NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026593

Metagenome / Metatranscriptome Family F026593

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026593
Family Type Metagenome / Metatranscriptome
Number of Sequences 197
Average Sequence Length 43 residues
Representative Sequence YNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF
Number of Associated Samples 152
Number of Associated Scaffolds 197

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.49 %
% of genes from short scaffolds (< 2000 bps) 94.92 %
Associated GOLD sequencing projects 138
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.695 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.706 % of family members)
Environment Ontology (ENVO) Unclassified
(39.086 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(57.360 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 197 Family Scaffolds
PF13517FG-GAP_3 12.18
PF07593UnbV_ASPIC 9.14
PF13620CarboxypepD_reg 8.63
PF01212Beta_elim_lyase 4.57
PF01799Fer2_2 3.55
PF02371Transposase_20 2.54
PF12836HHH_3 2.54
PF00106adh_short 2.03
PF01436NHL 1.52
PF12681Glyoxalase_2 1.52
PF12704MacB_PCD 1.52
PF13672PP2C_2 1.02
PF03551PadR 1.02
PF00111Fer2 1.02
PF03372Exo_endo_phos 1.02
PF00313CSD 1.02
PF02687FtsX 1.02
PF08281Sigma70_r4_2 0.51
PF00903Glyoxalase 0.51
PF00486Trans_reg_C 0.51
PF00011HSP20 0.51
PF14559TPR_19 0.51
PF028262-Hacid_dh_C 0.51
PF00589Phage_integrase 0.51
PF00355Rieske 0.51
PF00144Beta-lactamase 0.51
PF09359VTC 0.51
PF14108ABA4-like 0.51
PF13673Acetyltransf_10 0.51
PF13181TPR_8 0.51
PF01872RibD_C 0.51
PF09994DUF2235 0.51
PF09594GT87 0.51
PF02738MoCoBD_1 0.51
PF03972MmgE_PrpD 0.51
PF00202Aminotran_3 0.51
PF02823ATP-synt_DE_N 0.51
PF05190MutS_IV 0.51
PF13282DUF4070 0.51
PF08331QueG_DUF1730 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 197 Family Scaffolds
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 9.14
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 4.57
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 4.57
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 4.57
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 4.57
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 4.57
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 4.57
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 4.57
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 4.57
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 4.57
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 4.57
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 4.57
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 4.57
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 4.57
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 4.57
COG3033TryptophanaseAmino acid transport and metabolism [E] 4.57
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 4.57
COG3547TransposaseMobilome: prophages, transposons [X] 2.54
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.02
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.02
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.02
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.51
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 0.51
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.51
COG0355FoF1-type ATP synthase, epsilon subunitEnergy production and conversion [C] 0.51
COG1600Epoxyqueuosine reductase QueG (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.51
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.51
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.51
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.51
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.51
COG2367Beta-lactamase class ADefense mechanisms [V] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.70 %
UnclassifiedrootN/A20.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908009|FWIRA_GRAM18401BHLX8All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300000956|JGI10216J12902_100453521All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300000956|JGI10216J12902_103159241All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae1256Open in IMG/M
3300000956|JGI10216J12902_114045518Not Available827Open in IMG/M
3300002076|JGI24749J21850_1057615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300004020|Ga0055440_10041564All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium983Open in IMG/M
3300004463|Ga0063356_101607036Not Available968Open in IMG/M
3300004480|Ga0062592_102082272All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300004643|Ga0062591_102817703All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300005290|Ga0065712_10198669All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300005295|Ga0065707_10551524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300005330|Ga0070690_100262263All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300005332|Ga0066388_103904218All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005333|Ga0070677_10044022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1775Open in IMG/M
3300005343|Ga0070687_100676383All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005353|Ga0070669_100152962All Organisms → cellular organisms → Bacteria → Proteobacteria1787Open in IMG/M
