Basic Information | |
---|---|
Family ID | F026618 |
Family Type | Metagenome |
Number of Sequences | 197 |
Average Sequence Length | 41 residues |
Representative Sequence | ERLQLRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPPAP |
Number of Associated Samples | 153 |
Number of Associated Scaffolds | 197 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.03 % |
% of genes near scaffold ends (potentially truncated) | 97.97 % |
% of genes from short scaffolds (< 2000 bps) | 89.34 % |
Associated GOLD sequencing projects | 142 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.985 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.858 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.442 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.777 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 197 Family Scaffolds |
---|---|---|
PF01509 | TruB_N | 52.79 |
PF16198 | TruB_C_2 | 33.50 |
PF02033 | RBFA | 3.05 |
PF00263 | Secretin | 2.54 |
PF13517 | FG-GAP_3 | 2.03 |
PF02885 | Glycos_trans_3N | 0.51 |
PF00215 | OMPdecase | 0.51 |
PF07876 | Dabb | 0.51 |
PF01850 | PIN | 0.51 |
PF13419 | HAD_2 | 0.51 |
PF12704 | MacB_PCD | 0.51 |
COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
---|---|---|---|
COG0130 | tRNA U55 pseudouridine synthase TruB, may also work on U342 of tmRNA | Translation, ribosomal structure and biogenesis [J] | 52.79 |
COG0858 | Ribosome-binding factor RbfA | Translation, ribosomal structure and biogenesis [J] | 3.05 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.49 % |
Unclassified | root | N/A | 0.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459023|GZGNO2B02H53ZJ | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300001089|JGI12683J13190_1005995 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300001593|JGI12635J15846_10323587 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300002914|JGI25617J43924_10367504 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300002916|JGI25389J43894_1018637 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300004267|Ga0066396_10077587 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300004267|Ga0066396_10115006 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005332|Ga0066388_102445828 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300005436|Ga0070713_101140840 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300005439|Ga0070711_100019957 | All Organisms → cellular organisms → Bacteria | 4310 | Open in IMG/M |
3300005554|Ga0066661_10445518 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300005569|Ga0066705_10174820 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300005586|Ga0066691_10054375 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300005587|Ga0066654_10509366 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005842|Ga0068858_100997923 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300005921|Ga0070766_10623552 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300006086|Ga0075019_11046881 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300006162|Ga0075030_100027982 | All Organisms → cellular organisms → Bacteria | 4821 | Open in IMG/M |
3300006176|Ga0070765_101357387 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300006797|Ga0066659_10043427 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
3300006797|Ga0066659_10951829 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300006854|Ga0075425_100413181 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300006903|Ga0075426_11487632 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300006904|Ga0075424_100200037 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
3300007255|Ga0099791_10636347 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300009012|Ga0066710_102307808 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300009038|Ga0099829_10304179 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300009038|Ga0099829_10320750 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300009038|Ga0099829_11689674 | Not Available | 521 | Open in IMG/M |
3300009088|Ga0099830_10247875 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300009088|Ga0099830_10471587 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300009088|Ga0099830_10578837 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300009088|Ga0099830_11131896 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300009088|Ga0099830_11505986 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300009088|Ga0099830_11846478 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300009089|Ga0099828_11807349 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300009524|Ga0116225_1535628 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300009621|Ga0116116_1020476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2408 | Open in IMG/M |
