380_110820551 | 3300010043 | Tropical Forest Soil | VTPQPSLLVLAVIIGLAAAVTLAGSAIPLRRAARYEPAPILRGE* |
Ga0126384_110895312 | 3300010046 | Tropical Forest Soil | APSLLVFAIILAIASLVTLLGSALPLRRATHFEPAPILRGE* |
Ga0126384_118080392 | 3300010046 | Tropical Forest Soil | PSFLVLAVVLALAAAITLLGSALPLRRASRLDPAPILRGE* |
Ga0099796_101443421 | 3300010159 | Vadose Zone Soil | PEFSFVVLAVIIGLAAIVTLLGSAIPLRRASRYEPAPILRGE* |
Ga0134062_104370171 | 3300010337 | Grasslands Soil | MVFFVIIALAGGVTILGSALPLRRASRYEPAPILRGE* |
Ga0074046_104276681 | 3300010339 | Bog Forest Soil | TPNLFLLLIILALAALITLLGSAFPLRRASRYDPAPILRGE* |
Ga0074046_109061212 | 3300010339 | Bog Forest Soil | PNLFVLLIILALAALITLLGSAFPLRRASRYDPAPILRGE* |
Ga0074044_100428031 | 3300010343 | Bog Forest Soil | KLFVLLLILGLAALITLLGIVVPLRRASRYEPAPILRGE* |
Ga0126370_120620562 | 3300010358 | Tropical Forest Soil | VLGVVLVLAAGVTLLGSALPLRRAANYDPAPILRGE* |
Ga0126372_108044402 | 3300010360 | Tropical Forest Soil | VFLVVIGLAALVTLLGSAIPLRRASRIEPAPILRGE* |
Ga0126378_109321242 | 3300010361 | Tropical Forest Soil | EPSLLVFFVVIGLAALVTLLGSALPLRRASRIDPAPILRGE* |
Ga0126381_1016259361 | 3300010376 | Tropical Forest Soil | VQLATTPKIFVLFIVLVLAALITLLGSAYPLRRAAKYDPAPILRGE* |
Ga0136449_1006050941 | 3300010379 | Peatlands Soil | NLRMVLLPIVMGLATAVVLLGSVIPLRRAARFEPAPILRGE* |
Ga0136449_1041792552 | 3300010379 | Peatlands Soil | FGFTPEPRAFVLLLILSLAALITLLGSAFPLRQASRYDPAPILRGE* |
Ga0137392_101709003 | 3300011269 | Vadose Zone Soil | EFSFLVLGVTIGLAAVVTLLGSAIPLRRASRLEPAPILRGE* |
Ga0137392_106109632 | 3300011269 | Vadose Zone Soil | LGVIIGLAAIVTLLGSAIPLRRASRYEPAPILRGE* |
Ga0137393_116493732 | 3300011271 | Vadose Zone Soil | PLVFLVVIGLAALVTLLGSAIPLRRASRIEPAPILRGE* |
Ga0137389_106870402 | 3300012096 | Vadose Zone Soil | SFLVLAVIIVLAAVVTLLGSAIPLRRAARYEPAPILRGE* |
Ga0137388_115760151 | 3300012189 | Vadose Zone Soil | IVFFVIIALATGVTILGSALPLRRASRIEPAPILRGE* |
Ga0137363_103526851 | 3300012202 | Vadose Zone Soil | AFSFVVLAVIIGLAAIVTLLGSAIPLRRASRYEPAPILRGE* |
Ga0137399_116827082 | 3300012203 | Vadose Zone Soil | FLVIIALAAGVTLLGSAFPLHRASRYEPAPILRGE* |
Ga0137380_103590131 | 3300012206 | Vadose Zone Soil | FGAAPEPSLIVLLVILVLAIGITLLGSAIPLRRASLYEPAPILRGE* |
Ga0137380_106334471 | 3300012206 | Vadose Zone Soil | APEPSLIVFFVIIALAAGVTILGSALPLRRASRYEPAPILRGE* |
Ga0137380_110801862 | 3300012206 | Vadose Zone Soil | VFLVIIALAAGVTILGSALPLHRASRIEPAPILRGE* |
Ga0137360_116554412 | 3300012361 | Vadose Zone Soil | SLLVLGVILVLASAVTLLGSALPLRRAARFDPAPILRGE* |
Ga0137361_107283552 | 3300012362 | Vadose Zone Soil | LGVILVLAAAVTLLGSALPLRRAARFNPAPILRGE* |
