Basic Information | |
---|---|
Family ID | F026551 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 197 |
Average Sequence Length | 40 residues |
Representative Sequence | MAKVKSTDSRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGK |
Number of Associated Samples | 146 |
Number of Associated Scaffolds | 197 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 16.75 % |
% of genes near scaffold ends (potentially truncated) | 16.75 % |
% of genes from short scaffolds (< 2000 bps) | 60.41 % |
Associated GOLD sequencing projects | 135 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.883 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (10.660 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.223 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.822 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 0.00% Coil/Unstructured: 95.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 197 Family Scaffolds |
---|---|---|
PF00182 | Glyco_hydro_19 | 9.64 |
PF00436 | SSB | 7.11 |
PF00166 | Cpn10 | 3.55 |
PF03796 | DnaB_C | 2.54 |
PF13539 | Peptidase_M15_4 | 2.54 |
PF00534 | Glycos_transf_1 | 2.03 |
PF08291 | Peptidase_M15_3 | 2.03 |
PF08299 | Bac_DnaA_C | 1.52 |
PF01541 | GIY-YIG | 1.02 |
PF00081 | Sod_Fe_N | 1.02 |
PF04851 | ResIII | 1.02 |
PF01520 | Amidase_3 | 1.02 |
PF07728 | AAA_5 | 1.02 |
PF13482 | RNase_H_2 | 1.02 |
PF03167 | UDG | 1.02 |
PF07460 | NUMOD3 | 1.02 |
PF02777 | Sod_Fe_C | 1.02 |
PF12838 | Fer4_7 | 1.02 |
PF01510 | Amidase_2 | 1.02 |
PF07603 | DUF1566 | 0.51 |
PF04984 | Phage_sheath_1 | 0.51 |
PF00149 | Metallophos | 0.51 |
PF13426 | PAS_9 | 0.51 |
PF00583 | Acetyltransf_1 | 0.51 |
PF04860 | Phage_portal | 0.51 |
PF13589 | HATPase_c_3 | 0.51 |
PF14550 | Peptidase_S78_2 | 0.51 |
PF00959 | Phage_lysozyme | 0.51 |
PF04480 | DUF559 | 0.51 |
PF03237 | Terminase_6N | 0.51 |
PF00271 | Helicase_C | 0.51 |
PF09374 | PG_binding_3 | 0.51 |
PF03692 | CxxCxxCC | 0.51 |
PF01075 | Glyco_transf_9 | 0.51 |
PF01183 | Glyco_hydro_25 | 0.51 |
PF05766 | NinG | 0.51 |
PF01653 | DNA_ligase_aden | 0.51 |
PF00692 | dUTPase | 0.51 |
PF12957 | DUF3846 | 0.51 |
PF05257 | CHAP | 0.51 |
PF13479 | AAA_24 | 0.51 |
PF14902 | DUF4494 | 0.51 |
COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
---|---|---|---|
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 9.64 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 9.64 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 7.11 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 7.11 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 3.55 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 2.54 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 2.54 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 2.03 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.52 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.02 |
COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 1.02 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.02 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.02 |
COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.51 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.51 |
COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.51 |
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.51 |
COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.88 % |
All Organisms | root | All Organisms | 41.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000439|TBL_comb48_EPIDRAFT_1000012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 132374 | Open in IMG/M |
3300000882|FwDRAFT_10014802 | All Organisms → cellular organisms → Bacteria | 8517 | Open in IMG/M |
3300000882|FwDRAFT_10217095 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300001275|B570J13894_1020711 | Not Available | 621 | Open in IMG/M |
3300001838|RCM33_1093706 | Not Available | 502 | Open in IMG/M |
3300001839|RCM40_1045144 | Not Available | 806 | Open in IMG/M |
3300001847|RCM41_1136803 | Not Available | 748 | Open in IMG/M |