3300009629|Ga0116119_1016166 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
3300009698|Ga0116216_10363906 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300010046|Ga0126384_12400971 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300010159|Ga0099796_10117718 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300010341|Ga0074045_10415457 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300010343|Ga0074044_10937683 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300010359|Ga0126376_10635676 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300010359|Ga0126376_10835369 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300010360|Ga0126372_11136549 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300010360|Ga0126372_11226728 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300010376|Ga0126381_101603806 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300010398|Ga0126383_11797560 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300010937|Ga0137776_1382099 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300011269|Ga0137392_10166116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1790 | Open in IMG/M |
3300011269|Ga0137392_11259901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300011269|Ga0137392_11637653 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300011271|Ga0137393_10228047 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300011271|Ga0137393_10649870 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300011271|Ga0137393_11485129 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300012189|Ga0137388_10257343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1590 | Open in IMG/M |
3300012189|Ga0137388_10679916 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300012202|Ga0137363_10640813 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300012203|Ga0137399_10457165 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300012209|Ga0137379_10643973 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300012351|Ga0137386_10510343 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300012357|Ga0137384_10839788 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300012363|Ga0137390_11678958 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300012363|Ga0137390_11935429 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300012683|Ga0137398_10847094 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300012683|Ga0137398_10860546 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012685|Ga0137397_10194873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1506 | Open in IMG/M |
3300012917|Ga0137395_10925219 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300012923|Ga0137359_10068601 | All Organisms → cellular organisms → Bacteria | 3098 | Open in IMG/M |
3300012923|Ga0137359_11443147 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300012924|Ga0137413_10150620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
3300012925|Ga0137419_10387626 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300012925|Ga0137419_10798782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300012927|Ga0137416_10159949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1772 | Open in IMG/M |
3300012927|Ga0137416_11900919 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300012976|Ga0134076_10413202 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300013832|Ga0120132_1103703 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300015053|Ga0137405_1135658 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300015241|Ga0137418_10829987 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300015241|Ga0137418_11144437 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300016341|Ga0182035_10633293 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300016341|Ga0182035_11351392 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300016387|Ga0182040_11119482 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300016422|Ga0182039_12198038 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300016445|Ga0182038_11995301 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300017928|Ga0187806_1098049 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300017942|Ga0187808_10453216 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300017955|Ga0187817_10111828 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
3300017959|Ga0187779_11185769 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300018006|Ga0187804_10047767 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
