NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026639

Metagenome / Metatranscriptome Family F026639

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026639
Family Type Metagenome / Metatranscriptome
Number of Sequences 197
Average Sequence Length 42 residues
Representative Sequence EGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA
Number of Associated Samples 177
Number of Associated Scaffolds 197

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.02 %
% of genes near scaffold ends (potentially truncated) 98.98 %
% of genes from short scaffolds (< 2000 bps) 88.83 %
Associated GOLD sequencing projects 168
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.173 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.198 % of family members)
Environment Ontology (ENVO) Unclassified
(20.812 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.284 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 197 Family Scaffolds
PF00248Aldo_ket_red 30.46
PF02769AIRS_C 8.63
PF13714PEP_mutase 3.55
PF01523PmbA_TldD 3.05
PF01042Ribonuc_L-PSP 2.54
PF01965DJ-1_PfpI 2.03
PF13472Lipase_GDSL_2 1.52
PF09907HigB_toxin 1.52
PF12867DinB_2 1.52
PF13432TPR_16 1.02
PF08281Sigma70_r4_2 1.02
PF04542Sigma70_r2 1.02
PF13414TPR_11 1.02
PF00550PP-binding 0.51
PF13458Peripla_BP_6 0.51
PF01979Amidohydro_1 0.51
PF00127Copper-bind 0.51
PF00155Aminotran_1_2 0.51
PF02163Peptidase_M50 0.51
PF00586AIRS 0.51
PF13565HTH_32 0.51
PF01609DDE_Tnp_1 0.51
PF06068TIP49 0.51
PF13517FG-GAP_3 0.51
PF01288HPPK 0.51
PF00313CSD 0.51
PF06762LMF1 0.51
PF03352Adenine_glyco 0.51
PF07676PD40 0.51
PF12704MacB_PCD 0.51
PF13374TPR_10 0.51
PF04473DUF553 0.51
PF04384Fe-S_assembly 0.51
PF02882THF_DHG_CYH_C 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 197 Family Scaffolds
COG0312Zn-dependent protease PmbA/TldA or its inactivated homologGeneral function prediction only [R] 3.05
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 2.54
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.02
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.02
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.02
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.02
COG01905,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolaseCoenzyme transport and metabolism [H] 0.51
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.51
COG08017,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis)Coenzyme transport and metabolism [H] 0.51
COG1224DNA helicase TIP49, TBP-interacting proteinTranscription [K] 0.51
COG28183-methyladenine DNA glycosylase TagReplication, recombination and repair [L] 0.51
COG2975Fe-S-cluster formation regulator IscX/YfhJPosttranslational modification, protein turnover, chaperones [O] 0.51
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.51
COG3293TransposaseMobilome: prophages, transposons [X] 0.51
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.51
COG5421TransposaseMobilome: prophages, transposons [X] 0.51
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.51
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.17 %
UnclassifiedrootN/A21.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_11984126Not Available657Open in IMG/M
3300001593|JGI12635J15846_10733139Not Available568Open in IMG/M
3300002245|JGIcombinedJ26739_100922143Not Available756Open in IMG/M
3300004081|Ga0063454_100176658All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola1175Open in IMG/M
3300004082|Ga0062384_100363883Not Available920Open in IMG/M
3300004633|Ga0066395_10946871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter523Open in IMG/M
3300004635|Ga0062388_100204886All Organisms → cellular organisms → Bacteria1561Open in IMG/M
3300005167|Ga0066672_10998456All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005174|Ga0066680_10348097All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300005178|Ga0066688_10493436All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300005331|Ga0070670_100841137All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300005332|Ga0066388_102704951All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300005340|Ga0070689_100438630All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300005435|Ga0070714_102367207Not Available516Open in IMG/M
3300005526|Ga0073909_10448324Not Available616Open in IMG/M
3300005536|Ga0070697_101526847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300005538|Ga0070731_10600127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300005538|Ga0070731_11005480All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005557|Ga0066704_10408946All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300005576|Ga0066708_10275099All Organisms → cellular organisms → Bacteria → Acidobacteria1074Open in IMG/M
3300005586|Ga0066691_10403876All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300005764|Ga0066903_101609079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1232Open in IMG/M