3300005364|Ga0070673_100037021All Organisms → cellular organisms → Bacteria3714Open in IMG/M
3300005365|Ga0070688_100983969All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005436|Ga0070713_101420286All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005441|Ga0070700_101224050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300005441|Ga0070700_101967809All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300005456|Ga0070678_101923468All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300005457|Ga0070662_101227845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300005466|Ga0070685_10080959All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300005466|Ga0070685_10997958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300005466|Ga0070685_11343074All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300005529|Ga0070741_11068500All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300005536|Ga0070697_101383850All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005543|Ga0070672_101395377All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300005543|Ga0070672_101629448All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005543|Ga0070672_101780950Not Available554Open in IMG/M
3300005545|Ga0070695_100129966All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300005548|Ga0070665_102096052All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005548|Ga0070665_102536520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300005549|Ga0070704_100757143Not Available865Open in IMG/M
3300005615|Ga0070702_100031127All Organisms → cellular organisms → Bacteria2917Open in IMG/M
3300005617|Ga0068859_101027481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium906Open in IMG/M
3300005617|Ga0068859_101732294Not Available690Open in IMG/M
3300005617|Ga0068859_102380648All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria584Open in IMG/M
3300005713|Ga0066905_101624518All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005718|Ga0068866_10184481All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300005718|Ga0068866_10594901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300005719|Ga0068861_102318432All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22539Open in IMG/M
3300005764|Ga0066903_101930275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1132Open in IMG/M
3300005764|Ga0066903_104592436All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300005829|Ga0074479_10021910All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005836|Ga0074470_10431342All Organisms → cellular organisms → Bacteria → Proteobacteria3082Open in IMG/M
3300005840|Ga0068870_10505863Not Available806Open in IMG/M
3300005840|Ga0068870_10941846All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria612Open in IMG/M
3300005840|Ga0068870_11222867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300005843|Ga0068860_101058564Not Available830Open in IMG/M
3300005844|Ga0068862_100509724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1143Open in IMG/M
3300005937|Ga0081455_10088471All Organisms → cellular organisms → Bacteria2516Open in IMG/M
3300006058|Ga0075432_10195401All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300006237|Ga0097621_100765541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor → Flavonifractor plautii893Open in IMG/M
3300006237|Ga0097621_101332191All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300006237|Ga0097621_102181082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300006844|Ga0075428_101070867All Organisms → cellular organisms → Bacteria → Acidobacteria852Open in IMG/M
3300006844|Ga0075428_101985529All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300006845|Ga0075421_100510886All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300006845|Ga0075421_102551057All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006846|Ga0075430_100261005All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300006847|Ga0075431_102047180All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006876|Ga0079217_10690907Not Available684Open in IMG/M
3300006881|Ga0068865_100791600All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300006894|Ga0079215_10158483All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1092Open in IMG/M
3300006918|Ga0079216_10296330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium954Open in IMG/M
3300006918|Ga0079216_10795313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300007004|Ga0079218_11984834All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300009012|Ga0066710_104798148Not Available506Open in IMG/M
3300009036|Ga0105244_10412951All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300009053|Ga0105095_10123694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1407Open in IMG/M
3300009078|Ga0105106_10972073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales604Open in IMG/M
3300009094|Ga0111539_12562286All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae591Open in IMG/M
3300009094|Ga0111539_13086045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300009094|Ga0111539_13232344Not Available525Open in IMG/M