Ga0137358_106292031 | 3300012582 | Vadose Zone Soil | EPSLIVFLVVIALAAGVTLLGSALPLRRASRYEPAPILRGE* |
Ga0137395_104668512 | 3300012917 | Vadose Zone Soil | VLGVILVLAAAVTLLGSALPLRRAARFDPAPILRGE* |
Ga0137413_110611772 | 3300012924 | Vadose Zone Soil | PKLFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE* |
Ga0137413_115507482 | 3300012924 | Vadose Zone Soil | VTPQPSLLVLAVILCLAAAVTLAGSAIPLRRAARYNPAPILRGD* |
Ga0137419_103984453 | 3300012925 | Vadose Zone Soil | FGAAPEPSLIVFLVVMALATGVTLLGSAIPLRRASRYKPAPILRGE* |
Ga0137419_104671662 | 3300012925 | Vadose Zone Soil | PSFLVLSVVLGLAILVTLLGSALPLRRATRCEPAPILRGE* |
Ga0137416_101327591 | 3300012927 | Vadose Zone Soil | EPSLIVFLVVIALAIGVTLLGSAIPLRRASRYQPAPILRGE* |
Ga0137416_106367122 | 3300012927 | Vadose Zone Soil | AAPEPSWIVFLVVIVLAAGVTILGSAFPLRRASQYEPAPILRGE* |
Ga0153916_106948561 | 3300012964 | Freshwater Wetlands | QVVFGAAPEPSGLVFAVVLALAVGVTLLGSFFSMRRAAAFEPAPILRGE* |
Ga0126369_107294522 | 3300012971 | Tropical Forest Soil | FAPEPKLFVLVIILVLAAVTTLLGSALPLRRASRYDPAPILRGE* |
Ga0134077_103841621 | 3300012972 | Grasslands Soil | PESSLIVFLVVIALAAGVTFLGSALPLRRASQYEPAPILRGE* |
Ga0163162_102164323 | 3300013306 | Switchgrass Rhizosphere | SLLVLLVILALAASVTLLGSAVPLRRAARYEPAPILRGE* |
Ga0134078_104179472 | 3300014157 | Grasslands Soil | LLVFLVVIGIAATVTLLGSAIPLRRASRIEPAPILRGE* |
Ga0134079_105174642 | 3300014166 | Grasslands Soil | VFFVVIGLAAIVTLLGSAIPLRRASRIEPAPILRGE* |
Ga0137414_10474871 | 3300015051 | Vadose Zone Soil | AVFFVIIAALAAGVTILGSALPLRRASRYEPAPILRGE* |
Ga0137414_10485943 | 3300015051 | Vadose Zone Soil | FFVIIALAAGVTILGSALPLRRASRYEPAPILRGE* |
Ga0137414_10541861 | 3300015051 | Vadose Zone Soil | KIFGGAAPKPSVIVFFVVIALATGVTILGSALPLRRASRIEPAPILRGE* |
Ga0137403_100922501 | 3300015264 | Vadose Zone Soil | LVIIVLAAGVTILGSAFPLRRASRYEPAPILRGE* |
Ga0182036_110428531 | 3300016270 | Soil | PKAFVLLLILGLAAVITLLGSAFPLRQASCYDPAPILRGE |
Ga0182041_100926571 | 3300016294 | Soil | RVFGFTPEPKLFVLLIVLVLAALTTLLGSALPLRRASRYDPAPILRGE |
Ga0182034_116803421 | 3300016371 | Soil | RVFGFAPQPKIFVLFMVLVLAALITLLGSAYPLRRASKYDPAPILRGE |
Ga0182037_109504692 | 3300016404 | Soil | EPSWLVLGVIVVLAAGVTLLGSALPLRRAASYDPAPILRGE |
Ga0182039_120138801 | 3300016422 | Soil | LFVLLIILVLAALITLLGSALPLRRASRYDPAPILRGE |
Ga0187818_101640911 | 3300017823 | Freshwater Sediment | PSLIVLLVILALAALVTLLGSAIPLRRASRIEPAPILRGE |
Ga0187801_100307641 | 3300017933 | Freshwater Sediment | EPSLIVLLVILALAALVTLLGSAVPLRRASRIEPAPILRGE |