3300005834|Ga0068851_10454767All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae761Open in IMG/M
3300005841|Ga0068863_100078322All Organisms → cellular organisms → Bacteria → Acidobacteria3130Open in IMG/M
3300005891|Ga0075283_1066906All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300006032|Ga0066696_10496986All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300006175|Ga0070712_100874179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300006176|Ga0070765_100831586All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300006176|Ga0070765_101803046Not Available574Open in IMG/M
3300006354|Ga0075021_11121569All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006796|Ga0066665_10133207All Organisms → cellular organisms → Bacteria1867Open in IMG/M
3300006904|Ga0075424_102146657Not Available588Open in IMG/M
3300006954|Ga0079219_10860046All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300007982|Ga0102924_1183595Not Available925Open in IMG/M
3300009090|Ga0099827_10218158All Organisms → cellular organisms → Bacteria1593Open in IMG/M
3300009090|Ga0099827_11169277All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300009098|Ga0105245_10712229All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1038Open in IMG/M
3300009500|Ga0116229_10070381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3294Open in IMG/M
3300009523|Ga0116221_1098236All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300009525|Ga0116220_10021807All Organisms → cellular organisms → Bacteria2587Open in IMG/M
3300009549|Ga0116137_1006577All Organisms → cellular organisms → Bacteria → Acidobacteria5349Open in IMG/M
3300009551|Ga0105238_11328010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300009552|Ga0116138_1044083All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1295Open in IMG/M
3300009672|Ga0116215_1321299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300009683|Ga0116224_10372411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300010043|Ga0126380_11949259Not Available536Open in IMG/M
3300010048|Ga0126373_10091915All Organisms → cellular organisms → Bacteria2789Open in IMG/M
3300010320|Ga0134109_10358969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300010339|Ga0074046_10405950All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300010361|Ga0126378_10197426All Organisms → cellular organisms → Bacteria2087Open in IMG/M
3300010371|Ga0134125_10951046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium943Open in IMG/M
3300010376|Ga0126381_101935598All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Luteibacter → unclassified Luteibacter → Luteibacter sp. Sphag1AF850Open in IMG/M
3300010376|Ga0126381_102587136Not Available726Open in IMG/M
3300010376|Ga0126381_102691825Not Available711Open in IMG/M
3300010376|Ga0126381_103141937Not Available654Open in IMG/M
3300010379|Ga0136449_103943616All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300010396|Ga0134126_11803539All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300010397|Ga0134124_11667211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300010401|Ga0134121_12689882Not Available542Open in IMG/M
3300011120|Ga0150983_12806721All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300011269|Ga0137392_10078747All Organisms → cellular organisms → Bacteria2553Open in IMG/M
3300011271|Ga0137393_11460902All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300012189|Ga0137388_11950145All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300012200|Ga0137382_11292843All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012203|Ga0137399_11259338Not Available623Open in IMG/M
3300012208|Ga0137376_10300176Not Available1394Open in IMG/M
3300012210|Ga0137378_11267238All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012211|Ga0137377_10382582All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1345Open in IMG/M
3300012285|Ga0137370_10094124Not Available1679Open in IMG/M
3300012285|Ga0137370_10164583All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300012351|Ga0137386_11159177All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300012374|Ga0134039_1134833Not Available554Open in IMG/M
3300012582|Ga0137358_10077113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium2241Open in IMG/M
3300012955|Ga0164298_10098753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1541Open in IMG/M
3300012957|Ga0164303_10766559Not Available659Open in IMG/M
3300012976|Ga0134076_10489367All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300013100|Ga0157373_10218687All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1344Open in IMG/M
3300013307|Ga0157372_11798394All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300014157|Ga0134078_10168138All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium874Open in IMG/M