3300009147|Ga0114129_13159306All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300009156|Ga0111538_11502886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300009156|Ga0111538_12329554All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22672Open in IMG/M
3300009162|Ga0075423_12399588All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300009177|Ga0105248_10741626Not Available1108Open in IMG/M
3300009514|Ga0129284_10232444Not Available824Open in IMG/M
3300009551|Ga0105238_12868587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium518Open in IMG/M
3300009553|Ga0105249_12277870All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium614Open in IMG/M
3300009840|Ga0126313_11358080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300010159|Ga0099796_10551121All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300010301|Ga0134070_10226618All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300010358|Ga0126370_11441639All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300010358|Ga0126370_11884139All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300010362|Ga0126377_13482287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300010366|Ga0126379_12862192Not Available577Open in IMG/M
3300010398|Ga0126383_13387664All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300010400|Ga0134122_10948710All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300010403|Ga0134123_13050092All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300011410|Ga0137440_1050332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium796Open in IMG/M
3300011415|Ga0137325_1108744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300012212|Ga0150985_109650128Not Available573Open in IMG/M
3300012232|Ga0137435_1218999Not Available581Open in IMG/M
3300012893|Ga0157284_10194995All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300012898|Ga0157293_10313822Not Available523Open in IMG/M
3300012902|Ga0157291_10019313All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300012902|Ga0157291_10125915All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300012905|Ga0157296_10160706All Organisms → cellular organisms → Bacteria → Proteobacteria682Open in IMG/M
3300012909|Ga0157290_10235977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300012925|Ga0137419_10860063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300012948|Ga0126375_10386773All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300012948|Ga0126375_12071105Not Available505Open in IMG/M
3300012971|Ga0126369_13591936All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012989|Ga0164305_11064827Not Available692Open in IMG/M
3300013296|Ga0157374_12012582Not Available604Open in IMG/M
3300013297|Ga0157378_10273671All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300013306|Ga0163162_11398844All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300013308|Ga0157375_11696722Not Available748Open in IMG/M
3300014325|Ga0163163_11932083All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300014326|Ga0157380_10146691All Organisms → cellular organisms → Bacteria2034Open in IMG/M
3300014326|Ga0157380_12660479Not Available567Open in IMG/M
3300014969|Ga0157376_10030056All Organisms → cellular organisms → Bacteria4333Open in IMG/M
3300014969|Ga0157376_10392282Not Available1340Open in IMG/M
3300014969|Ga0157376_12767234All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300015201|Ga0173478_10473989All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300015201|Ga0173478_10808115All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300015258|Ga0180093_1033782All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300015371|Ga0132258_13438270All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1086Open in IMG/M
3300015372|Ga0132256_100439723Not Available1410Open in IMG/M
3300015374|Ga0132255_101002814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1252Open in IMG/M
3300016445|Ga0182038_11123095All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300016445|Ga0182038_11341495All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300018074|Ga0184640_10161458All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1003Open in IMG/M
3300018081|Ga0184625_10373495All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300018083|Ga0184628_10278427Not Available879Open in IMG/M
3300018432|Ga0190275_11567139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium736Open in IMG/M
3300018468|Ga0066662_12694825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300018469|Ga0190270_10911833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium897Open in IMG/M
3300018469|Ga0190270_11406091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300018469|Ga0190270_11750152All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300018469|Ga0190270_12667927All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300018476|Ga0190274_10587360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1137Open in IMG/M