3300018058|Ga0187766_10608057 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300018086|Ga0187769_10180801 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300018090|Ga0187770_10364079 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300018090|Ga0187770_10990011 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300018433|Ga0066667_10100161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1926 | Open in IMG/M |
3300018482|Ga0066669_10007557 | All Organisms → cellular organisms → Bacteria | 5259 | Open in IMG/M |
3300018482|Ga0066669_11168227 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300019789|Ga0137408_1097741 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300020199|Ga0179592_10091464 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300020579|Ga0210407_10461678 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300020580|Ga0210403_10847707 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300020581|Ga0210399_10139961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1997 | Open in IMG/M |
3300020581|Ga0210399_10372722 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300020581|Ga0210399_10983666 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300020582|Ga0210395_10437742 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300020583|Ga0210401_10471293 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300021088|Ga0210404_10248195 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300021088|Ga0210404_10905034 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300021178|Ga0210408_10644915 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300021181|Ga0210388_10033662 | All Organisms → cellular organisms → Bacteria | 4221 | Open in IMG/M |
3300021181|Ga0210388_10464849 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300021181|Ga0210388_11607986 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300021401|Ga0210393_10057399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3062 | Open in IMG/M |
3300021401|Ga0210393_10566975 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300021401|Ga0210393_11071327 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300021401|Ga0210393_11225970 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300021401|Ga0210393_11663747 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300021403|Ga0210397_10052652 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
3300021403|Ga0210397_11055200 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300021404|Ga0210389_10247042 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300021405|Ga0210387_10705970 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300021405|Ga0210387_10941131 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300021433|Ga0210391_10570280 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300021433|Ga0210391_11128412 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300021474|Ga0210390_10534801 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300021475|Ga0210392_10638088 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300021478|Ga0210402_11423440 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300021479|Ga0210410_10331779 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300021559|Ga0210409_10159797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2062 | Open in IMG/M |
3300022873|Ga0224550_1039178 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300024286|Ga0247687_1007445 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300024288|Ga0179589_10279426 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300024290|Ga0247667_1033999 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300025472|Ga0208692_1046644 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300025898|Ga0207692_10117842 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
3300025916|Ga0207663_10008018 | All Organisms → cellular organisms → Bacteria | 5506 | Open in IMG/M |
3300025922|Ga0207646_11105762 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300025922|Ga0207646_11451446 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300026035|Ga0207703_10911796 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300026328|Ga0209802_1319264 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300026343|Ga0209159_1072787 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300026482|Ga0257172_1059638 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300026499|Ga0257181_1096349 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300026507|Ga0257165_1091252 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300026530|Ga0209807_1123898 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300026548|Ga0209161_10372311 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300026557|Ga0179587_10424308 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300026557|Ga0179587_10477931 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300026823|Ga0207759_111466 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300026847|Ga0207802_1024394 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300027011|Ga0207740_1016865 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300027505|Ga0209218_1135324 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300027660|Ga0209736_1002689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5871 | Open in IMG/M |