3300014487|Ga0182000_10339116All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300014489|Ga0182018_10619591All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300014501|Ga0182024_11578341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300014654|Ga0181525_10290412All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300014969|Ga0157376_11196048All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300014969|Ga0157376_12434739All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300015262|Ga0182007_10176777Not Available736Open in IMG/M
3300016341|Ga0182035_11100066Not Available707Open in IMG/M
3300016387|Ga0182040_10315082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1201Open in IMG/M
3300016445|Ga0182038_10925879All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300017930|Ga0187825_10233322All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300017933|Ga0187801_10140877Not Available935Open in IMG/M
3300017934|Ga0187803_10051609All Organisms → cellular organisms → Bacteria1624Open in IMG/M
3300017934|Ga0187803_10378600Not Available571Open in IMG/M
3300017955|Ga0187817_10192335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1300Open in IMG/M
3300017975|Ga0187782_10007119All Organisms → cellular organisms → Bacteria → Acidobacteria8297Open in IMG/M
3300017975|Ga0187782_10016313All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5412Open in IMG/M
3300017975|Ga0187782_10577253All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300017994|Ga0187822_10384940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300017995|Ga0187816_10133273Not Available1072Open in IMG/M
3300018042|Ga0187871_10487104All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300018057|Ga0187858_10014870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6292Open in IMG/M
3300018057|Ga0187858_10410061All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300018064|Ga0187773_10294776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium903Open in IMG/M
3300018088|Ga0187771_10398984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1160Open in IMG/M
3300019268|Ga0181514_1592263Not Available518Open in IMG/M
3300020080|Ga0206350_11660834All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300020170|Ga0179594_10356296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300020579|Ga0210407_10882819All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300020580|Ga0210403_11394816All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300020582|Ga0210395_11181077All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300020583|Ga0210401_11071553All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300021088|Ga0210404_10656452All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300021168|Ga0210406_10261325All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300021170|Ga0210400_10025171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4624Open in IMG/M
3300021171|Ga0210405_10764288Not Available743Open in IMG/M
3300021181|Ga0210388_11529564All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300021401|Ga0210393_10464793Not Available1033Open in IMG/M
3300021403|Ga0210397_10818017All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300021404|Ga0210389_10695024Not Available797Open in IMG/M
3300021404|Ga0210389_10985119Not Available654Open in IMG/M
3300021405|Ga0210387_10318508Not Available1370Open in IMG/M
3300021420|Ga0210394_10036615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4363Open in IMG/M
3300021432|Ga0210384_10941280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300021432|Ga0210384_11563794All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300021433|Ga0210391_11370770All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300021477|Ga0210398_11527343All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300021478|Ga0210402_10477213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1158Open in IMG/M
3300021560|Ga0126371_11994535Not Available698Open in IMG/M
3300022722|Ga0242657_1254024All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300022726|Ga0242654_10158340All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300022756|Ga0222622_10650263All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300024295|Ga0224556_1046464Not Available1076Open in IMG/M
3300025463|Ga0208193_1053227Not Available881Open in IMG/M
3300025500|Ga0208686_1100338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300025903|Ga0207680_11048329All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300025918|Ga0207662_10251927All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300025942|Ga0207689_11475835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3568Open in IMG/M
3300025945|Ga0207679_10625229All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300026088|Ga0207641_12261775Not Available543Open in IMG/M
3300026312|Ga0209153_1302290Not Available512Open in IMG/M
3300026322|Ga0209687_1006570All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3900Open in IMG/M