3300018476|Ga0190274_10982052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300018476|Ga0190274_11353670All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300018476|Ga0190274_11678162All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300018476|Ga0190274_12599036All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300018476|Ga0190274_13657298Not Available520Open in IMG/M
3300021082|Ga0210380_10413817All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300021082|Ga0210380_10488300Not Available564Open in IMG/M
3300021332|Ga0210339_1418875Not Available612Open in IMG/M
3300022756|Ga0222622_10297859Not Available1109Open in IMG/M
3300022911|Ga0247783_1032611All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis1358Open in IMG/M
3300023102|Ga0247754_1159116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300025165|Ga0209108_10207425All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300025899|Ga0207642_10031329All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300025910|Ga0207684_11716719All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300025918|Ga0207662_10836590Not Available650Open in IMG/M
3300025923|Ga0207681_10132040All Organisms → cellular organisms → Bacteria1848Open in IMG/M
3300025923|Ga0207681_11398543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300025925|Ga0207650_10594491All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300025928|Ga0207700_11796321All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300025931|Ga0207644_10526570All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300025938|Ga0207704_11177691All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300025941|Ga0207711_10211488All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300025960|Ga0207651_11008596All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300025972|Ga0207668_10117182Not Available2010Open in IMG/M
3300025986|Ga0207658_10690761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor → Flavonifractor plautii922Open in IMG/M
3300026088|Ga0207641_11040045All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300026089|Ga0207648_10163850All Organisms → cellular organisms → Bacteria1964Open in IMG/M
3300026089|Ga0207648_10729268All Organisms → cellular organisms → Bacteria → Proteobacteria920Open in IMG/M
3300026095|Ga0207676_10503718All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300026118|Ga0207675_100199548All Organisms → cellular organisms → Bacteria → Acidobacteria1921Open in IMG/M
3300026121|Ga0207683_11663112All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300027880|Ga0209481_10247323Not Available898Open in IMG/M
3300027886|Ga0209486_10000943All Organisms → cellular organisms → Bacteria12730Open in IMG/M
3300027993|Ga0247749_1003132All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-221456Open in IMG/M
3300028047|Ga0209526_10873817All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300028380|Ga0268265_11841192All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300028380|Ga0268265_11908278Not Available601Open in IMG/M
3300028380|Ga0268265_11920365All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300028381|Ga0268264_10654563Not Available1040Open in IMG/M
3300028381|Ga0268264_11046346Not Available824Open in IMG/M
3300031152|Ga0307501_10151160Not Available631Open in IMG/M
3300031170|Ga0307498_10159102All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300031226|Ga0307497_10499336Not Available600Open in IMG/M
3300031847|Ga0310907_10843481All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300031854|Ga0310904_10302510All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300031858|Ga0310892_10708906All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300031942|Ga0310916_11163661All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300031944|Ga0310884_10637025All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031946|Ga0310910_10747754Not Available772Open in IMG/M
3300032013|Ga0310906_10128943All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300032059|Ga0318533_11345188All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300032075|Ga0310890_10047864All Organisms → cellular organisms → Bacteria2428Open in IMG/M
3300032122|Ga0310895_10691835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300032157|Ga0315912_10899678Not Available704Open in IMG/M
3300032157|Ga0315912_11627436Not Available508Open in IMG/M
3300032211|Ga0310896_10050637All Organisms → cellular organisms → Bacteria → Proteobacteria1676Open in IMG/M
3300032421|Ga0310812_10281592Not Available736Open in IMG/M
3300033004|Ga0335084_10365641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1488Open in IMG/M
3300033412|Ga0310810_11093311All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae665Open in IMG/M