Ga0187803_102554162 | 3300017934 | Freshwater Sediment | LFVLLIILVLAALITLLGSAFPLRRASRYDPAPILRGE |
Ga0187778_108283082 | 3300017961 | Tropical Peatland | RMVLLPIVMGLATAVVLLGSAIPLRRAARFEPAPILRGE |
Ga0187781_104547182 | 3300017972 | Tropical Peatland | LIVLLVILALAALVTLLGSAIPLRRASRIEPAPILRGE |
Ga0187777_110630451 | 3300017974 | Tropical Peatland | PEPRLFVLFIVLGLAALITLLGSAYPLRQASRYDPAPILRGE |
Ga0187782_103232901 | 3300017975 | Tropical Peatland | LFVLLVILALAALITLLGSAWPLRRASRYDPAPILRGE |
Ga0187782_114581361 | 3300017975 | Tropical Peatland | APEPKLFVLLVILALAALITLIGSAYPLRRASRYDPAPILRGE |
Ga0187810_102923741 | 3300018012 | Freshwater Sediment | PKMFLLFIVLVLAALITLAGSAYPLRRASKYDPAPILRGE |
Ga0187771_110975531 | 3300018088 | Tropical Peatland | GFTPEPKLFVLLVILALAALITLIGSAYPLRRASRYDPAPILRGE |
Ga0066667_114748621 | 3300018433 | Grasslands Soil | IVFLVVIALAAGVTVLGSALPLRRASQYEPAPILRGE |
Ga0173482_106511442 | 3300019361 | Soil | LVLLVILALAAIVTLLGSVVPLRRAACYEPAPILRGE |
Ga0193718_10240871 | 3300019999 | Soil | LVLGLILVLAAAVTLLGSALPLRRAARFDPAAILRGE |
Ga0193730_11861931 | 3300020002 | Soil | APEPSLLVFAVILALAAAVTLLGSAIPLRRASRYEPAPILRGE |
Ga0210407_103830762 | 3300020579 | Soil | FLVIVALAVGVTLLGSAIPLRRASRYEPAPILRGE |
Ga0210403_108312672 | 3300020580 | Soil | ILVLVVIVGLAAAVTIAGSAIPLRRASRYAPAPILRGE |
Ga0210399_102149153 | 3300020581 | Soil | VLFVILSLAALITLLGSAFPLRRASRYEPAPILRGE |
Ga0210399_107809652 | 3300020581 | Soil | EPSLIVFFVIIALAAVVTILGSAFPLHRASRYEPAPILRGE |
Ga0210399_115133162 | 3300020581 | Soil | EPKVFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0210401_103593361 | 3300020583 | Soil | LVLVAVLALAAGVTLLGSAIPLRHASRYEPAPILRGE |
Ga0210401_109282681 | 3300020583 | Soil | EPKLFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0179596_100315871 | 3300021086 | Vadose Zone Soil | GAAPEPSLAVFFVIIALAAGVTILGSALPLRRASRYEPAPILRGE |
Ga0210404_103670372 | 3300021088 | Soil | SLIVFFVIIALAAGVTILGSALPLRRASRYEPAPILRGE |
Ga0210406_112057731 | 3300021168 | Soil | EPKLLLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0210400_103072671 | 3300021170 | Soil | FTPEPKLFLLFVVLVLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0210387_115008691 | 3300021405 | Soil | KMFVLFVILSLAALITLLGSAFPLRRASRYEPAPILRGE |
Ga0210383_104852312 | 3300021407 | Soil | KVFVLLIVLVLAAVVTLLGSAIPLRRASRFEPAPILRGE |
Ga0210394_108800662 | 3300021420 | Soil | LFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0210394_115758832 | 3300021420 | Soil | PSILVLVVIVSLAAAVTIAGSAIPLRRAARYEPAPILRGE |
Ga0210391_105032911 | 3300021433 | Soil | LVLAVIVGLAAVVTLAGSAIPLRRAARYEPAPILRGE |