3300026326|Ga0209801_1206325All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300026331|Ga0209267_1335164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300026538|Ga0209056_10554601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300027080|Ga0208237_1039124Not Available713Open in IMG/M
3300027432|Ga0209421_1100110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300027497|Ga0208199_1119503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300027648|Ga0209420_1080599Not Available940Open in IMG/M
3300027701|Ga0209447_10191371All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300027703|Ga0207862_1124757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300027737|Ga0209038_10184043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sandaracinaceae → Sandaracinus → Sandaracinus amylolyticus632Open in IMG/M
3300027842|Ga0209580_10109579All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300027846|Ga0209180_10390227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium790Open in IMG/M
3300027882|Ga0209590_10618434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300027894|Ga0209068_10870453All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300028381|Ga0268264_10414341All Organisms → cellular organisms → Bacteria → Acidobacteria1298Open in IMG/M
3300028906|Ga0308309_11819329All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300029922|Ga0311363_10165473All Organisms → cellular organisms → Bacteria2789Open in IMG/M
3300029943|Ga0311340_10252791All Organisms → cellular organisms → Bacteria1719Open in IMG/M
3300029951|Ga0311371_12682574All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300029956|Ga0302150_10389367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117515Open in IMG/M
3300029982|Ga0302277_1104593All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300029999|Ga0311339_10783279Not Available920Open in IMG/M
3300030003|Ga0302172_10098033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium892Open in IMG/M
3300030013|Ga0302178_10507095Not Available525Open in IMG/M
3300030020|Ga0311344_10566350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium985Open in IMG/M
3300030053|Ga0302177_10164289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1243Open in IMG/M
3300030294|Ga0311349_11233761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300030506|Ga0302194_10329166Not Available603Open in IMG/M
3300030507|Ga0302192_10445509All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300030688|Ga0311345_10823123Not Available724Open in IMG/M
3300030737|Ga0302310_10305257All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium894Open in IMG/M
3300030945|Ga0075373_10588434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300031047|Ga0073995_10051564All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300031261|Ga0302140_10030860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6192Open in IMG/M
3300031525|Ga0302326_13246292All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031708|Ga0310686_100713707All Organisms → cellular organisms → Bacteria → Terrabacteria group819Open in IMG/M
3300031708|Ga0310686_109829540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300031708|Ga0310686_112324298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2150Open in IMG/M
3300031708|Ga0310686_112730513Not Available717Open in IMG/M
3300031708|Ga0310686_117242160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1004Open in IMG/M
3300031716|Ga0310813_11028811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300031718|Ga0307474_10534153All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300031720|Ga0307469_11015932Not Available775Open in IMG/M
3300031754|Ga0307475_10777017All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300031768|Ga0318509_10787770All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031912|Ga0306921_10838102All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300032064|Ga0318510_10361121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300032174|Ga0307470_11108715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300032783|Ga0335079_10131474All Organisms → cellular organisms → Bacteria2820Open in IMG/M
3300032783|Ga0335079_10335095All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300032892|Ga0335081_10195593All Organisms → cellular organisms → Bacteria2807Open in IMG/M
3300032893|Ga0335069_11393130All Organisms → cellular organisms → Bacteria → Acidobacteria759Open in IMG/M
3300032955|Ga0335076_10177289All Organisms → cellular organisms → Bacteria2039Open in IMG/M
3300033158|Ga0335077_10188186All Organisms → cellular organisms → Bacteria → Acidobacteria2332Open in IMG/M