3300001848|RCM47_1051387 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300001851|RCM31_10103288 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300001968|GOS2236_1030644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctEw721 | 848 | Open in IMG/M |
3300002092|JGI24218J26658_1014976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
3300002098|JGI24219J26650_1005372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2613 | Open in IMG/M |
3300002161|JGI24766J26685_10030466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
3300002408|B570J29032_109930943 | Not Available | 3067 | Open in IMG/M |
3300002835|B570J40625_100892083 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 771 | Open in IMG/M |
3300002835|B570J40625_100969729 | Not Available | 729 | Open in IMG/M |
3300003808|Ga0007844_1000006 | All Organisms → cellular organisms → Bacteria | 23952 | Open in IMG/M |
3300003815|Ga0007856_1000105 | Not Available | 9291 | Open in IMG/M |
3300003852|Ga0031655_10005776 | Not Available | 6689 | Open in IMG/M |
3300003859|Ga0031653_10117742 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300004461|Ga0066223_1295133 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300004481|Ga0069718_15655823 | Not Available | 698 | Open in IMG/M |
3300004771|Ga0007797_1157841 | Not Available | 577 | Open in IMG/M |
3300004774|Ga0007794_10104886 | Not Available | 843 | Open in IMG/M |
3300005527|Ga0068876_10000338 | All Organisms → cellular organisms → Bacteria | 37499 | Open in IMG/M |
3300005581|Ga0049081_10000756 | All Organisms → cellular organisms → Bacteria | 12301 | Open in IMG/M |
3300005581|Ga0049081_10006829 | All Organisms → cellular organisms → Bacteria | 4316 | Open in IMG/M |
3300005581|Ga0049081_10119714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 974 | Open in IMG/M |
3300005585|Ga0049084_10219316 | Not Available | 645 | Open in IMG/M |
3300005662|Ga0078894_10457802 | Not Available | 1149 | Open in IMG/M |
3300005805|Ga0079957_1000906 | All Organisms → cellular organisms → Bacteria | 27114 | Open in IMG/M |
3300005805|Ga0079957_1001911 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52 | 18728 | Open in IMG/M |
3300005805|Ga0079957_1017027 | Not Available | 5202 | Open in IMG/M |
3300005805|Ga0079957_1027846 | Not Available | 3793 | Open in IMG/M |
3300005805|Ga0079957_1287134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 746 | Open in IMG/M |
3300006103|Ga0007813_1042190 | Not Available | 968 | Open in IMG/M |
3300006484|Ga0070744_10209744 | Not Available | 553 | Open in IMG/M |
3300006639|Ga0079301_1154628 | Not Available | 676 | Open in IMG/M |
3300006802|Ga0070749_10006110 | All Organisms → cellular organisms → Bacteria | 7908 | Open in IMG/M |
3300006805|Ga0075464_10733212 | Not Available | 612 | Open in IMG/M |
3300006875|Ga0075473_10071993 | Not Available | 1352 | Open in IMG/M |
3300006875|Ga0075473_10290064 | Not Available | 662 | Open in IMG/M |
3300007165|Ga0079302_1081012 | Not Available | 697 | Open in IMG/M |
3300007538|Ga0099851_1226111 | Not Available | 675 | Open in IMG/M |
3300007548|Ga0102877_1041116 | Not Available | 1344 | Open in IMG/M |
3300007553|Ga0102819_1043954 | Not Available | 755 | Open in IMG/M |
3300007559|Ga0102828_1058073 | Not Available | 907 | Open in IMG/M |
3300007559|Ga0102828_1158897 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300007562|Ga0102915_1005808 | All Organisms → Viruses → Predicted Viral | 4120 | Open in IMG/M |
3300007624|Ga0102878_1223561 | Not Available | 536 | Open in IMG/M |
3300007625|Ga0102870_1130352 | Not Available | 727 | Open in IMG/M |
3300007735|Ga0104988_10792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29589 | Open in IMG/M |
3300007973|Ga0105746_1010501 | All Organisms → Viruses → Predicted Viral | 2628 | Open in IMG/M |
3300007974|Ga0105747_1064517 | Not Available | 1100 | Open in IMG/M |
3300007974|Ga0105747_1074767 | Not Available | 1031 | Open in IMG/M |
3300007992|Ga0105748_10058677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin419 | 1498 | Open in IMG/M |
3300007992|Ga0105748_10148108 | Not Available | 961 | Open in IMG/M |
3300008107|Ga0114340_1095078 | Not Available | 1202 | Open in IMG/M |