3300027678|Ga0209011_1010043 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
3300027824|Ga0209040_10035523 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
3300027829|Ga0209773_10136825 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1018 | Open in IMG/M |
3300027869|Ga0209579_10327210 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300027875|Ga0209283_10835463 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300027884|Ga0209275_10502180 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300027908|Ga0209006_10635811 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300027910|Ga0209583_10388006 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300028047|Ga0209526_10723724 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300028789|Ga0302232_10230935 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300030057|Ga0302176_10226037 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300030524|Ga0311357_11407103 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300031128|Ga0170823_12896738 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300031545|Ga0318541_10332134 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300031680|Ga0318574_10054056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2122 | Open in IMG/M |
3300031715|Ga0307476_10701964 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300031720|Ga0307469_12139538 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300031754|Ga0307475_11338466 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300031777|Ga0318543_10491803 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300031782|Ga0318552_10623247 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300031793|Ga0318548_10294362 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300031823|Ga0307478_11744857 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031890|Ga0306925_10197747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2168 | Open in IMG/M |
3300031910|Ga0306923_10064159 | All Organisms → cellular organisms → Bacteria | 4085 | Open in IMG/M |
3300031910|Ga0306923_11927149 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300031962|Ga0307479_10311002 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300031962|Ga0307479_10788862 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300031962|Ga0307479_11588449 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300032039|Ga0318559_10288669 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300032059|Ga0318533_10248592 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300032065|Ga0318513_10329208 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300032076|Ga0306924_10605986 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300032180|Ga0307471_100353065 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300032180|Ga0307471_100445280 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
3300032205|Ga0307472_101274221 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300032261|Ga0306920_102410401 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300032828|Ga0335080_10791965 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300032828|Ga0335080_11377671 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300032897|Ga0335071_10357722 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300032955|Ga0335076_11144197 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300033289|Ga0310914_10001834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 13974 | Open in IMG/M |
3300033561|Ga0371490_1160341 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.08% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.05% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.05% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.05% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.03% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.52% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.52% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.02% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.02% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.02% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.51% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.51% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.51% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.51% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FA3_02736320 | 2170459023 | Grass Soil | LRRVPELHFSLDNSQEYTERIDQILKEMKKDNPSAT |