3300034660|Ga0314781_108377All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.11%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.06%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.05%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.52%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.02%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.02%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.02%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.02%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.02%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.02%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.02%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.02%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.51%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.51%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.51%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.51%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.51%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.51%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.51%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.51%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.51%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.51%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.51%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908009Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002076Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3Host-AssociatedOpen in IMG/M
3300004020Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009514Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1WEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034660Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIRA_059155602124908009SoilTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF
JGI10216J12902_10045352113300000956SoilDLYNLFNANTGTAFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
JGI10216J12902_10315924133300000956SoilGFNQVFGNASTPATLGATWLRPNTILNPRYLRFNATVDF*
JGI10216J12902_11404551813300000956SoilNGNTATGYDNGFGTDGSTWLRPTAVLNPRFVRFNMTFDF*
JGI24749J21850_105761523300002076Corn, Switchgrass And Miscanthus RhizosphereYNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0055440_1004156433300004020Natural And Restored WetlandsNANTGTSFNQNFGSDGSTWLRPNGILNPRYMRFNATVDF*
Ga0063356_10160703613300004463Arabidopsis Thaliana RhizosphereDLYNLFNANTGTSFNQNFGADGSTWLRPNGILNPRYVRFNATVDF*
Ga0062592_10208227223300004480SoilNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF*
Ga0062591_10281770313300004643SoilNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0065712_1019866933300005290Miscanthus RhizosphereNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0065707_1055152423300005295Switchgrass RhizosphereRKWCVSNANPGAAFNQTFSVGSPTYLRPTTILSPRFVRFNVTIDF*
Ga0070690_10026226323300005330Switchgrass RhizosphereFNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0066388_10390421813300005332Tropical Forest SoilGQKRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0070677_1004402213300005333Miscanthus RhizosphereYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0070687_10067638323300005343Switchgrass RhizosphereFNANTGTAFNQNFGTNGATWLRPNAILNPRYARFNATVDF*
Ga0070669_10015296233300005353Switchgrass RhizosphereFNDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTVDF*
Ga0070673_10003702143300005364Switchgrass RhizosphereTGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF*
Ga0070688_10098396923300005365Switchgrass RhizosphereNLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF*
Ga0070713_10142028613300005436Corn, Switchgrass And Miscanthus RhizosphereADIYNLFNSNAGTAYNGQFGVDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0070700_10122405013300005441Corn, Switchgrass And Miscanthus RhizosphereMDLYNLFNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0070700_10196780923300005441Corn, Switchgrass And Miscanthus RhizosphereIDLYNLFNANTGTTFNQAYGTDGAAWLRPTAIMNARFVRFNATIDF*
Ga0070678_10192346813300005456Miscanthus RhizosphereLNANVGTAFNQGFGTDGALWMRPTAVLNPRFARFNVTFDF*
Ga0070662_10122784523300005457Corn RhizosphereNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0070685_1008095913300005466Switchgrass RhizosphereDLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0070685_1099795823300005466Switchgrass RhizosphereNVALDLYNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF*
Ga0070685_1134307413300005466Switchgrass RhizosphereNANTGTAFNQNFGTNGATWLRPNAILNPRYARFNATVDF*
Ga0070741_1106850013300005529Surface SoilGVDLYNLFNANTGTSFNPNWGADGSTWLRPNAILNPRYVRFNATVDF*
Ga0070697_10138385013300005536Corn, Switchgrass And Miscanthus RhizosphereALDLYNLFNANTGTAFNQAFGTDGSLFLRPTAILNPRFVRFNVTFDF*
Ga0070672_10139537713300005543Miscanthus RhizosphereFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0070672_10162944823300005543Miscanthus RhizosphereLYNVFNANTGTAFNQAFGTDGATFLRPTAILNPRFVRFNVTFDF*
Ga0070672_10178095013300005543Miscanthus RhizosphereFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATLDF*
Ga0070695_10012996633300005545Corn, Switchgrass And Miscanthus RhizosphereDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0070665_10209605223300005548Switchgrass RhizosphereANTGTTFNQAYGTDGAAWLRPTAIMNARFVRFNATIDF*
Ga0070665_10253652023300005548Switchgrass RhizosphereVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF*
Ga0070704_10075714313300005549Corn, Switchgrass And Miscanthus RhizosphereLYNLFNANTGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF*
Ga0070702_10003112743300005615Corn, Switchgrass And Miscanthus RhizosphereNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0068859_10102748113300005617Switchgrass RhizosphereKTNVALDLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0068859_10173229413300005617Switchgrass RhizosphereGFDLYNLFNANTGLFTGATTGFNPNWGADGSTYLRPNAILNPRYARFNATVDF*