3300008108|Ga0114341_10366323 | Not Available | 716 | Open in IMG/M |
3300008110|Ga0114343_1007626 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 5510 | Open in IMG/M |
3300008113|Ga0114346_1204893 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300008116|Ga0114350_1003002 | Not Available | 10800 | Open in IMG/M |
3300008267|Ga0114364_1000177 | Not Available | 41376 | Open in IMG/M |
3300008267|Ga0114364_1009613 | All Organisms → cellular organisms → Bacteria | 5201 | Open in IMG/M |
3300008267|Ga0114364_1026483 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2324 | Open in IMG/M |
3300008450|Ga0114880_1029901 | Not Available | 2442 | Open in IMG/M |
3300008450|Ga0114880_1041178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2004 | Open in IMG/M |
3300008450|Ga0114880_1164130 | Not Available | 784 | Open in IMG/M |
3300008999|Ga0102816_1021982 | Not Available | 1842 | Open in IMG/M |
3300009037|Ga0105093_10023173 | Not Available | 2641 | Open in IMG/M |
3300009050|Ga0102909_1091285 | Not Available | 741 | Open in IMG/M |
3300009068|Ga0114973_10001587 | Not Available | 16815 | Open in IMG/M |
3300009075|Ga0105090_10455327 | Not Available | 779 | Open in IMG/M |
3300009081|Ga0105098_10432314 | Not Available | 659 | Open in IMG/M |
3300009085|Ga0105103_10078100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1699 | Open in IMG/M |
3300009085|Ga0105103_10194171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
3300009085|Ga0105103_10383382 | Not Available | 776 | Open in IMG/M |
3300009151|Ga0114962_10000019 | Not Available | 124635 | Open in IMG/M |
3300009151|Ga0114962_10000549 | Not Available | 33459 | Open in IMG/M |
3300009151|Ga0114962_10133190 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1510 | Open in IMG/M |
3300009151|Ga0114962_10656558 | Not Available | 539 | Open in IMG/M |
3300009157|Ga0105092_10150796 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
3300009159|Ga0114978_10031946 | All Organisms → cellular organisms → Bacteria | 3753 | Open in IMG/M |
3300009163|Ga0114970_10000123 | All Organisms → cellular organisms → Bacteria | 50206 | Open in IMG/M |
3300009165|Ga0105102_10011613 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3385 | Open in IMG/M |
3300009165|Ga0105102_10403375 | Not Available | 727 | Open in IMG/M |
3300009169|Ga0105097_10606715 | Not Available | 616 | Open in IMG/M |
3300009183|Ga0114974_10008175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7666 | Open in IMG/M |
3300010157|Ga0114964_10001329 | All Organisms → cellular organisms → Bacteria | 18043 | Open in IMG/M |
3300010157|Ga0114964_10022166 | Not Available | 3611 | Open in IMG/M |
3300010158|Ga0114960_10523304 | Not Available | 567 | Open in IMG/M |
3300010354|Ga0129333_10013532 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52 | 7744 | Open in IMG/M |
3300010354|Ga0129333_10038318 | Not Available | 4524 | Open in IMG/M |
3300010354|Ga0129333_10223697 | Not Available | 1706 | Open in IMG/M |
3300010354|Ga0129333_10284393 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-52 | 1483 | Open in IMG/M |
3300010354|Ga0129333_10321895 | Not Available | 1380 | Open in IMG/M |
3300010354|Ga0129333_10799334 | Not Available | 804 | Open in IMG/M |
3300010354|Ga0129333_10845083 | Not Available | 778 | Open in IMG/M |
3300010885|Ga0133913_10326761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4061 | Open in IMG/M |
3300010885|Ga0133913_10514971 | Not Available | 3151 | Open in IMG/M |
3300010885|Ga0133913_11493905 | Not Available | 1712 | Open in IMG/M |
3300012017|Ga0153801_1051852 | Not Available | 722 | Open in IMG/M |
3300012017|Ga0153801_1054307 | Not Available | 704 | Open in IMG/M |
3300013004|Ga0164293_10130497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1891 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10380311 | Not Available | 909 | Open in IMG/M |
3300013372|Ga0177922_10811168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10286363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10602489 | Not Available | 602 | Open in IMG/M |