3300033158|Ga0335077_11913087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300033755|Ga0371489_0393880All Organisms → cellular organisms → Bacteria638Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.20%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.06%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.55%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.05%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.05%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.54%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.03%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.03%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.03%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.03%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.03%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.52%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.02%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.02%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.02%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.02%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.02%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.51%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.51%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.51%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.51%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.51%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.51%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.51%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.51%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.51%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.51%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.51%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.51%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012374Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031047Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1198412613300000789SoilDGKELPPIKMPSKDDGVQQVLKPEPGRPGIAKGGESPARA*
JGI12635J15846_1073313913300001593Forest SoilPPMKSPAKPDDGVQQVLKPEPGRGIVKGGESPARA*
JGIcombinedJ26739_10092214313300002245Forest SoilLPPVKAPAKPDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0063454_10017665813300004081SoilAGKELPKLTPPSKSDDGGVQQVLKPEPGRPGIAKGGDYPAPA*
Ga0062384_10036388313300004082Bog Forest SoilASEIGLLVEGKELPPFKTPPKPDDGVQQVLKPEPGRPGIVKGGESPARA*
Ga0066395_1094687113300004633Tropical Forest SoilIRMLVEGKELPPIKMPSKDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0062388_10020488613300004635Bog Forest SoilASEVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA*
Ga0066672_1099845613300005167SoilKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0066680_1034809723300005174SoilIIEGKALPKLTPPPKSDDGVQQVLKPEPGRPGMAKGGERPAPA*
Ga0066688_1049343623300005178SoilDGQELPPVKVAPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA*
Ga0070670_10084113723300005331Switchgrass RhizosphereLMEGKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA*
Ga0066388_10270495113300005332Tropical Forest SoilKELPKMTPPSKGDDGMQQVLKPEPGRPGIAKGGEHPAPA*
Ga0070689_10043863013300005340Switchgrass RhizosphereELPKITPPSKGDDSGMQQVLKPEPGRPGLAKGGEHPAPA*
Ga0070714_10236720723300005435Agricultural SoilIRMLVEGKELPPVKLPSKDDGGVQQVLKPEPGRQPVKGGERPATA*
Ga0073909_1044832413300005526Surface SoilKQLPKIVPPPKSDDSGVQQVLKPEPGRPGIAKGGEHPAPA*
Ga0070697_10152684723300005536Corn, Switchgrass And Miscanthus RhizosphereELPVKPPTPGKSDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0070731_1060012713300005538Surface SoilKELPKITPPPKPDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0070731_1100548013300005538Surface SoilKELPKLTPPPKSDDGVQQVLKPEPGRPGLKGGESPARA*
Ga0066704_1040894643300005557SoilGKGLPPIKAAPPKSDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0066708_1027509913300005576SoilELPKITPPPKPDDGMQQVLKPEPGRPGIAKGGESPARA*
Ga0066691_1040387613300005586SoilLPKIVPPPKADDGGVQQVLKPEPGRAGLKGGEHPAPA*
Ga0066903_10160907913300005764Tropical Forest SoilEGKELPPIKMPSKDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0068851_1045476713300005834Corn RhizosphereEIKMIIDGKELPKITPPSKGDDSGMQQVLKPEPGRPGLAKGGEHPAPA*
Ga0068863_10007832233300005841Switchgrass RhizosphereKIIPPSKGDDSGLQQVLKPEPGRPGLAKGGEHPAPA*
Ga0075283_106690613300005891Rice Paddy SoilPKVIPPPKGDDGVQHVLKPEPGRPGIAKGGESPARA*
Ga0066696_1049698613300006032SoilELPKLTPPSKPDDGGVQQVLKPEPGRPGIAKGGDYPAPA*
Ga0070712_10087417923300006175Corn, Switchgrass And Miscanthus RhizosphereVDGKELPKIIPPSKPDDGGVQQVLKPEPGRPGLKGGEHPAPA*
Ga0070765_10083158613300006176SoilGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA*
Ga0070765_10180304613300006176SoilLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA*
Ga0075021_1112156913300006354WatershedsGKELPAKVLPPKSDDGGVQHVLRPETGRKPNVAPGGESPARA*
Ga0066665_1013320713300006796SoilIKLLMDGQELPPVKFSSSKGDDGVQQVLKPEPGRPGLAKGGERPAPA*
Ga0075424_10214665713300006904Populus RhizospherePTRPTPSKPDDGVQQVLKPEPGRPGLAKGGESPARA*
Ga0079219_1086004623300006954Agricultural SoilPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA*
Ga0102924_118359513300007982Iron-Sulfur Acid SpringKELPPMKAPSKADDGGVQQVLKPEPGRGIAKGGESPARA*