JGI12683J13190_10059952 | 3300001089 | Forest Soil | RVPELHFTLDLSQEHVERIERLLKEMKKDNPPTPQQ* |
JGI12635J15846_103235871 | 3300001593 | Forest Soil | IERLQLRRVPELHFTLDLSQEKVQRIEQLLKEVKKPNPPPQS* |
JGI25617J43924_103675041 | 3300002914 | Grasslands Soil | RLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPAA* |
JGI25389J43894_10186372 | 3300002916 | Grasslands Soil | ELVERLQLRRVPELHFILDLSQEHVERIERLLKEMKKDNPPAP* |
Ga0066396_100775871 | 3300004267 | Tropical Forest Soil | LRRLPELHFALDLSEERVERIERLLKEVNKDKPSSKLGSNF* |
Ga0066396_101150061 | 3300004267 | Tropical Forest Soil | ERLQLRRLPDLHFTLDLSQEHVARIEQLLKQMKSDKPVNPSPKPDRAP* |
Ga0066388_1024458281 | 3300005332 | Tropical Forest Soil | LVERLQLRRTPDLHFILDHSQEYTERIDQLLKEMKKGKPSTP* |
Ga0070713_1011408401 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ERLQLRRVPELHFSLDNSQEYTERIDQLLKEMKKDKSAT* |
Ga0070711_1000199574 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SELIERLQLRRLPELHFTLDVSQEHVERIEQLLKDLKKDKPAASSD* |
Ga0066661_104455181 | 3300005554 | Soil | ERLQLRRVPELHFILDLSQEHVERIERLLKEMKKDNPPAP* |
Ga0066705_101748201 | 3300005569 | Soil | LQLRRVPELHFSLDNSQEYTERIDTLLKELKKDSTSTK* |
Ga0066691_100543754 | 3300005586 | Soil | LERLQLRRVPDLHFTLDNSQEYTERIDQLLKEMKKGNPSPK* |
Ga0066654_105093662 | 3300005587 | Soil | RRVPELHFTLDLSQEHVERIERLLKEMKKDNPPAP* |
Ga0068858_1009979232 | 3300005842 | Switchgrass Rhizosphere | LRRLPELHFALDLTQERAERIEQLLKEVKKDKPAAP* |
Ga0070766_106235521 | 3300005921 | Soil | ERLQLRRLPELHFTLDLSQEHVERIEQLLKEMKEKTPKPETNL* |
Ga0075019_110468812 | 3300006086 | Watersheds | LLERLQLRRIPELHFVLDVSQEHVERIEQLLKEVKKNPATTD* |
Ga0075030_1000279824 | 3300006162 | Watersheds | AYIRRELVGRLLLRRVPELHFVLDLSQESVERIEELLKEMKKDQPSAPQE* |
Ga0070765_1013573872 | 3300006176 | Soil | RHELIERLQLRRLPDLHFTLDLSQEHVERIEQLLKQMKAQKPSTPEASS* |
Ga0066659_100434274 | 3300006797 | Soil | LRRAPEFHFVLDRSEQYTERIEQLLRDIKKSESAGS* |
Ga0066659_109518292 | 3300006797 | Soil | RVPELHFILDLSQEHVERIERLLKEMKKDNPPAP* |
Ga0075425_1004131811 | 3300006854 | Populus Rhizosphere | ERLQLRRVPDLHFTLDNSEEHAARVDQLLKQMKSGTSPSK* |
Ga0075426_114876322 | 3300006903 | Populus Rhizosphere | LIERLQVRRLPELHFTLDLSEESALRIEQLLKDVKKDKPSAP* |
Ga0075424_1002000374 | 3300006904 | Populus Rhizosphere | LQLRRVPDLHFTLDNSEEQAARVDQLLKQMKSGTSPTK* |
Ga0099791_106363471 | 3300007255 | Vadose Zone Soil | RLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDKPSAAEQ* |
Ga0066710_1023078081 | 3300009012 | Grasslands Soil | HEILERLQLRRVPDLHFTLDNSHEYTERIDQLLKEMKKGNPSPK |
Ga0099829_103041793 | 3300009038 | Vadose Zone Soil | EIIERLQLRRLPELHFALDLSQEHVERIEQLLKEMKKDKPSSNP* |
Ga0099829_103207502 | 3300009038 | Vadose Zone Soil | GELVERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDSPPAP* |
Ga0099829_116896741 | 3300009038 | Vadose Zone Soil | IERLRLRRLPELHFLLDHSQEYTERIEQLLKEVKKDKPSAP* |
Ga0099830_102478751 | 3300009088 | Vadose Zone Soil | ELVERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPTPQQ* |
Ga0099830_104715871 | 3300009088 | Vadose Zone Soil | ELVERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPAP* |
Ga0099830_105788371 | 3300009088 | Vadose Zone Soil | RVPELHFTLDLSQEHVERIERLLKEMKKDNPPAA* |
Ga0099830_111318961 | 3300009088 | Vadose Zone Soil | QLRRVPELHLTLDLSQKHVERIQRLLKEMKKDNPPTPQQ* |
Ga0099830_115059862 | 3300009088 | Vadose Zone Soil | VERLQLRRVPELHFILDLSQEHMERIERLLKEMKKDNPPATQ* |
Ga0099830_118464781 | 3300009088 | Vadose Zone Soil | SEIIERLQLRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPPAP* |
Ga0099828_118073491 | 3300009089 | Vadose Zone Soil | QLRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPPAP* |
Ga0116225_15356281 | 3300009524 | Peatlands Soil | LHFTLDLSQEHVERIERLLKEAKSEKPPTPETNL* |
Ga0116116_10204763 | 3300009621 | Peatland | ERLQLRRVPELHFTLDLSQEHVERIERLLKEAKSEKPPNKPETNL* |
Ga0116119_10161663 | 3300009629 | Peatland | VPELHFALDLSQEHVERIERLLKEAKSAKPPTSESNL* |
Ga0116216_103639062 | 3300009698 | Peatlands Soil | RRLPDLHFTLDLSEEHVERIEQLLKQMKAEKPSTPEANS* |
Ga0126384_124009711 | 3300010046 | Tropical Forest Soil | LVERLQLRRLPELHFTLDVSEESAERIEKLLKEVKKDKPSPI* |
Ga0099796_101177181 | 3300010159 | Vadose Zone Soil | RLQLRRLPELHFTLDLSQEHVERIEQLLRDMKKDKPSSNL* |
Ga0074045_104154572 | 3300010341 | Bog Forest Soil | RRVPELHFTLDLSQEHVERIERLLKEAKSEKPPTPETNL* |
Ga0074044_109376832 | 3300010343 | Bog Forest Soil | IERLQLRRLPELHFILDHSQEYTERIEQLLKDMKKDKPSAP* |
Ga0126376_106356761 | 3300010359 | Tropical Forest Soil | HELIERLQLRRLPDLHFTLDLSQERVERIEQLLKEMKAEKRSKPESNP* |
Ga0126376_108353691 | 3300010359 | Tropical Forest Soil | RLQLRRVPDLHFTLDLSQEHMERIEQLLKQMKSERVNKPEPNP* |
Ga0126372_111365491 | 3300010360 | Tropical Forest Soil | HEIVERLQLRRVPELHFSLDNSQEYTERIDQLLKEMKKGSPPST* |