3300017754|Ga0181344_1010451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2982 | Open in IMG/M |
3300017766|Ga0181343_1107481 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300018775|Ga0188848_1005482 | Not Available | 1428 | Open in IMG/M |
3300019784|Ga0181359_1118119 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 952 | Open in IMG/M |
3300019784|Ga0181359_1120968 | Not Available | 936 | Open in IMG/M |
3300020084|Ga0194110_10750039 | Not Available | 598 | Open in IMG/M |
3300020141|Ga0211732_1414108 | Not Available | 4308 | Open in IMG/M |
3300020151|Ga0211736_10187574 | Not Available | 1389 | Open in IMG/M |
3300020151|Ga0211736_10498217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5850 | Open in IMG/M |
3300020151|Ga0211736_10839808 | Not Available | 12575 | Open in IMG/M |
3300020159|Ga0211734_11317042 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 775 | Open in IMG/M |
3300020161|Ga0211726_10345265 | Not Available | 641 | Open in IMG/M |
3300020161|Ga0211726_10865263 | Not Available | 802 | Open in IMG/M |
3300020164|Ga0194037_1175341 | Not Available | 699 | Open in IMG/M |
3300020205|Ga0211731_11525948 | Not Available | 826 | Open in IMG/M |
3300020222|Ga0194125_10711464 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 584 | Open in IMG/M |
3300020229|Ga0194042_1143763 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Taibaiella → Taibaiella soli | 643 | Open in IMG/M |
3300020512|Ga0207936_1002083 | All Organisms → Viruses | 3965 | Open in IMG/M |
3300020518|Ga0208721_1027386 | Not Available | 709 | Open in IMG/M |
3300020563|Ga0208082_1030389 | Not Available | 1034 | Open in IMG/M |
3300020731|Ga0214170_1000216 | All Organisms → cellular organisms → Bacteria | 24266 | Open in IMG/M |
3300021079|Ga0194055_10003411 | Not Available | 12203 | Open in IMG/M |
3300021131|Ga0214206_1008837 | Not Available | 1501 | Open in IMG/M |
3300021142|Ga0214192_1009921 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3906 | Open in IMG/M |
3300021354|Ga0194047_10000162 | Not Available | 46996 | Open in IMG/M |
3300021961|Ga0222714_10023858 | All Organisms → cellular organisms → Bacteria | 4704 | Open in IMG/M |
3300022179|Ga0181353_1018521 | Not Available | 1818 | Open in IMG/M |
3300022179|Ga0181353_1041333 | Not Available | 1218 | Open in IMG/M |
3300022407|Ga0181351_1164864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300022407|Ga0181351_1275328 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300022752|Ga0214917_10198274 | Not Available | 993 | Open in IMG/M |
3300023184|Ga0214919_10052369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3887 | Open in IMG/M |
3300024346|Ga0244775_10119519 | Not Available | 2234 | Open in IMG/M |
3300024346|Ga0244775_11203100 | Not Available | 590 | Open in IMG/M |
3300024346|Ga0244775_11278032 | Not Available | 569 | Open in IMG/M |
3300025896|Ga0208916_10306118 | Not Available | 692 | Open in IMG/M |
3300027186|Ga0208797_1037120 | Not Available | 628 | Open in IMG/M |
3300027244|Ga0208173_1072655 | Not Available | 593 | Open in IMG/M |
3300027659|Ga0208975_1003026 | All Organisms → cellular organisms → Bacteria | 6500 | Open in IMG/M |
3300027659|Ga0208975_1033282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1637 | Open in IMG/M |
3300027693|Ga0209704_1221744 | Not Available | 552 | Open in IMG/M |
3300027708|Ga0209188_1000167 | Not Available | 73524 | Open in IMG/M |
3300027710|Ga0209599_10060895 | Not Available | 992 | Open in IMG/M |
3300027736|Ga0209190_1000102 | All Organisms → cellular organisms → Bacteria | 55992 | Open in IMG/M |
3300027743|Ga0209593_10004820 | Not Available | 5626 | Open in IMG/M |
3300027747|Ga0209189_1000038 | Not Available | 124552 | Open in IMG/M |
3300027759|Ga0209296_1046321 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2295 | Open in IMG/M |
3300027763|Ga0209088_10084729 | Not Available | 1477 | Open in IMG/M |
3300027782|Ga0209500_10009846 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5937 | Open in IMG/M |