Ga0099827_1021815833300009090Vadose Zone SoilPPVKVAPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA*
Ga0099827_1116927723300009090Vadose Zone SoilLPKIVPPPKSDDGGVQQVLKPEPGRSGLKGGESPAPA*
Ga0105245_1071222933300009098Miscanthus RhizosphereKLIIEGKELPKIIPPSKGDDSGLQQVLKPEPGRPGLAKGGEHPAPA*
Ga0116229_1007038113300009500Host-AssociatedLIEGRELPKVVPPPKADDGVQQVLKPEPGRTSVAKGGDYPAPA*
Ga0116221_109823623300009523Peatlands SoilPKIVPPPKSDDGVQQVLKPEPGRPGIAKGERPAPA*
Ga0116220_1002180713300009525Peatlands SoilELPKMTPPPKSDDGGQQVLKPKPGRPGISKGGESPARA*
Ga0116137_100657783300009549PeatlandKELPPMKSPSKPDEGVQQVLKPEPGRGIAKGGESPARA*
Ga0105238_1132801013300009551Corn RhizosphereDGKDLPKIVPPPRSDDSGVQQVLKPEPGRPGLKGGEHPAPA*
Ga0116138_104408313300009552PeatlandLLVEGKELPPMKSPSKPDDGVQQVLKPEPGRGIAKGGESPARA*
Ga0116215_132129913300009672Peatlands SoilSEIQLLIEGKELPPVKSLPTKADDGVQQVLKPEPGRSGIAKGGESPARA*
Ga0116224_1037241123300009683Peatlands SoilSEVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA*
Ga0126380_1194925923300010043Tropical Forest SoilMIIEGKELPKMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA*
Ga0126373_1009191553300010048Tropical Forest SoilLLIEGKELPKMQSPSRPDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0134109_1035896923300010320Grasslands SoilDANEIRILIEGKELPKIVPPPKSDDGGVQQVLKPEPRSGIAKGGEHPAPA*
Ga0074046_1040595013300010339Bog Forest SoilASEVMMLVEGKELPPMKSPSKPDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0126378_1019742613300010361Tropical Forest SoilEIKLLIEGKELPKMQSPSRPDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0134125_1095104613300010371Terrestrial SoilKLIIEGKELPKVVPPPRGDDNGLQQVLKPEPGRPGIAKGGEHPAPA*
Ga0126381_10193559813300010376Tropical Forest SoilTEIKMIIEGKELPPTKPVPKDSDVQQVLKPEPGRPGIAKGGEHPAPA*
Ga0126381_10258713613300010376Tropical Forest SoilPKMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA*
Ga0126381_10269182523300010376Tropical Forest SoilIEGKELPKMVPPPKSDDGGVQQVLKPEPGRPGIAKGGEHPAPA*
Ga0126381_10314193723300010376Tropical Forest SoilMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA*
Ga0136449_10394361613300010379Peatlands SoilEGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0134126_1180353923300010396Terrestrial SoilPKITPPPRSDDGVQQVLKPEPGRPGLAKGGESHAPA*
Ga0134124_1166721123300010397Terrestrial SoilEGKELPTITPPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA*
Ga0134121_1268988213300010401Terrestrial SoilIKMIIDGKELPKITPPSKGDDNGMQQVLKPEPGRPGLAKGGEHPAPA*
Ga0150983_1280672113300011120Forest SoilLMEGKELPKMTPPPRSDDGVQQVLKPEPGRPGLAKGGESPARA*
Ga0137392_1007874743300011269Vadose Zone SoilPVKAPSRPDDGVQQVLKPEPGRGIVKGGESPARA*
Ga0137393_1146090213300011271Vadose Zone SoilLIMDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0137388_1195014523300012189Vadose Zone SoilALIEGKDLPPVKVAPSKGDDGVQQVLKPEPGRPGLAKGERPAPA*
Ga0137382_1129284313300012200Vadose Zone SoilELPKMTPPPKSEDGVQQVIKPEPGRPGIAKGGESPARA*
Ga0137399_1125933823300012203Vadose Zone SoilLLVDGKELPPVKAPSKPDDGVQQVLKPEPGRGIVKGGESPARA*
Ga0137376_1030017613300012208Vadose Zone SoilGKELPPIKLPSKDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0137378_1126723813300012210Vadose Zone SoilLPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0137377_1038258213300012211Vadose Zone SoilPKIIPPSKPDDGVQQVLKPEPGRPGLAKGERPAPA*
Ga0137370_1009412433300012285Vadose Zone SoilLPKITPPSKPDDGMQQVLKPEPGRPGIAKGGESPARA*
Ga0137370_1016458323300012285Vadose Zone SoilMDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0137386_1115917713300012351Vadose Zone SoilELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0134039_113483323300012374Grasslands SoilIIEGKELPKLTPPPRPDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0137358_1007711323300012582Vadose Zone SoilELPPIKLPTKDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0164298_1009875333300012955SoilKELPPVKLPSKDDGVQQVLKPEPGRPGLAKGGESPARA*
Ga0164303_1076655913300012957SoilQLPKIVPPPKSDDSGVQQVLKPEPGRPGIAKGGEHPAPA*
Ga0134076_1048936713300012976Grasslands SoilNEIKLIMDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0157373_1021868713300013100Corn RhizosphereNEIKMIIDGKELPKITPPSKGDDNGMQQVLKPEPGRPGLAKGGEHPAPA*
Ga0157372_1179839413300013307Corn RhizosphereKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA*
Ga0134078_1016813813300014157Grasslands SoilPKLTPPSKPDDGGVQQVLKPEPGPPGIAKGGDYPAPA*
Ga0182000_1033911613300014487SoilKMIIEGKELPKITPPSKPDDGMQQVLKPEPGRPGIA*
Ga0182018_1061959113300014489PalsaNEIKMIIEGKELPKLTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0182024_1157834113300014501PermafrostKMIIEGKELPKLTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA*
Ga0181525_1029041223300014654BogEVMMLVEGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA*
Ga0157376_1119604813300014969Miscanthus RhizosphereIKLLVEGKDLPKIVPPSKPDDGGVQQVLKPEPGRPGLKGGEHPAPA*
Ga0157376_1243473923300014969Miscanthus RhizosphereTPPSKGDDSGMQQVLKPEPGRPGLAKGGEHPAPA*