Ga0068859_10238064813300005617Switchgrass RhizosphereTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0066905_10162451813300005713Tropical Forest SoilRTRAKVGIDLYNLLNSNTGTGFNQNWTGDGSTYLRPNAILNPRYVRFNATIDF*
Ga0068866_1018448133300005718Miscanthus RhizosphereNTGTTFNQAYGTDGAAWLRPTAILNARFLRFNATIDF*
Ga0068866_1059490123300005718Miscanthus RhizosphereANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF*
Ga0068861_10231843213300005719Switchgrass RhizosphereNTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVAF*
Ga0066903_10193027513300005764Tropical Forest SoilNTGTAFNQNFGLDGSTWLRPNAILNPRYVRFNATVDF*
Ga0066903_10459243613300005764Tropical Forest SoilLFNSNTGTAFNQNFGTDGSTWLRPVGILNPRYLRFNATVDF*
Ga0074479_1002191023300005829Sediment (Intertidal)VGTAFNQGFGADGATWLRPTAVLNPRFARFNVTFDF*
Ga0074470_1043134213300005836Sediment (Intertidal)NSNTGTGFNQNYGTDGSTYLRPNAILNPRYVRFNATIDF*
Ga0068870_1050586323300005840Miscanthus RhizosphereDLYNLFNANTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF*
Ga0068870_1094184613300005840Miscanthus RhizosphereDLYNMFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0068870_1122286713300005840Miscanthus RhizosphereGIDLYNVFNTNTGTTFNQNFGTDGAIYRQEVTILNPRFARFNVTVDF*
Ga0068860_10105856423300005843Switchgrass RhizosphereDLYNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF*
Ga0068862_10050972413300005844Switchgrass RhizosphereGIDLYNLFNANTGTTFNQNFGTDGSTWLRPNAILNPRYVRFNVTLDF*
Ga0081455_1008847143300005937Tabebuia Heterophylla RhizosphereGRTRAKVGIDLYNLLNSNTGTGFNQNWGADGSTYLRPNAILNPRYVRFNATIDF*
Ga0075432_1019540123300006058Populus RhizosphereDLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0097621_10076554123300006237Miscanthus RhizosphereTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0097621_10133219123300006237Miscanthus RhizosphereRTNIGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0097621_10218108223300006237Miscanthus RhizosphereNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0075428_10107086723300006844Populus RhizosphereLLNANTGTSFNQNFGRDGSTWLRPNAILNPRYVRFNATIDF*
Ga0075428_10198552923300006844Populus RhizosphereLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0075421_10051088613300006845Populus RhizosphereLFNANTGTAYNANFGIDGATWNRETAILNPRAVRLNITFNY*
Ga0075421_10255105733300006845Populus RhizosphereANTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0075430_10026100513300006846Populus RhizosphereRTNVGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0075431_10204718013300006847Populus RhizosphereNTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0079217_1069090713300006876Agricultural SoilYRANVGFDLYNLFNANTGVFTNATTGFNPNWGTDGSTYLRPNATLNPRYARFSATVDF*
Ga0068865_10079160013300006881Miscanthus RhizosphereTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0079215_1015848333300006894Agricultural SoilGFDLYNLFNANTGTSFNQNFGTDGSTWLRPNGILNPRYARFNATVDF*
Ga0079216_1029633013300006918Agricultural SoilNTGTTFSEGFGTDGSLYLREVTILNPRFVRFNVTVDF*
Ga0079216_1079531313300006918Agricultural SoilLYNLFNGNTATGYDQGFGTDGSTWLRPTAVLNPRFVRFNVTFDF*
Ga0079218_1198483423300007004Agricultural SoilNSNVGTAFNQGFGTNGATWLRPTAVLNPRFARFNVTFDF*
Ga0066710_10479814813300009012Grasslands SoilNSNAGTAYNGQFGTNGSTWNRPTAILSPRFVQFNGRFDF
Ga0105244_1041295113300009036Miscanthus RhizosphereLYNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0105095_1012369433300009053Freshwater SedimentNSGTAFDQGFGADGSTWLRPTTIMNPRFVRFNVTFDF*
Ga0105106_1097207313300009078Freshwater SedimentIDLYNLLNANTGTGFNTGFGADGATYLRPTGILNPRFARFNVTIEY*
Ga0111539_1256228613300009094Populus RhizosphereMFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0111539_1308604513300009094Populus RhizosphereNANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF*
Ga0111539_1323234423300009094Populus RhizosphereYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0114129_1315930623300009147Populus RhizosphereNANTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0111538_1150288623300009156Populus RhizosphereGLDLYNLFNANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF*
Ga0111538_1232955413300009156Populus RhizosphereIRRIRANVGFDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0075423_1239958813300009162Populus RhizosphereFRRTRANVGIDLYNVFNTNTGTTFNQNFGVDGATYRQEVTILNPRFVRFNATVDF*
Ga0105248_1074162613300009177Switchgrass RhizosphereGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF*
Ga0129284_1023244413300009514Beach Aquifer PorewaterIYNLFNANTPTAFNEGFGTDGTGWLTPTGILNPRFVRFNITIDY*
Ga0105238_1286858713300009551Corn RhizosphereRTNIGIDLYNLFNANTGTAFNQAFGTDGSTWLRPTTVLNPRFLRLNVTFDF*
Ga0105249_1227787013300009553Switchgrass RhizosphereTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0126313_1135808033300009840Serpentine SoilYNLFNANTTTGYNTAYGADGSAWLNPTAILNPRFVRFNVRFDF*
Ga0099796_1055112123300010159Vadose Zone SoilLYNIFNSSNGTAFNQSFGFDGSTWLRPTAILNPRAVRFNLTFNY*
Ga0134070_1022661823300010301Grasslands SoilTGTGFNQSFGTDGATWLRPTTILNPRFVRFNVTMDF*