3300027793|Ga0209972_10044375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 2464 | Open in IMG/M |
3300027805|Ga0209229_10072055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1549 | Open in IMG/M |
3300027805|Ga0209229_10221330 | Not Available | 845 | Open in IMG/M |
3300027816|Ga0209990_10000038 | All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota | 126638 | Open in IMG/M |
3300027900|Ga0209253_10154241 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium | 1858 | Open in IMG/M |
3300027900|Ga0209253_10233934 | Not Available | 1453 | Open in IMG/M |
3300027972|Ga0209079_10052962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
3300028025|Ga0247723_1003471 | All Organisms → cellular organisms → Bacteria | 7847 | Open in IMG/M |
3300028392|Ga0304729_1111989 | Not Available | 917 | Open in IMG/M |
3300031746|Ga0315293_10031905 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 4646 | Open in IMG/M |
3300031758|Ga0315907_10593658 | Not Available | 860 | Open in IMG/M |
3300031784|Ga0315899_10612835 | Not Available | 1025 | Open in IMG/M |
3300031787|Ga0315900_10580302 | Not Available | 826 | Open in IMG/M |
3300031857|Ga0315909_10478606 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 867 | Open in IMG/M |
3300031952|Ga0315294_10407742 | Not Available | 1270 | Open in IMG/M |
3300031952|Ga0315294_10824777 | Not Available | 796 | Open in IMG/M |
3300032053|Ga0315284_10086827 | All Organisms → Viruses → Predicted Viral | 4215 | Open in IMG/M |
3300032053|Ga0315284_10858832 | Not Available | 1042 | Open in IMG/M |
3300032053|Ga0315284_10971218 | Not Available | 961 | Open in IMG/M |
3300032516|Ga0315273_10216455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2616 | Open in IMG/M |
3300033978|Ga0334977_0011232 | Not Available | 5109 | Open in IMG/M |
3300033980|Ga0334981_0002956 | All Organisms → cellular organisms → Bacteria | 10794 | Open in IMG/M |
3300033981|Ga0334982_0000351 | All Organisms → cellular organisms → Bacteria | 28321 | Open in IMG/M |
3300034012|Ga0334986_0317313 | Not Available | 820 | Open in IMG/M |
3300034018|Ga0334985_0037675 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 3655 | Open in IMG/M |
3300034061|Ga0334987_0108940 | Not Available | 2112 | Open in IMG/M |
3300034061|Ga0334987_0369556 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 921 | Open in IMG/M |
3300034104|Ga0335031_0158180 | Not Available | 1562 | Open in IMG/M |
3300034116|Ga0335068_0070149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2011 | Open in IMG/M |
3300034118|Ga0335053_0017026 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5261 | Open in IMG/M |
3300034118|Ga0335053_0369904 | Not Available | 878 | Open in IMG/M |
3300034272|Ga0335049_0571531 | Not Available | 706 | Open in IMG/M |
3300034279|Ga0335052_0048348 | Not Available | 2632 | Open in IMG/M |
3300034355|Ga0335039_0473377 | Not Available | 632 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.66% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.66% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.61% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.60% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.09% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.58% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.57% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.06% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.06% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.55% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.55% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.05% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.05% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.54% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.54% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 2.54% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.54% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.54% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.03% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.03% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.03% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.52% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.52% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.02% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 