Ga0182007_1017677723300015262RhizosphereLIDGKELPKMTPPSKGDDGGMQQVLKPEPGRPGIAKGGEHPAPA*
Ga0182035_1110006613300016341SoilIEGKELPKMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA
Ga0182040_1031508213300016387SoilMIVDGKELPPIKMPSKDEAVQQVLKPEPGRPGIAKGGESPARA
Ga0182038_1092587923300016445SoilNEIKMIIEGKELPKITAPPKPDEAVQQVLKPEPGRPGIAKGGESPARA
Ga0187825_1023332213300017930Freshwater SedimentELPPVKLPSKEDGVQQVLKPEPGRPGLAKGGESPARA
Ga0187801_1014087713300017933Freshwater SedimentIIEGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0187803_1005160943300017934Freshwater SedimentSEIKLLVDGKELPAKPPSPGKSDDGVQQVLKPEPGRPGIVKGGESPARA
Ga0187803_1037860023300017934Freshwater SedimentMLLVEGKELPAMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0187817_1019233533300017955Freshwater SedimentLDASEVMLLVEGKELPPNKSPAKPDDSVQQVLKPEPGRGIAKGGESPALA
Ga0187782_1000711913300017975Tropical PeatlandKMLVDGKDLPPFKPVSSKPDDGVQQVLKPEPGRVPAKGERPATA
Ga0187782_1001631313300017975Tropical PeatlandEIRMIIEGKELPKITVPPKSDEAVQQVLKPEPGRPGIAKGGESPARA
Ga0187782_1057725313300017975Tropical PeatlandIIEGKELPSITPPPKAEEGVQQVLKPEPGRPGIAKGGESPARA
Ga0187822_1038494023300017994Freshwater SedimentEGKELPPIKLPSKDEGVQQVLKPEPGRPGIAKGGESPARA
Ga0187816_1013327313300017995Freshwater SedimentEGKELPKMTPPPKSDDGVQQVLKPEPGRPGLAKGGESPARA
Ga0187871_1048710413300018042PeatlandKMIIEGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0187858_1001487083300018057PeatlandLLVEGKELPPMKSPSKPDDGVQQVLKPEPGRGIAKGGESPARA
Ga0187858_1041006113300018057PeatlandMIIEGKELPKLTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0187773_1029477623300018064Tropical PeatlandEIKMIMEGKELPKMQPPSKPDDGGVQQVLKPEPGRPGIAKGGESPARA
Ga0187771_1039898413300018088Tropical PeatlandPALTPPPKPEEGVQQVLKPEPGRPGIAKGGESPARA
Ga0181514_159226323300019268PeatlandLIEGRELPKVVPPPKADDGVQQVLKPEPGRTSVAKGGDYPAPA
Ga0206350_1166083423300020080Corn, Switchgrass And Miscanthus RhizosphereMIIDGKELPKITPPSKGDDNGMQQVLKPEPGRPGLAKGGEHPAPA
Ga0179594_1035629613300020170Vadose Zone SoilGKELPPVKLPSKDDGVQQVLKPEPGRPGLAKGGESPARA
Ga0210407_1088281913300020579SoilEVMLLVEGKELPPMKSPAKPDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0210403_1139481623300020580SoilANEIKLLVDGKELPPVKLPSKDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0210395_1118107723300020582SoilVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0210401_1107155313300020583SoilVEGKELPPIKLPSKDDGVQQVLKPEPGRPGLAKGGESPARA
Ga0210404_1065645213300021088SoilIIEGKELPPIKLPSKDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0210406_1026132513300021168SoilKELPPMKAPSKPDDGVQQVLKPEPGRGIAKGGESPARA
Ga0210400_1002517163300021170SoilVEGKELPPVKAPSKPDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0210405_1076428823300021171SoilEVMLLVEGKELPPMKAPSKADDGGVQQVLKPEPGRGIAKGGESPARA
Ga0210388_1152956413300021181SoilPKLTPPPKSDDGVQQVLKPEPGRPGLAKGGESPARA
Ga0210393_1046479323300021401SoilVMLLVEGKELPPMKSPAKPDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0210397_1081801733300021403SoilKLTPPPKSDDGVQQVLKPEPGRPGMAKGGESPARA
Ga0210389_1069502413300021404SoilPMKAPSKADDGGVQQVLKPEPGRGIAKGGESPARA
Ga0210389_1098511923300021404SoilLPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0210387_1031850813300021405SoilGKELPPFKSPPKPDDGVQQVLKPEPGRPGIVKGGESPARA
Ga0210394_1003661513300021420SoilPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0210384_1094128023300021432SoilLPKITPPPRQDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0210384_1156379423300021432SoilASEVMMLVEGKELPPMKSPSKADEGVQQVLKPEPGRGIAKGGESPARA
Ga0210391_1137077023300021433SoilLDASEVMLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0210398_1152734313300021477SoilDGKELPPMKSPAKPDDGGVQQVLKPEPGRGIAKGGESPARA
Ga0210402_1047721313300021478SoilKELPPFKSPPKPDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0126371_1199453533300021560Tropical Forest SoilIIEGKELPKMTPPSKPDDGGVQHVLKPEPGRPGIAKGGEHPAPA
Ga0242657_125402413300022722SoilMLLVEGKELPPVKAPSKPDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0242654_1015834013300022726SoilNEIKMIIEGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0222622_1065026323300022756Groundwater SedimentDAKEIKMIMEGKELPPTKLPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA
Ga0224556_104646423300024295SoilSEVIMLVEGKELPPMKSPAKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0208193_105322713300025463PeatlandPPMKLPSKPDDGVQQVLKPEPGRGIAKGGESPARA
Ga0208686_110033823300025500PeatlandLVDGKELPPMKSPSKPDEGVQQVLKPEPGRGIAKGGESPARA
Ga0207680_1104832913300025903Switchgrass RhizosphereNEIKLLMDGKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA
Ga0207662_1025192713300025918Switchgrass RhizosphereKITPPSKGDDSGMQQVLKPEPGRPGLAKGGEHPAPA
Ga0207689_1147583523300025942Miscanthus RhizosphereIKLLMEGKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA
Ga0207679_1062522923300025945Corn RhizosphereGKDLPPSKIPSKSDDGVQQVLKPEPGRPGIAKGGEHPAPA
Ga0207641_1226177513300026088Switchgrass RhizosphereKIIPPSKGDDSGLQQVLKPEPGRPGLAKGGEHPAPA