Ga0126370_1144163913300010358Tropical Forest SoilNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0126370_1188413923300010358Tropical Forest SoilFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0126377_1348228713300010362Tropical Forest SoilTAYNQAFGTDGSTWLRPTSVLNPRFVRFNVTFDF*
Ga0126379_1286219213300010366Tropical Forest SoilGVDLYNLFNANTGITFNPNYGVDGSTWLRPNAILNPRYLRFNATVDF*
Ga0126383_1338766413300010398Tropical Forest SoilGRKRVILGADVYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0134122_1094871013300010400Terrestrial SoilDLYNLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTLDF*
Ga0134123_1305009223300010403Terrestrial SoilDLYNVFNSNTGTTFNGNFGNDGSTWLRPTAILNARFVRCNVTVNF*
Ga0137440_105033213300011410SoilAGTAFNQNFGTNGATWLRPNGILNPRYARFNATVDF*
Ga0137325_110874423300011415SoilTRTNVGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF*
Ga0150985_10965012813300012212Avena Fatua RhizosphereGTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0137435_121899923300012232SoilFDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0157284_1019499523300012893SoilDLYNVFNTNTGTTFNQNFGTDGATYRQEVTLLNPRFLRFNVTVDF*
Ga0157293_1031382223300012898SoilFNTNVGTVFNTNYGADGATWLRPTAIYTPRFLRFNVTFNY*
Ga0157291_1001931313300012902SoilLLNSNVGTAFNQAFGNDGATWLRPTVVLNPRFARFNVTFDF*
Ga0157291_1012591513300012902SoilGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0157296_1016070623300012905SoilANTGTTFQQTYDPLNNGATWLRPTAILNPRFVRFNATVDF*
Ga0157290_1023597723300012909SoilRTNVALDLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0137419_1086006313300012925Vadose Zone SoilNANTGTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0126375_1038677323300012948Tropical Forest SoilLNSNTGTGFNQNWTGDGSTYLRPNAILNPRYVRFNATIDF*
Ga0126375_1207110523300012948Tropical Forest SoilGVDLYNLFNANTGTTFNQNFGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0126369_1359193613300012971Tropical Forest SoilNANTGTSFNQNFGIDGSAWLRPNAILNPRYVRFNATVDF*
Ga0164305_1106482713300012989SoilLFNANTGTTFNQAYGTDGAAWLRPTAILNARFMRFNVTIDF*
Ga0157374_1201258213300013296Miscanthus RhizosphereLFNANTGTVFNEVFGSDGVRWLRPTSILNARFLRFNVTLDF*
Ga0157378_1027367113300013297Miscanthus RhizosphereLYNMLNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF*
Ga0163162_1139884423300013306Switchgrass RhizosphereLDLYNLFNANTGSTFNQNFGGDGATYRQEQTVLNPRFVRFNITVDF*
Ga0157375_1169672223300013308Miscanthus RhizosphereFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF*
Ga0163163_1193208323300014325Switchgrass RhizosphereRTNIGIDLYNLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF*
Ga0157380_1014669113300014326Switchgrass RhizosphereNTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0157380_1266047913300014326Switchgrass RhizosphereLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0157376_1003005613300014969Miscanthus RhizosphereVGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0157376_1039228213300014969Miscanthus RhizosphereRTNIGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNSILNPRYLRFNATVDF*
Ga0157376_1276723413300014969Miscanthus RhizosphereVGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATLDF*
Ga0173478_1047398913300015201SoilNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0173478_1080811523300015201SoilYNMFNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF*
Ga0180093_103378213300015258SoilNTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF*
Ga0132258_1343827013300015371Arabidopsis RhizosphereNLFNSNVGTAFNQGFGTDGLLWLRPTAVLNPRFARFNVTFDF*
Ga0132256_10043972313300015372Arabidopsis RhizosphereIGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0132255_10100281413300015374Arabidopsis RhizosphereLDLYNLFNANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF*
Ga0182038_1112309513300016445SoilMGQKRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF
Ga0182038_1134149523300016445SoilFNSNTGTAFNQAFGTDGSTWLRPTSILNPRFVRFNVTFDF
Ga0184640_1016145833300018074Groundwater SedimentDLYNLFNSNTGTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF
Ga0184625_1037349513300018081Groundwater SedimentTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0184628_1027842713300018083Groundwater SedimentNTNVGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY
Ga0190275_1156713913300018432SoilYNLFNANTATTYDQGFTGDGSGWLRPTAVLNPRFVRFNLTFDF
Ga0066662_1269482523300018468Grasslands SoilLYNLFNANPGTAFNQTFSAGSPTYLRPTTILNPRFVRFNVTVDF
Ga0190270_1091183313300018469SoilGTTFNQAFGTDGTTWLRPTAVMSPRFVRFNVTMDF
Ga0190270_1140609113300018469SoilNVGTAFNQAFGNDGATWLRPTAVLNPRFARFNVTFDF
Ga0190270_1175015223300018469SoilGVDLYNLFNSNTGTTFNQNFGTDGSAWLRPNAILNPRYVRFNATVDF
Ga0190270_1266792713300018469SoilRTNVGLDLFNLFNANTGTAFNQAFGGDGATWLRPTTILNPRFLRFNVTFDF
Ga0190274_1058736023300018476SoilFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0190274_1098205213300018476SoilLNSNVGTAFNQAFGNDGATWLRPTAVLNPRFARFNVTFDF
Ga0190274_1135367013300018476SoilGTTFNQNFGTDGSTWLRPNAILNPRYVRFNVTLDF
Ga0190274_1167816213300018476SoilIGVDLYNLLNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF
Ga0190274_1259903613300018476SoilLYNIFNSNTGTTFNQGYGVDGSTYLRPLTILNPRFLRFNVTVDF
Ga0190274_1365729813300018476SoilFNTNTGTTFNQNFGTDGATYRQEVTLLNPRFLRFNVTVDF
Ga0210380_1041381723300021082Groundwater SedimentGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF
Ga0210380_1048830023300021082Groundwater SedimentDAYNVFNTNVGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY
Ga0210339_141887513300021332EstuarineANTGTAFNQVFGTNGAAWLRPNAILNPRYVRFNATIDF
Ga0222622_1029785923300022756Groundwater SedimentNLFNANPGTAFLQNFSVTNPTYLRPTTVLRPRFVRFNVTVDF
Ga0247783_103261113300022911Plant LitterLYNLFNDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTMDF
Ga0247754_115911623300023102SoilNDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTMDF
Ga0209108_1020742513300025165SoilLYNLFNANAGLTFQPAYGDGSGWLAPQTYLNARFVRFNATFDF
Ga0207642_1003132933300025899Miscanthus RhizosphereNTGTTFNQAYGTDGAAWLRPTAILNARFLRFNATIDF
Ga0207684_1171671923300025910Corn, Switchgrass And Miscanthus RhizosphereLYNLFNANTGTAFNQAFGTDGSLFLRPTAILNPRFVRFNVTFDF
Ga0207662_1083659013300025918Switchgrass RhizosphereSNTGTAFSQTFPAPPASDATFLRPTAILNPRFVRFNVTFDF
Ga0207681_1013204013300025923Switchgrass RhizosphereMDLYNMFNSNVGTAFNQGFGADGALWLRPTAVLNPRFARFNVTFDF
Ga0207681_1139854313300025923Switchgrass RhizosphereNTRTNVGIDLYNIFNTNTGTAFNQNFGVDGAQYLQEQTILNPRFLRFNVTFDF
Ga0207650_1059449113300025925Switchgrass RhizosphereVAIDLYNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF
Ga0207700_1179632123300025928Corn, Switchgrass And Miscanthus RhizosphereADIYNLFNSNAGTAYNGQFGVDGSTWNRPTAILNPRFVQFNGRFDF
Ga0207644_1052657033300025931Switchgrass RhizosphereVGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY
Ga0207704_1117769123300025938Miscanthus RhizosphereQTNVGLDLYNMFNSNTGTSFNQGYGTDGALYLRPLTILNPRFLRFNVTFDF
Ga0207711_1021148813300025941Switchgrass RhizosphereLYNLFNANPGTAFNQMFSVGSPTYLRPTTILRPRFVRFNVTVDF
Ga0207651_1100859613300025960Switchgrass RhizosphereNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF
Ga0207668_1011718213300025972Switchgrass RhizosphereNTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF
Ga0207658_1069076113300025986Switchgrass RhizosphereANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF
Ga0207641_1104004523300026088Switchgrass RhizosphereGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF
Ga0207648_1016385033300026089Miscanthus RhizosphereNTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0207648_1072926813300026089Miscanthus RhizosphereANTGTTFQQTYDPLNNGATWLRPTAILNPRFVRFNATVDF
Ga0207676_1050371823300026095Switchgrass RhizosphereMDLYNLFNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF
Ga0207675_10019954833300026118Switchgrass RhizosphereYNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF
Ga0207683_1166311213300026121Miscanthus RhizosphereTNIGIDLYNMLNANVGTAFNQGFGTDGALWMRPTAVLNPRFARFNVTFDF
Ga0209481_1024732313300027880Populus RhizosphereRSLNLFNTNTGTSFNENFGTDGSTWLRPNAILNPRYVRFNATVDF
Ga0209486_1000094313300027886Agricultural SoilTGTSFNQNFGTDGSTWLRPNGILNPRYARFNATVDF
Ga0247749_100313213300027993SoilVGFDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF
Ga0209526_1087381713300028047Forest SoilVDLYNLFNANTGITFNPNFGADGSTWLRPNAILNPRYLRFNATVDF
Ga0268265_1184119223300028380Switchgrass RhizosphereNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF
Ga0268265_1190827813300028380Switchgrass RhizosphereTGTTFNQNFGTDGATYLRPNAILNPRYVRFNATIDF
Ga0268265_1192036513300028380Switchgrass RhizosphereLYNLFNANTGLFTGATTGFNPNWGADGSTYLRPNAILNPRYARFNATVDF
Ga0268264_1065456313300028381Switchgrass RhizosphereLDLYNLFNANTGTAFNQAFGTDGTTFLRPTAILNPRFVRFNVTFDF
Ga0268264_1104634613300028381Switchgrass RhizosphereNLFNANTGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF
Ga0307501_1015116013300031152SoilNLFNANPGTAFNQNFTAESTTYLRPTTILRPRFVRINATVDF
Ga0307498_1015910213300031170SoilNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF
Ga0307497_1049933613300031226SoilVSKILNLWHTRTNIGIDFYNLNNANTGTSFNQSYGVDGAQYLRPLTVLNPRFMRFNVTVD
Ga0310907_1084348123300031847SoilMFNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF
Ga0310904_1030251013300031854SoilNTNTGTAFNQNFGVDGAQYLQEQTILNPRFLRFNVTFDF
Ga0310892_1070890623300031858SoilSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF
Ga0310916_1116366123300031942SoilKRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF
Ga0310884_1063702523300031944SoilRTNVGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF
Ga0310910_1074775413300031946SoilLAKVLKLGRAKSTVGFDLYNIFNVNPGTAFNQTFSVGNPTYLRPTAILNPRFVRLNVTVD
Ga0310906_1012894313300032013SoilMFNSNVGTAFNQAFGTDGATWMRPTAVLNPRFARFNVTFDF
Ga0318533_1134518823300032059SoilAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF
Ga0310890_1004786443300032075SoilDLYNMFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0310895_1069183513300032122SoilVGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF
Ga0315912_1089967813300032157SoilVDLYNLFNANTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF
Ga0315912_1162743623300032157SoilYNLFNANTGTSFNQNFGRDGSTWLRPNAILNPRYVRFNATIDF
Ga0310896_1005063713300032211SoilNMFNANTETTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0310812_1028159223300032421SoilVDLYNLFNANTGTTFNQNFGTDGATYLRPNAILNPRYVRFNATIDF
Ga0335084_1036564123300033004SoilNSNVGTAFNQAFGTDGSTWLRPTAVLNPRFVRFNVTVDF
Ga0310810_1109331123300033412SoilVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF
Ga0314781_108377_440_5653300034660SoilLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.