1.02% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.51% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.51% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.51% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.51% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.51% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003808 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07 | Environmental | Open in IMG/M |
3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300020229 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-12m | Environmental | Open in IMG/M |
3300020512 | Freshwater microbial communities from Lake Mendota, WI - 19NOV2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020518 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TBL_comb48_EPIDRAFT_1000012109 | 3300000439 | Freshwater | MAKGSVTNANKVTFGSRKGGKAKKSSGPKDKKVSKYIGQGK* |
FwDRAFT_1001480216 | 3300000882 | Freshwater And Marine | MAKVTGNSTKLSFGKRKGGKAQKTQGPKQKSVSKYRGQGK* |
FwDRAFT_102170952 | 3300000882 | Freshwater And Marine | MSKGKSLGATKVTFGKRKGGKAVKSRSPKDKKVSKYKGQGR* |
B570J13894_10207111 | 3300001275 | Freshwater | MAKSKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK* |
RCM33_10937062 | 3300001838 | Marine Plankton | MAKKQGKTGTAAGIKISFGVRKGGKHKKFRGPKEKMVSKYRGQGR* |
RCM40_10451442 | 3300001839 | Marine Plankton | MAKSKAADSKKISFGKRKGGKAAKTKGPKDKAVSKYRGQGK*LSL* |
RCM41_11368032 | 3300001847 | Marine Plankton | SVGNSTKLSFGKRKSGKARKSRSPKDKNVSKYRGQGK* |
RCM47_10513872 | 3300001848 | Marine Plankton | MAKSVGNSTKLSFGKRKSGKARKSRSPKDKNVSKYRGQGK* |
RCM31_101032881 | 3300001851 | Marine Plankton | MAKATRGEARKVTFGKRKKGKAAKFKGPKDKPVSKYRGQGR* |
GOS2236_10306442 | 3300001968 | Marine | MAKPKGSADKKKITFGTRKGGKPRKSRGPKDKGVSKYQGQGR* |
JGI24218J26658_10149761 | 3300002092 | Lentic | KSANSNKITFGKRKGGKARKTSGPKDKNKKPNVGQGH* |
JGI24219J26650_10053721 | 3300002098 | Lentic | MAKAKAISSTKLTFGKRKGGRAQKRSGPKDKPVSKYIGQGK* |
JGI24766J26685_100304663 | 3300002161 | Freshwater And Sediment | MAGKVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR* |
B570J29032_1099309433 | 3300002408 | Freshwater | MAKSVNSNKLTFGKRKGGKAKKTSGPKDAPTKIYRGQGKKH* |
B570J40625_1008920832 | 3300002835 | Freshwater | KVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR* |
B570J40625_1009697291 | 3300002835 | Freshwater | MAKITNANKVSFGKRKGGKASKSRGPKDKRVSKYIGQGK* |
Ga0007844_100000612 | 3300003808 | Freshwater | MAKAVGNTRKLTFGKRKGGKAKKSSGPKDKKVSKYRSQGR* |
Ga0007856_10001059 | 3300003815 | Freshwater | MAGKKSSADNRKVTFGKRXRGKASKTKGPKDKPVKQYQGQGR* |
Ga0031655_100057767 | 3300003852 | Freshwater Lake Sediment | MAKSKSTDSRKISFGKRKGGKAAKTSGPKDKPVKKYRGQGK* |
Ga0031653_101177422 | 3300003859 | Freshwater Lake Sediment | MAKATTTSNKINFGKRKGGKYKKSSGPKDKNVSRYRGQGK* |
Ga0066223_12951332 | 3300004461 | Marine | MAKVLGNSTKLSFGKRKGGKAKNSKSPKEKNVSQYKGQGK* |
Ga0069718_156558232 | 3300004481 | Sediment | MAKGKGSSDRQKISFGKRKGGKAAKTSGPKDKNKKAYRGQGK* |
Ga0007797_11578412 | 3300004771 | Freshwater | MAKAASSVKKISFGKRKGGKASKTKGPKAKAVSKYRGQGK* |
Ga0007794_101048861 | 3300004774 | Freshwater | MAKLKGVSSNKVTFGKRKGGKAAKRSGPKDKPVSKYIGQGK* |
Ga0068876_1000033867 | 3300005527 | Freshwater Lake | MAKGKLTDSRKITFGKRKGGKAAKSRGPKDKSVSKYRAQGR* |
Ga0049081_1000075615 | 3300005581 | Freshwater Lentic | MAKVTKSASSTKISFGKRKGGKATKSSGPKDKSVSAYRSQGR* |
Ga0049081_100068298 | 3300005581 | Freshwater Lentic | MAKGTFSANKIVFGKRKGGKPAKSKGPKDKSVSKYRGQGKA* |
Ga0049081_101197141 | 3300005581 | Freshwater Lentic | MAKATGNSTKLSFGKRKGGKAQKTRGPKQKSVSQYRGQGK* |
Ga0049084_102193162 | 3300005585 | Freshwater Lentic | MAKAKVGDSRKITFGKRRAGRLRKRSGPKAKKVSKYRGQGR* |
Ga0078894_104578022 | 3300005662 | Freshwater Lake | MAKPKAGESRKISFGKRKGGRLRKRSGPKDKKVSKYRGQGK* |
Ga0079957_100090645 | 3300005805 | Lake | MAKSTSAVTKITFGKRKGGKARKGAGPKDKAVSKYRGQGR* |
Ga0079957_100191115 | 3300005805 | Lake | MAKINGAANKITFGTRKGRKARKSRGPKDKGISKYRGQGR* |