Ga0210391_105189711 | 3300021433 | Soil | LFIVLALASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0210391_111110711 | 3300021433 | Soil | LPIIVALAALVALIGGLIPLRRAARFDPAPILRGE |
Ga0210390_110382002 | 3300021474 | Soil | VLAVTLGLAAAVTLAGSAIPLRRAARYEPAPILRGE |
Ga0210392_113225942 | 3300021475 | Soil | QKIFGFTPEPKLFLLFIVLLLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0210392_114810761 | 3300021475 | Soil | LVLVAVLALAAGVTLLGSAIPLRRASRYEPAPILRGE |
Ga0210402_118428021 | 3300021478 | Soil | KLFVLLIVLMLAAVVTLLGSAMPLRRASRLEPAPILRGE |
Ga0210410_108205321 | 3300021479 | Soil | PEPSLIVFLVIIALAAGVTILGSAFPLRRASRFEAAPILRGE |
Ga0210410_117826782 | 3300021479 | Soil | LLVLVAVLALAAGVTLLGSAIPLRRASLYEPAPILRGE |
Ga0210409_116100371 | 3300021559 | Soil | AAPEPSLLVFVVTIGLAAGVTLLGSALPLRRASRYEPAPILRGE |
Ga0126371_116895012 | 3300021560 | Tropical Forest Soil | APTLLVFLVVIGLAALVTLLGSAIPLRRASRIEPAPILRGE |
Ga0222728_10220182 | 3300022508 | Soil | SLLVLVAVLALAAGVTLLGSAIPLRRASHYQPAPILRGE |
Ga0247670_11142341 | 3300024283 | Soil | LAVVLTLAILVTLLGSALPLRRATRCEPAPILRGE |
Ga0179589_103374851 | 3300024288 | Vadose Zone Soil | PSLLVLGVILVLAAVVTLLGSALPLRRAARFDPAPILRGE |
Ga0247678_10135581 | 3300024325 | Soil | LVLGVVLTLATVVTLLGSALPLRRATRCEPAPILRGE |
Ga0247668_10201281 | 3300024331 | Soil | VLGVILALAAGVTLLGSALPLRRAARFDPAPILRGE |
Ga0208192_10259701 | 3300025477 | Peatland | KLFVLLIILGLAALITLLGSAFPLRRASRYDPAPILRGE |
Ga0208688_10091024 | 3300025480 | Peatland | VLLIILGLAALITLLGSAFPLRRASRYDPAPILRGE |
Ga0207671_111542292 | 3300025914 | Corn Rhizosphere | PSLLVLLVILALAAIVTLLGSAVPLRRAARYEPAPILRGE |
Ga0207646_113444201 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TLLVFLVVIGLAALVTLLGSAIPLRRAARIEPAPILRGE |
Ga0207681_110124641 | 3300025923 | Switchgrass Rhizosphere | LVLLVILALAAIVTLLGSAVPLRRAARYEPAPILRGE |
Ga0209237_10510131 | 3300026297 | Grasslands Soil | VFLVVIGLAALVTLLGSAIPLRRASRIEPAPILRGE |
Ga0209236_11342872 | 3300026298 | Grasslands Soil | PSLIVFLVIIALATGVTLLGSAIPLRRASGYEPAPILRGE |
Ga0209027_11491161 | 3300026300 | Grasslands Soil | FLVVIALAAGVTVLGSALPLRRASQYEPAPILRGE |
Ga0209647_11086741 | 3300026319 | Grasslands Soil | SAPEPSLLILVVIIGLAAGVTLLGSAVPLRRASRYEPAPILRGE |
Ga0209158_11499841 | 3300026333 | Soil | IVFLVVIALAAGVTILGSALPLRRASQYEPAPILRGE |
Ga0257149_10271541 | 3300026355 | Soil | IVFFVVIALAAGVTILGSALPLRRASRYEPAPILRGE |
Ga0257163_10239211 | 3300026359 | Soil | APEFSFFVLAVIVGLAAIVTLLGSAIPLRRASRYEPAPILRGE |
Ga0257173_10334311 | 3300026360 | Soil | VFLVVIALAAGVTLLGSALPLRRASRYQPAPILRGE |