Ga0126372_112267281 | 3300010360 | Tropical Forest Soil | LERLQLRRVPDLHFTLDDSEDNAARIDQLLKQMKHDASPQK* |
Ga0126381_1016038061 | 3300010376 | Tropical Forest Soil | LHFTLDLSQEHVERIEQLLKQMKAERANKTEPNP* |
Ga0126383_117975602 | 3300010398 | Tropical Forest Soil | ERLQLRRLPELHFTLDVSQENAERIEQLLKEVKKDKPSAQGSSK* |
Ga0137776_13820992 | 3300010937 | Sediment | HELIERLQVRRLPELHFTLDVSEESALRIEQLLKEMKKDKPSVP* |
Ga0137392_101661163 | 3300011269 | Vadose Zone Soil | HELIERLQVRRLPELHFALDVSEESALRIEQLLKEVKKDKPTAS* |
Ga0137392_112599012 | 3300011269 | Vadose Zone Soil | VERLQLRRVPELHFTLDLSQEHIERIEQLLKEMKKDKPSAP* |
Ga0137392_116376531 | 3300011269 | Vadose Zone Soil | QLRRVPELHFILDLSQEHVERIERLLKEMKKDNPPAA* |
Ga0137393_102280473 | 3300011271 | Vadose Zone Soil | VERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPAA* |
Ga0137393_106498701 | 3300011271 | Vadose Zone Soil | KHELVERLQLRRVPDLHFTLDLSQEHVERIEQLLKQMKLDKADKPEPNP* |
Ga0137393_114851291 | 3300011271 | Vadose Zone Soil | QLRRVPELHFALDLSQEHVERIERLLKEMKKDNPPAA* |
Ga0137388_102573433 | 3300012189 | Vadose Zone Soil | RLPELHFTLDLSQEHVERIEQLLKQMKKDKPSSNL* |
Ga0137388_106799161 | 3300012189 | Vadose Zone Soil | RTPEIHFTLDLSQEYSERIEQLLKDVKKDRPAAP* |
Ga0137363_106408132 | 3300012202 | Vadose Zone Soil | HFTLDLSQEHVERIEQLLKQMKLDKADKPEPTPEQ* |
Ga0137399_104571652 | 3300012203 | Vadose Zone Soil | RRVPELHFILDLSQEHVERIERLLKEMKKDNPPAA* |
Ga0137379_106439731 | 3300012209 | Vadose Zone Soil | ERLQLRRLPELHFALDLSQEHVERIEQLLKEAKKDKPAAP* |
Ga0137386_105103431 | 3300012351 | Vadose Zone Soil | LRRVPELHFILDLSQEHVERIERLLKEMKKDNPPTPQQ* |
Ga0137384_108397881 | 3300012357 | Vadose Zone Soil | RLQLRRLPELHFALDLSQEHVERIEQLLKEAKKDKPAAP* |
Ga0137390_116789581 | 3300012363 | Vadose Zone Soil | RLQLRRVPELHFALDNSQEYTERIDQILKEMKKDNPSAT* |
Ga0137390_119354292 | 3300012363 | Vadose Zone Soil | LQLRRVPELHFILDLSQEHVERIERLLKEMKKDNPPAA* |
Ga0137398_108470942 | 3300012683 | Vadose Zone Soil | SVSIRREMVEWLELRRVPELHFTLYLSQEYLERIERLLKEMKKDNPPAP* |
Ga0137398_108605461 | 3300012683 | Vadose Zone Soil | LRRVPELHFSLDNSQEYTERIDQLLKEMKKGSPPTS* |
Ga0137397_101948733 | 3300012685 | Vadose Zone Soil | RRVPELHFTLDLSQEHIERIEQLLKEMKKDKPSAP* |
Ga0137395_109252191 | 3300012917 | Vadose Zone Soil | RLPELHFALDVSEESALRIEQLLKEVKKDKPTAS* |
Ga0137359_100686013 | 3300012923 | Vadose Zone Soil | LIERLQLRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPTAT* |
Ga0137359_114431471 | 3300012923 | Vadose Zone Soil | LIERLQLRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPTAL* |
Ga0137413_101506203 | 3300012924 | Vadose Zone Soil | LQLRRLPELHFTLDLSQEHVERIEQLLRDMKKDKPSSNL* |
Ga0137419_103876261 | 3300012925 | Vadose Zone Soil | ERLQVRRLPELHFTLDNSEESALRIEQLLKEVKKDKPTAL* |
Ga0137419_107987822 | 3300012925 | Vadose Zone Soil | LQLRRVPELHFTLDLSQEHIERIEQLLKEMKKDKPSAP* |
Ga0137416_101599493 | 3300012927 | Vadose Zone Soil | VPELHFTLDLSQEHVERIERLLKEMKKDKPSAAEQ* |
Ga0137416_119009192 | 3300012927 | Vadose Zone Soil | RRVPELHFTLDLSQEHVERIERLLKEMKKDNPPAA* |
Ga0134076_104132021 | 3300012976 | Grasslands Soil | RRELVERLQLRRVPELHFTLDLSQEHIERIEQLLKEMKKDKPSAAEQ* |
Ga0120132_11037032 | 3300013832 | Permafrost | LIERLQLRRVPELHFTLDLTQEKVQRIEQLLKEVKKPTPPTA* |
Ga0137405_11356582 | 3300015053 | Vadose Zone Soil | HELIERLQVRRLPELHFTLDNSEESALRIEQLLKEVKKDKPTAL* |
Ga0137418_108299872 | 3300015241 | Vadose Zone Soil | RRLPELHFTLDVSEESALRIEQLLKEVKKDKPSAP* |
Ga0137418_111444371 | 3300015241 | Vadose Zone Soil | IERLQLRRLPELHYTLDLSQEHVERIEQLLNDMKKDKPSSTP* |
Ga0182035_106332932 | 3300016341 | Soil | RHQILERLQLRRVPDLHFTLDNSEEHAARIDQLLKAMKSDRSAQK |
Ga0182035_113513921 | 3300016341 | Soil | RLPDLHFTLDLSQERLERIEQLLKEMKAEKRSKPESNP |
Ga0182040_111194822 | 3300016387 | Soil | RHELIERLQLRRLPDLHFTLDLSQERVERIEQLLKEMKTEKRSKRESNP |
Ga0182039_121980381 | 3300016422 | Soil | RLQLRRVPDLHFTLDNSEEHAARIDQLLKDMKKNPSLRK |
Ga0182038_119953012 | 3300016445 | Soil | HKLMERLQLRRLPELHFALDLSEERVERIEQLLKEVKRDKPSTKSKKRK |
Ga0187806_10980491 | 3300017928 | Freshwater Sediment | RLQLRRLPELHFTLDLSQEHVERIEQLLKQMKAEKPSTPERNS |
Ga0187808_104532161 | 3300017942 | Freshwater Sediment | LQLRRVPDLHFTLDLSQEHVERIEQLLMQMKAERADKPEPKA |
Ga0187817_101118281 | 3300017955 | Freshwater Sediment | RLQLRRLPELHFTLDLSQEHVERIEQLLKEMKKNKPAAP |
Ga0187779_111857691 | 3300017959 | Tropical Peatland | RLQLRRVPELHFTLDLSQAHVERIERLLKEAKTEKPPKPETNL |
Ga0187804_100477671 | 3300018006 | Freshwater Sediment | LIERLRMRRLPDLHFTLDLSQEHLERIEQLLKQMKAPKPSTPDSTP |
Ga0187766_106080571 | 3300018058 | Tropical Peatland | HELVERLQLRRVPDLHFTLDLSQEHVERIERLLKQMKSERSDKPEQKA |
Ga0187769_101808011 | 3300018086 | Tropical Peatland | QLRRLPELHFALDESQENAERIEQLLKEMKKGKPSAPQK |
Ga0187770_103640791 | 3300018090 | Tropical Peatland | DLHFTLDLSQEHMERIEQLLKQMRSDKPANPSKPDSTP |