Ga0209153_130229013300026312SoilLKMIIEGKELPKIVPPPRGDDNGLQQVLKPEPGRPGIAKGGEHPAPA
Ga0209687_100657013300026322SoilMDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA
Ga0209801_120632523300026326SoilIKMIIDGKELPKITPPPKPDDGMQQVLKPEPGRPGIAKGGESPARA
Ga0209267_133516413300026331SoilIKLIMDGKELPKMTPPPKSEDGVQQVLKPEPGRPGIAKGGESPARA
Ga0209056_1055460113300026538SoilSDLPPVKVAPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA
Ga0208237_103912413300027080Forest SoilEVMLLVDGKELPPMKSPTKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0209421_110011023300027432Forest SoilELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0208199_111950323300027497Peatlands SoilDGKELPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0209420_108059923300027648Forest SoilVLLLVEGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0209447_1019137123300027701Bog Forest SoilSEVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0207862_112475713300027703Tropical Forest SoilTEIHMLVDGKELPPAKAPAKDDGVQQVLKPEPGRQPVKGGERPATA
Ga0209038_1018404313300027737Bog Forest SoilGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0209580_1010957913300027842Surface SoilLPKMVPPPRSDDGGVQQVLKPEPGRPGIAKGGERPAPA
Ga0209180_1039022723300027846Vadose Zone SoilELPKIIPPSKPDDGVQQVLKPEPGRPGLAKGERPAPA
Ga0209590_1061843423300027882Vadose Zone SoilPPVKVAPSKGDDGVQQVLKPEPGRPGLAKGGERPAPA
Ga0209068_1087045323300027894WatershedsGKELPAKVLPPKSDDGGVQHVLRPETGRKPNVAPGGESPARA
Ga0268264_1041434113300028381Switchgrass RhizospherePKIIPPSKGDDSGLQQVLKPEPGRPGLAKGGEHPAPA
Ga0308309_1181932913300028906SoilKELPPIKSPSKPDDGGVQQVLKPEPGRGIAKGGESPARA
Ga0311363_1016547363300029922FenKELPPMKLPSKEDGVQQVLKPEPGRGIAKGGESPARA
Ga0311340_1025279113300029943PalsaRLLIDNKELPAKPPAVGKNDDVQQVLKPEPGRPGIAKGGESPARA
Ga0311371_1268257413300029951PalsaPPMKSPAKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0302150_1038936723300029956BogASEVLLLVDGKELPPMKLPSKEDGVQQVLKPEPGRGIAKGGESPARA
Ga0302277_110459313300029982BogVDGKELPPMKLPSKEDGVQQVLKPEPGRGIAKGGESPARA
Ga0311339_1078327913300029999PalsaIDNKELPAKPPAVGKNDDVQQVLKPEPGRPGIAKGGESPARA
Ga0302172_1009803313300030003FenKLLMEGKELPKIIPPPRGDNDGVQQVLKPEPGRPGIAKGGESPARA
Ga0302178_1050709513300030013PalsaIGLLVEGKELPPFKSPPKPEDGVQQVLKPEPGRPGIVKGGESPARA
Ga0311344_1056635013300030020BogVDGKELPPMKSPAKPDDGGGVQQVLKPEPGRGIAKGGESPARA
Ga0302177_1016428913300030053PalsaDKALPPVKASPTKADDGVQQVLKPEPGRPGIAKGGESPARA
Ga0311349_1123376123300030294FenEGKELPKIIPPPRGDNDGVQQVLKPEPGRPGIAKGGESPARA
Ga0302194_1032916613300030506BogVDGKELPPIKAPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0302192_1044550923300030507BogMKSPAKPDDGGGVQQVLKPEPGRGIAKGGESPARA
Ga0311345_1082312313300030688BogGRELPKVVPPPKADDGVQQVLKPEPGRTSVAKGGDYPAPA
Ga0302310_1030525713300030737PalsaLLVDGKELPPMKSPAKPDDGGGVQQVLKPEPGRGIAKGGESPARA
Ga0075373_1058843423300030945SoilKLLIDGKELPKIVPPPRSDDNGVQQVLKPEPGRPGLKGGEHPAPA
Ga0073995_1005156423300031047SoilVKPPTPGKSDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0302140_1003086093300031261BogVDGKELPPIKDPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0302326_1324629213300031525PalsaPKIVPPPKSDDGVQQVLKPEPGRPGIAKGGERPAPA
Ga0310686_10071370723300031708SoilVEGKELPPMKLPSKPDDGGVQQVLKPEPGRGIAKGGESPARA
Ga0310686_10982954013300031708SoilDASEVLLLVDGKELPPMKSPAKPDDGVQQVLKPEPGRGIAKGGESPARA
Ga0310686_11232429813300031708SoilLPKMTPPPKSDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0310686_11273051313300031708SoilLVDGKELPPMKSPSKPDDGVQQVLKPEPGRAGIAKGGESPARA
Ga0310686_11724216033300031708SoilEVLLLVDGKELPPMKSPSKPDDGVQQVLKPEPGRGIVKGGESPARA
Ga0310813_1102881123300031716SoilMIMEGKELPPSKPVPKDDGVQQVLKPEPGRPGIAKGGEHPAPA
Ga0307474_1053415313300031718Hardwood Forest SoilGKELPPMKSPSKPDDGVQQVLKPEPGRGMVKGGESPARA
Ga0307469_1101593223300031720Hardwood Forest SoilQLPKVVPPPRSDDSGVQQVLKPEPGRPGIAKGGEHPAPA
Ga0307475_1077701723300031754Hardwood Forest SoilEVMLLVEGKELPPMKAPAKPDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0318509_1078777013300031768SoilPPVKAPSKDEGIQQVLKPEPGRPGIAKGGESPARA
Ga0306921_1083810223300031912SoilGKELPPAKTVSSKPDDGVQQVLKPEPGRTPGLAKGGESPARA
Ga0318510_1036112113300032064SoilPAKTVSSKPDDGVQQVLKPEPGRTPGLAKGGESPARA
Ga0307470_1110871513300032174Hardwood Forest SoilIIEGKELPKLTPPPRQDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0335079_1013147413300032783SoilELPKLEPPSKPDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0335079_1033509513300032783SoilKMLIEGRELPKLTPPPKSDDGGVQQVLKPEPGRPGIAKGGESPARA
Ga0335081_1019559313300032892SoilEIKMIIEGKELPKITAPPKPDEAVQQVLKPEPGRPGIAKGGESPARA
Ga0335069_1139313013300032893SoilGRELPKLQPPSKPDDGVQQVLKPEPGRPGIAKGGESPARA
Ga0335076_1017728933300032955SoilKIVPPSKGDDGVQQVLKPEPGRPGIAKGGEHPAPA
Ga0335077_1018818613300033158SoilEGKELPKIVPPSKGDDGVQQVLKPEPGRPGIAKGGEHPAPA
Ga0335077_1191308723300033158SoilDASEIQMLIDGKTLPPMKSPSKPDDGVQQVLKPEPGRSGIAKGGESPARA
Ga0371489_0393880_517_6363300033755Peat SoilGKELPPMKSPSKPDEGVQQVLKPEPGRGIVKGGESPARA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.