Ga0209806_12623102 | 3300026529 | Soil | FLVVIALAAGVTILGSALPLRRASQYEPAPILRGE |
Ga0209807_12719812 | 3300026530 | Soil | AAPEPSLMVFFVIIALAGGVTILGSALPLRRASRYEPAPILRGE |
Ga0179587_102197701 | 3300026557 | Vadose Zone Soil | FFVILGLAAGVTILGSAFPLRRASRYEPAPILRGE |
Ga0179587_102330622 | 3300026557 | Vadose Zone Soil | GFTPEPKLFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0179587_104183271 | 3300026557 | Vadose Zone Soil | FAPEPKLFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0207760_1161421 | 3300026845 | Tropical Forest Soil | PKLFVLLIVLALAALTTLLGSALPLRRASRYDPAPILRGE |
Ga0208859_10462031 | 3300027069 | Forest Soil | VFLVIVALAIGVTLLGSAIPLRRASRYEPAPILRGE |
Ga0207944_10029221 | 3300027105 | Forest Soil | FVLLIILVLAALITLLGSALPLRRASRYDPAPILRGE |
Ga0209422_11407872 | 3300027629 | Forest Soil | VAPGFSFLVLAVTIGLAAIVTLLGSAIPLRRASRYEPAPILRGE |
Ga0209076_10942132 | 3300027643 | Vadose Zone Soil | LIVFLVVIALATGVTLLGSAIPLRRASRYKPAPILRGE |
Ga0209076_11445822 | 3300027643 | Vadose Zone Soil | APEPSLIVFLVVIALATGVTLLGSAIPLRRASRYKPAPILRGE |
Ga0209217_11642491 | 3300027651 | Forest Soil | GAAPAFSFLVLAVIIGLAAIVTLLGSAIPLRRASRYEPAPILRGE |
Ga0209736_10439972 | 3300027660 | Forest Soil | EPKLFLLFIVLVLASLITLLGSAYPLRRASRYDPAPILRGE |
Ga0209009_10680811 | 3300027667 | Forest Soil | LFVILSLAALITLLGSAFPLRRASRYEPAPILRGE |
Ga0209009_11664081 | 3300027667 | Forest Soil | AAPAFSFLVLAVIIGLATVVTLLGSAIPLRRASRYEPAPILRGE |
Ga0208981_11841242 | 3300027669 | Forest Soil | LAVIIGLAAIVTLLGSAIPLRRASRYEPAPILRGE |
Ga0209588_11959511 | 3300027671 | Vadose Zone Soil | FGAAPEPSLIVFLVVIALAAGVTLLGSALPLRRASRYEPAPILRGE |
Ga0209446_11716021 | 3300027698 | Bog Forest Soil | FVIILGLAAGVTMLGSAIPLRRAAHYQPAPILRGE |
Ga0209772_101498061 | 3300027768 | Bog Forest Soil | LLIILGLAAAVTLLGSAFPLRQASRYDPAPILRGE |
Ga0209656_101629922 | 3300027812 | Bog Forest Soil | FLLFIVLALASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0209180_106821042 | 3300027846 | Vadose Zone Soil | LVLAVIVGLAAIVTLLGSAIPLRRASRYEPAPILRGE |
Ga0209701_104061431 | 3300027862 | Vadose Zone Soil | EPSVIVFSVVIAIATGVTILGSALPLRRASRIAPAPILRGE |
Ga0209275_105060471 | 3300027884 | Soil | APAPSLLVLVAVLALAAGVTLLGSAIPLRRASRYEPAPILRGE |
Ga0209488_103092731 | 3300027903 | Vadose Zone Soil | IVFFVVIALATGVTILGSALPLRRASRIEPAPILRGE |
Ga0209583_104460272 | 3300027910 | Watersheds | VLAVIIGLAAVVTLLGSAIPLRRASRFEPAPILRGE |
Ga0311355_100081191 | 3300030580 | Palsa | APQPSLLVVVLILTLAAAVTIMGSAIPLHRASRYEPAPILRGE |