Ga0187770_109900111 | 3300018090 | Tropical Peatland | VPELHFTLDLSQEHVERIERLLKEAKSAKPPKPESSL |
Ga0066667_101001613 | 3300018433 | Grasslands Soil | VERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPTPQQ |
Ga0066669_100075574 | 3300018482 | Grasslands Soil | VERLQLRRVPELHFILDLSQEHVERIERLLKEMKKDNPPAP |
Ga0066669_111682272 | 3300018482 | Grasslands Soil | VPELHFTLDLSQEHVERIERLLKEMKKDNPPTPQQ |
Ga0137408_10977412 | 3300019789 | Vadose Zone Soil | ELVERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDKPSAP |
Ga0179592_100914642 | 3300020199 | Vadose Zone Soil | ELVERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPAP |
Ga0210407_104616782 | 3300020579 | Soil | RRELVERLQLRRVPELHFALDLSQAHVERIEQLLKDMKKDKPSATQE |
Ga0210403_108477072 | 3300020580 | Soil | RLQLRRLPDLHFTLDLSQEHVERIEQLLKEVKKDKPAAP |
Ga0210399_101399613 | 3300020581 | Soil | ERLQLRRTPELHFTLDLSHEYTLRIEQLLKEVKKDKPAAS |
Ga0210399_103727221 | 3300020581 | Soil | VERLQLRRVPDLHFTLDLSQEHVERIEQLLKQMKLDKADKPEPNP |
Ga0210399_109836662 | 3300020581 | Soil | VPELHFTLDLSQEHIERIEQLLKDMKKDKPSAPEQ |
Ga0210395_104377423 | 3300020582 | Soil | HELVERLQLRRVPDLHFTLDLSQEHVERIEQLLKQMKSDKADKPEPNP |
Ga0210401_104712931 | 3300020583 | Soil | LRRVPELHFTLDLSQEHVERIEQLLKEMKKDKPSAP |
Ga0210404_102481952 | 3300021088 | Soil | RLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPTPQQ |
Ga0210404_109050342 | 3300021088 | Soil | RRELIERLQLRRLPELHFALDHSQEYTERIDQLLKEMKKDKPAAS |
Ga0210408_106449152 | 3300021178 | Soil | LRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPSSNL |
Ga0210388_100336623 | 3300021181 | Soil | LQLRRLPELHFALDHSQEYTERIDQLLKEMKKDKPAAS |
Ga0210388_104648492 | 3300021181 | Soil | LRRLPELHFALDHSQEYTERIDQLLKEMKKDKPAAS |
Ga0210388_116079862 | 3300021181 | Soil | ELIERLQLRRLPEMHFTLDQSQEHVERIDQLLREMKKDKPAASSE |
Ga0210393_100573991 | 3300021401 | Soil | ERLQLRRLPELHFILDHSQEYTERIEQLLRDMKKDKPSAP |
Ga0210393_105669752 | 3300021401 | Soil | RLQLRRLPELHFALDHSQEYTERIDQLLKEMKKDKPAAS |
Ga0210393_110713271 | 3300021401 | Soil | LRRLPELHFTLDLSQEHVERIEQLLKEVKTEKPAAPETERSQE |
Ga0210393_112259702 | 3300021401 | Soil | ERLQLRRLPELLFALDHSQEYTERIDQLLKEMKKDKPAAS |
Ga0210393_116637471 | 3300021401 | Soil | LQLRRLPEMHFTLDTSQEHVERIEQLLKEMKKDKPAASSD |
Ga0210397_100526521 | 3300021403 | Soil | LIERLQLRRLPEMHFTLDQSQEHVERIEQLLKEMKKDKPAASSD |
Ga0210397_110552002 | 3300021403 | Soil | LQLRRVPDLHFTLDLSQEHVERIEQLLKQMKSEKADKPEPNP |
Ga0210389_102470421 | 3300021404 | Soil | RRLPELHFTLDHSQEYTERIDQLLKEMKKDKPAAS |
Ga0210387_107059702 | 3300021405 | Soil | LIERLQLRRLPEMHFTLDESQEHVERIEQLLRDMKKDKPAASSD |
Ga0210387_109411311 | 3300021405 | Soil | LRRLPELHFTLDLSQEHVERIEQLLKEMKEKTPKPETNL |
Ga0210391_105702802 | 3300021433 | Soil | LQLRRLPDLHFTLDLSQEHVERIEQLLKQMKAQKPSTPEASS |
Ga0210391_111284122 | 3300021433 | Soil | SELIERLQLRRLPEMHFTLDTSQEHVERIEQLLKEMKKDKPAASSD |
Ga0210390_105348012 | 3300021474 | Soil | DLHFTLDLSQEHVERIERLLKQMKTEKPSTPEANS |
Ga0210392_106380881 | 3300021475 | Soil | DLHFTLDLSQEHVERIEQLLKQMKLDKADKPDKPEPNP |
Ga0210402_114234402 | 3300021478 | Soil | LIERLQLRRLPELHFALDHSQEYTERIDQLLKEMKKDKPAAS |
Ga0210410_103317792 | 3300021479 | Soil | LRRLPDLHFTLDLSQEHVERIEQLLKEVKKDKPAAP |
Ga0210409_101597971 | 3300021559 | Soil | LRRVPELHFTLDLSQEHIERIEQLLKDMKKDKPSAPSE |
Ga0224550_10391782 | 3300022873 | Soil | LQVRRLPELHFTLDHSQEYTERIEQLLRDMKKDKPSAP |
Ga0247687_10074452 | 3300024286 | Soil | IRHELIERLQVRRLPELHFTLDVSEESALRIEQLLKEVKKDKPTAL |
Ga0179589_102794262 | 3300024288 | Vadose Zone Soil | RLQLRRVPELHFTLDLSQEHLERIERLLKEMKKDNPPAP |
Ga0247667_10339991 | 3300024290 | Soil | LRRLPELHFTLDLSQEHVERIEQLLKDMKKDKPSSNL |
Ga0208692_10466442 | 3300025472 | Peatland | RVPELHFTLDLSQEHVERIERLLKEAKSEKPPNKPETNL |
Ga0207692_101178421 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VERLQLRRVPDLHFTLDLSQEHVERIEQLLKEVKKEKPASSD |
Ga0207663_100080184 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IRSELIERLQLRRLPELHFTLDVSQEHVERIEQLLKDLKKDKPAASSD |
Ga0207646_111057622 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EILERLQLRRVPDLHFTLDSSEDHAARIDQLLKQMKSGTSPTK |
Ga0207646_114514462 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVPDLHFTLDNSHEYTERIDQLLKEMKKNSSSTK |
Ga0207703_109117961 | 3300026035 | Switchgrass Rhizosphere | QLRRLPELHFALDLTQERAERIEQLLKEVKKDKPAAP |
Ga0209802_13192642 | 3300026328 | Soil | LQLRRVPDLHFTLDNSQEYTERIDQLLKEMKKGNPSPK |
Ga0209159_10727873 | 3300026343 | Soil | LQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPSAP |
Ga0257172_10596382 | 3300026482 | Soil | LQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPLTPQQ |
Ga0257181_10963491 | 3300026499 | Soil | ERLQLRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPPAP |
Ga0257165_10912522 | 3300026507 | Soil | RRVPDLHFTLDLSQEHVERIEQLLKQMKLDKADKPEPTPEQ |
Ga0209807_11238981 | 3300026530 | Soil | RLQLRRVPELHFILDLSQEHVERIERLLKEMKKDNPPAP |