Ga0079957_10170271 | 3300005805 | Lake | MAKATGTSAKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK* |
Ga0079957_10278465 | 3300005805 | Lake | MAKVKSADSRKTTFGKRKGGKASKLRGPKDKPVSKYRGQGR* |
Ga0079957_12871342 | 3300005805 | Lake | MAKNNSSNKVVFGTRKGGKAKKSRGPKDKKISKYQGQGR* |
Ga0007813_10421902 | 3300006103 | Freshwater | MAKSTGSASSIKTVFGKRKCGKAKKSSGPKDKKVSKYVGQGK* |
Ga0070744_102097442 | 3300006484 | Estuarine | MAKVKSDSRKVSFGKRKGGKATKTSGPKAKKISKYR |
Ga0079301_11546283 | 3300006639 | Deep Subsurface | VTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK* |
Ga0070749_1000611014 | 3300006802 | Aqueous | MAKATGNSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK* |
Ga0075464_107332122 | 3300006805 | Aqueous | MAKTISSIKATFGKRKGGKAQKRKGPKDKAVSKYKGQGKL* |
Ga0075473_100719933 | 3300006875 | Aqueous | MAKSISGANKVTFGKRKGGKPSKSKGPKVKSTSLYRGQGR* |
Ga0075473_102900642 | 3300006875 | Aqueous | MAKAKGGEVRKISFGKRKGGKAKKTTGPKDKAVSKYRGQ |
Ga0079302_10810121 | 3300007165 | Deep Subsurface | INFMAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK* |
Ga0099851_12261113 | 3300007538 | Aqueous | MAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK* |
Ga0102877_10411161 | 3300007548 | Estuarine | MAKVKSDSRKVSFGKRKGGKATKTSGPKAKAVSKYRGQGR* |
Ga0102819_10439542 | 3300007553 | Estuarine | MAKVKSDSRKISFGKRKGGKATKTSGPKAKKISQYRGQGR* |
Ga0102828_10580731 | 3300007559 | Estuarine | MAKSKAIGDVKKVTFGARKTGKAKKGSGPKDKSVSKYRGQGR* |
Ga0102828_11588972 | 3300007559 | Estuarine | AKSKAVSSIKATFGKRKGGKAQKRSGPKDKPVSKYIGQGK* |
Ga0102915_10058083 | 3300007562 | Estuarine | MAKVKSDSRKISFGKRKGGKASKTSGPKAKAVSKYRGQGR* |
Ga0102878_12235611 | 3300007624 | Estuarine | MAKVKSDSRKISFGKRKTGRAYKTSGPKAKKISKY |
Ga0102870_11303521 | 3300007625 | Estuarine | MAKAKGGSTSMKITFGKRRNGKYAKSTGPKAKKVSK |
Ga0104988_1079212 | 3300007735 | Freshwater | MAKTISSNKLSFGKRKGGKARKSKGPKDKNVSKYKGQGK* |
Ga0105746_10105011 | 3300007973 | Estuary Water | AKSSGESKKLNFGKRKNGKASKTRGPKDKPVSAYRGQGK* |
Ga0105747_10645171 | 3300007974 | Estuary Water | MAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK* |
Ga0105747_10747671 | 3300007974 | Estuary Water | MAKAKLTSGKATFGKRKGGKARKSSGPKDAPKSKYRGQGK* |
Ga0105748_100586773 | 3300007992 | Estuary Water | MAKSSGESKKLNFGKRKNGKASKTRGPKDKPVSAYRGQGK* |
Ga0105748_101481083 | 3300007992 | Estuary Water | MAKSIGNATKQTFGKRKGGKARKSSGPKDAPKSKYRGQGK* |
Ga0114340_10950783 | 3300008107 | Freshwater, Plankton | MAKGKITDSKKITFGKRKGGKAAKSRGPKDKSVSQYRGQGR* |
Ga0114341_103663233 | 3300008108 | Freshwater, Plankton | FQMAKIKSSESRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGR* |
Ga0114343_10076269 | 3300008110 | Freshwater, Plankton | MSLSSANTRKLTFGRRKKGQSRKSSGPKAKKYSRYRGQGK* |
Ga0114346_12048931 | 3300008113 | Freshwater, Plankton | MAKASRGEAKKVTFGKRRTGKAKKFSGPKDKDVSKYRGQGR* |
Ga0114350_10030022 | 3300008116 | Freshwater, Plankton | MAKSIGNATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK* |
Ga0114364_10001777 | 3300008267 | Freshwater, Plankton | MAKTLSSANKTTFGKRKGGKPKKGKGPKEKSVSKYRGQGK* |
Ga0114364_10096133 | 3300008267 | Freshwater, Plankton | MAKTKSADSKKITFGKRKGGKAAKSRGPKDKPVSKYRGQG* |
Ga0114364_10264832 | 3300008267 | Freshwater, Plankton | MAKTKSSDSKKITFGKRKGGKAAKSRGPKDKAVSKYRGQG* |
Ga0114880_10299014 | 3300008450 | Freshwater Lake | MAKATSNNNKQSFGKRKGGKAKKTLSPKDKQISKYKGQGRG* |
Ga0114880_10411783 | 3300008450 | Freshwater Lake | MAKGSKNESRKISFGKRKGGKAAKVRGPKAKKVSAYRGQGR* |
Ga0114880_11641301 | 3300008450 | Freshwater Lake | MAKIKSTDSKKTTFGKRKGGKAQKSRGPKDKPVSKYQGQGR* |
Ga0102816_10219822 | 3300008999 | Estuarine | MAKAKVGDSRKITFGKRRSGRLRKTSGPKCKKVSKYRGQGR* |
Ga0105093_100231738 | 3300009037 | Freshwater Sediment | MAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK* |
Ga0102909_10912851 | 3300009050 | Estuarine | TCIIFKKTTMAKVKSDSRKISFGKLKTGRAYKTSGPKAKKISKYRGQGR* |
Ga0114973_1000158714 | 3300009068 | Freshwater Lake | MARALSSDSRKVTFGSRKKGKAKKGSGPKDKSVSKYRAQGR* |
Ga0105090_104553272 | 3300009075 | Freshwater Sediment | MAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQGK* |