Ga0170834_1104212632 | 3300031057 | Forest Soil | PEPSLLVLGLILVLAAAVTLLGSALPLRRAARFDPAAILRGE |
Ga0170834_1128797673 | 3300031057 | Forest Soil | LVFIVILVLAACVTLLGSAIPLHRASRYEPAPILRGE |
Ga0318534_103079062 | 3300031544 | Soil | SRIFGAPPAPSLLVLGVVLVLAAGVTLASSAMPLKRAANYDPAPILRGE |
Ga0318561_107957791 | 3300031679 | Soil | VLGVVLVLAAGVTLAGSAMPLKRAANYDPAPILRGE |
Ga0318572_101941171 | 3300031681 | Soil | PAPKLFVLFLILALAALITLLGSAFPLRRASRYEPAPILRGE |
Ga0307474_101509873 | 3300031718 | Hardwood Forest Soil | QPSLLVLVVIVGLAAAVTLAGSAIPLRRAARYEPAPILRGE |
Ga0306917_114221231 | 3300031719 | Soil | PKLFVLLIVLVLAALTTLLGSALPLRRASRYDPAPILRGE |
Ga0307469_107323721 | 3300031720 | Hardwood Forest Soil | PEPSLIVFFVVIALAAGVTLLGSALPLRRASRYQPAPILRGE |
Ga0318501_100720061 | 3300031736 | Soil | VLVVVLVLAAGVTLAGSAMPLKRAANYDPAPILRGE |
Ga0318502_108191282 | 3300031747 | Soil | LFVLLVILVLAAVITLIGSAYPLRRAARYDPAPILRGE |
Ga0307475_100276641 | 3300031754 | Hardwood Forest Soil | IFGAVPEPSLIVFLVIIALATGVTLLGSAIPLRRASRYEPAPILRGE |
Ga0307475_102101613 | 3300031754 | Hardwood Forest Soil | GVAPEFSFLVLAVIIGLAAVVTLLGSAIPLRRASRFEPAPILRGE |
Ga0318535_102815762 | 3300031764 | Soil | VFLVVIGLAAVVTLLGSAIPLRRASRIEPAPILRGE |
Ga0318546_107572492 | 3300031771 | Soil | PTLLVFLVVIGLAAVVTLLGSAIPLRRASRIEPAPILRGE |
Ga0318523_106245921 | 3300031798 | Soil | MPPEPSLLVLGVILALAAGVTLLGSALPLRRAASYDPAPILRGE |
Ga0307473_111842372 | 3300031820 | Hardwood Forest Soil | QKIFGFTPEPKLFLLFIVLVLASLITLLGSAYPLRRASQYDPAPILRGE |
Ga0310917_111607122 | 3300031833 | Soil | LVLAVVLALAAAVTLLGSALPLRRAARYEPAPILRGE |
Ga0306923_115314581 | 3300031910 | Soil | FTPEPRIFVLLIILALAALITLLGSAFPLRQAAQYDPAPILRGE |
Ga0306921_121289422 | 3300031912 | Soil | EPRFFVLLIVLSLAAIITLLGSAYPLRQASRYDPAPILRGE |
Ga0310916_105273901 | 3300031942 | Soil | FAPEPKLFVLVIILVLAAVTTLLGSALPLRRASRYDPAPILRGE |
Ga0310910_115764751 | 3300031946 | Soil | RIFGFTPEPKLFVLLIVLVLAALTTLLGSALPLRRASRYDPAPILRGE |
Ga0306922_110092072 | 3300032001 | Soil | KAFVLLLILGLAAVITLLGSAFPLRQASCYDPAPILRGE |
Ga0318562_104862272 | 3300032008 | Soil | LLIVLGLAAIITLLGSAYPLRQASRYDPAPILRGE |
Ga0318532_100270861 | 3300032051 | Soil | LLVFLVAIGLAAVVTLLGSAIPLRRASRIEPAPILRGE |
Ga0307470_109896891 | 3300032174 | Hardwood Forest Soil | PEPSLLVLGVILALAAIITLLGSALPLRRASRFDPAPILRGE |
Ga0335079_117634802 | 3300032783 | Soil | KIFVLLIILALAALITLIGSAYPLRQASRYDPAPILRGE |
Ga0335077_109650091 | 3300033158 | Soil | APEPKLFVLLIILVLAALITLLGSALPLRRASRYDPAPILRGE |
Ga0370484_0062716_812_934 | 3300034125 | Untreated Peat Soil | PSILVFVIILGLAALVTLVGSAIPLHRASCYEPAPILRGE |
⦗Top⦘ |