Ga0209161_103723112 | 3300026548 | Soil | VRRLPELHFTLDNSEEGALRIEQLLKEVKKDKPTAL |
Ga0179587_104243082 | 3300026557 | Vadose Zone Soil | LRRLPELHFTLDLSQEHVERIEQLLRDMKKDKPSSNL |
Ga0179587_104779312 | 3300026557 | Vadose Zone Soil | LRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPAP |
Ga0207759_1114661 | 3300026823 | Tropical Forest Soil | QLRRLPDLHFTLDLSQERVERIEQLLKEMKAEKRSKPGSNP |
Ga0207802_10243941 | 3300026847 | Tropical Forest Soil | HELIERLQLRRLPDLHFTLDLSQERVERIEALLKEMKAGKSSKSNP |
Ga0207740_10168652 | 3300027011 | Tropical Forest Soil | HELIERLQLRRLPDLHFTLDLSQERVERIEQLLKEMKAEKRSKPGSNP |
Ga0209218_11353241 | 3300027505 | Forest Soil | RLQLRRLPEMHFTLDTSQEHVERIEQLLKEMKKDKPAASSD |
Ga0209736_10026895 | 3300027660 | Forest Soil | RSEIIERLQLRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPSSAP |
Ga0209011_10100431 | 3300027678 | Forest Soil | ERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPTPQQ |
Ga0209040_100355231 | 3300027824 | Bog Forest Soil | ELVERLQLRRIPELHFVLDISQEHVERIEQLLKEVKKNPTPTE |
Ga0209773_101368253 | 3300027829 | Bog Forest Soil | LRRIPDLHFVLDVSQEHVERIEQLLKEVKKNPTTLE |
Ga0209579_103272101 | 3300027869 | Surface Soil | RLPDMHFTLDTSQEHVERIEQLLKEMKKDKPAASSD |
Ga0209283_108354631 | 3300027875 | Vadose Zone Soil | LRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPPAP |
Ga0209275_105021802 | 3300027884 | Soil | LQLRRLPDMHFTLDTSQEHVERIEQLLNEMKKDKPAATSD |
Ga0209006_106358112 | 3300027908 | Forest Soil | RLQLRRLPDLHFTLDTSQEHVERIEQLLKDLKKDKPAASSD |
Ga0209583_103880062 | 3300027910 | Watersheds | VAVEPGRLLQLRRVPDLHFTLDLSQEHVERIERLLKEMKKDNPPAA |
Ga0209526_107237242 | 3300028047 | Forest Soil | QLRRVPELHFTLDLSQEHLERIERLLKEMKKDNPPAP |
Ga0302232_102309352 | 3300028789 | Palsa | LQLRRLPELHFTLDHSQEYTERIEQLLRDMNKDKPSAP |
Ga0302176_102260372 | 3300030057 | Palsa | ELIERLQLRRLPELHFILDHSQEYTERIEQLLRDMKKDKPAAP |
Ga0311357_114071031 | 3300030524 | Palsa | YIRSELIERLQLRRLPDLHFVLDHSQQHVERVEQLLKEMKKQDPATS |
Ga0170823_128967381 | 3300031128 | Forest Soil | EILERLQLRRVPDLHFSLDNSQEYTERIDQLLKEMKKDSPPTK |
Ga0318541_103321342 | 3300031545 | Soil | LQLRRVPDLHFTLDNSEEHAARIDQLLKAMKSDRSAQK |
Ga0318574_100540563 | 3300031680 | Soil | RRLPDLHFTLDLSQERVERIEQLLKEMKAEKRSKPESNP |
Ga0307476_107019641 | 3300031715 | Hardwood Forest Soil | IERLQLRRLPDLHFTLDLSQEHVERIEQLLKQVKIEKPSTSESNS |
Ga0307469_121395382 | 3300031720 | Hardwood Forest Soil | RRELIERLQLRRLPELHFTLDHSQEYTERIDQLLKEMKKDKPAAS |
Ga0307475_113384662 | 3300031754 | Hardwood Forest Soil | RLQLRRVPELHFSLDNSQEYTERIDQLLKEMKKGSPPAT |
Ga0318543_104918032 | 3300031777 | Soil | ELVERLQLRRVPELHFTLDLSQEHVERIEQLLKQVKKEKPANSD |
Ga0318552_106232471 | 3300031782 | Soil | LRRLPDLHFTLDLSQERVERIEQLLKEMKAEKRSKPESNP |
Ga0318548_102943622 | 3300031793 | Soil | DLHFTLDLSQERVERIEQLLKEMKAEKRSKPESNP |
Ga0307478_117448571 | 3300031823 | Hardwood Forest Soil | LERLQLRRVPELHFTLDNSQEYTERIDQLLKEMKKDASQTK |
Ga0306925_101977473 | 3300031890 | Soil | PDLHFTLDLSQERVERIEQLLKEMKAEKRSKPGSNP |
Ga0306923_100641591 | 3300031910 | Soil | QLRRLPDLHFTLDLSQEHMERIDQLLKRMKAGKPSSPDSKP |
Ga0306923_119271492 | 3300031910 | Soil | LQLRRLPDLHFTLDLSQERVERIEQLLKEMKAEKRPKSESNP |
Ga0307479_103110021 | 3300031962 | Hardwood Forest Soil | REMVERLQLRRTPELHFTLDLSQEYSERIEQLLKDVKKDKPAAP |
Ga0307479_107888622 | 3300031962 | Hardwood Forest Soil | IRGHQVERLQLRRVPELHFTLDLSQEHVERIERLLKEMKKDNPPAP |
Ga0307479_115884492 | 3300031962 | Hardwood Forest Soil | KHELVERLQLRRVPDLHFTLDLSQEHVERIEQLLKQMKLDKADKPEPNP |
Ga0318559_102886692 | 3300032039 | Soil | QLRRLPDLHFTLDLSQERVERIEQLLKEMKTEKRSKRESNP |
Ga0318533_102485922 | 3300032059 | Soil | LQLRRLPELHFALDLSEERLERIEQLLKEVKKDKPASKRK |
Ga0318513_103292082 | 3300032065 | Soil | LIERLQLRRLPDLHFTLDLSEERVERIEQLLKEMKAEKRSKPESNP |
Ga0306924_106059861 | 3300032076 | Soil | LRRLPDLHFTLDLSQEHMERIEQLLKQMKANHPSPKPKSDPAT |
Ga0307471_1003530651 | 3300032180 | Hardwood Forest Soil | YIRSEIIERLQLRRLPELHFTLDLSQEHVERIEQLLKEMKKDKPSSTP |
Ga0307471_1004452801 | 3300032180 | Hardwood Forest Soil | QLRRVPELHFSLDNSQEYTERIDQLLKEMKKGSPPTS |
Ga0307472_1012742211 | 3300032205 | Hardwood Forest Soil | IERLQLRRLPELHFTLDLSQEHVERIEQLLRDMKKDKPSSNL |
Ga0306920_1024104011 | 3300032261 | Soil | DLHFTLDLSQEHVERIELLLKQMKSDKPSNPSPKSDPTP |
Ga0335080_107919651 | 3300032828 | Soil | RRELVERLQLRRVPDLHFTLDLSQEHVERIEQLLKEVKKEKPATSD |
Ga0335080_113776711 | 3300032828 | Soil | LIERLQVRRLPELHFTLDVSEESALRIEQLLKEMKKDKPSAS |
Ga0335071_103577223 | 3300032897 | Soil | LQLRRLPDMHFTLDTSQEHVERIEQLLKEMKKDNPAASSD |
Ga0335076_111441972 | 3300032955 | Soil | RRLPDLHFTLDLSQEHVERIEQLLKQMKTGKPSTPEASS |
Ga0310914_1000183413 | 3300033289 | Soil | QVRRLPELHFTLDLSQEHVERIEQLLKQMKADKPSKPESNP |
Ga0371490_11603412 | 3300033561 | Peat Soil | RLQVRRVPELHFTLDLWQEHVERIERLLKEAKSAKPPKPESSL |
⦗Top⦘ |