Ga0105098_104323142 | 3300009081 | Freshwater Sediment | MAKVTGNSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK* |
Ga0105103_100781005 | 3300009085 | Freshwater Sediment | VAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV* |
Ga0105103_101941713 | 3300009085 | Freshwater Sediment | MAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQ* |
Ga0105103_103833823 | 3300009085 | Freshwater Sediment | MAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV* |
Ga0114962_1000001961 | 3300009151 | Freshwater Lake | MAKTTTGANKITFGARKSGKSKKSSGPKDKKVSKYVGQG* |
Ga0114962_1000054954 | 3300009151 | Freshwater Lake | MARSISSDSRKLTFGARKKGKAKKGSGPKDKAVSKYRAQGR* |
Ga0114962_101331902 | 3300009151 | Freshwater Lake | MAKTTGDSRKTTFGKRKGGKAKKSKGPKEKNVSKYRSQGR* |
Ga0114962_106565583 | 3300009151 | Freshwater Lake | MAKVTASSVKSTFGKRKGGKAQKRKGPKDKAVSKYKGQGKL* |
Ga0105092_101507963 | 3300009157 | Freshwater Sediment | VAKAVSNSNKVTFGKRKGGKAKKRKSPRDKAVSKPRGQGNV* |
Ga0114978_100319464 | 3300009159 | Freshwater Lake | MAKVTGTSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK* |
Ga0114970_1000012333 | 3300009163 | Freshwater Lake | MAKVLGNSTKLSFGKRKSGKAKKSRSPKDKLVSKYRGQGK* |
Ga0105102_100116136 | 3300009165 | Freshwater Sediment | MAKATGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK* |
Ga0105102_104033752 | 3300009165 | Freshwater Sediment | MAKTKSSSNNKVSFGKRKGGKASKCKGPKDKNKSTYRGQGKLI* |
Ga0105097_106067152 | 3300009169 | Freshwater Sediment | MAKLKSAGGSVKISFGKRKGGKASKTSGPKAKPTKPYRGQGK* |
Ga0114974_100081753 | 3300009183 | Freshwater Lake | MAKVTGNSTKLSFGKRKGGRAQKTRGPKQKAVSHYRGQGK* |
Ga0114964_1000132924 | 3300010157 | Freshwater Lake | MAKTTGTSTKITFGTRKGGKAKKSSGPKDKKVSKYVGQGK* |
Ga0114964_100221662 | 3300010157 | Freshwater Lake | MAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK* |
Ga0114960_105233041 | 3300010158 | Freshwater Lake | KVTGSTIKITFGKRKTGKSKKRKGPKDKPVSKYIGQGN* |
Ga0129333_100135328 | 3300010354 | Freshwater To Marine Saline Gradient | MAKSVSSSRKTTFGKRKSGKRIKSRGPKDKAVSKYRGQGK* |
Ga0129333_100383189 | 3300010354 | Freshwater To Marine Saline Gradient | MAKPKAGESRKISFGKRKGGRPAKSKGPKDKKVSKYRGQG* |
Ga0129333_102236972 | 3300010354 | Freshwater To Marine Saline Gradient | MAKGKLTDIKKISFGKRKGGKAAKSSGPKDKAVSRYRGQGR* |
Ga0129333_102843933 | 3300010354 | Freshwater To Marine Saline Gradient | MAKISGAANKITFGTRKGRKARKSRGPKDKSISKYRGQGR* |
Ga0129333_103218954 | 3300010354 | Freshwater To Marine Saline Gradient | MAKGKLGDVKKVTFGKRKGGKPAKSSGPKAKAVSK |
Ga0129333_107993343 | 3300010354 | Freshwater To Marine Saline Gradient | MAKQTTQSIKTTFGKRKVGRAAKRSGPKVKHIKKYRGQGR* |
Ga0129333_108450832 | 3300010354 | Freshwater To Marine Saline Gradient | MAKGKLGDVKKVTFGKRKGGKAAKSRGPKDKSVSRYRAQGR* |
Ga0133913_103267613 | 3300010885 | Freshwater Lake | MAKVTASSIKATFGKRKSGKARKNKGPKDKPVSKYIGQGKL* |
Ga0133913_105149711 | 3300010885 | Freshwater Lake | SIMAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK* |
Ga0133913_114939051 | 3300010885 | Freshwater Lake | MAKVTGSTIKITFGKRKTGKSKKRKGPKDKPVSKYIGQGN* |
Ga0153801_10518523 | 3300012017 | Freshwater | SKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK* |
Ga0153801_10543072 | 3300012017 | Freshwater | MAKSIGNATKTTFGKHKGGKARKSSGPKDAPKSKYRGQGK* |
Ga0164293_101304974 | 3300013004 | Freshwater | MAKVIASSIKSTFGKRKGGKAQKRKGPKDKAVSKYKGQGKL* |
(restricted) Ga0172364_103803111 | 3300013129 | Sediment | MAKSIGRATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK* |
Ga0177922_108111682 | 3300013372 | Freshwater | MAGKASKQSNNKVSFGKRKGGKAAKVRGPKAKKVSAYRGQGR* |
(restricted) Ga0172376_102863634 | 3300014720 | Freshwater | MAKSKIGTNNKLTFGKRKTGKAKKTSGPKDKLVSKYRGQGKIG* |
(restricted) Ga0172376_106024891 | 3300014720 | Freshwater | INNIIMAKSIGRATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK* |
Ga0134315_10441353 | 3300014962 | Surface Water | MAKGSKSSESRKITFGKRRVGKAKKSKGPKDKNVSPYRGQG* |
Ga0181344_10104514 | 3300017754 | Freshwater Lake | MAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQGK |
Ga0181343_10306092 | 3300017766 | Freshwater Lake | MKKGEQFKITFGKRRKGKASKRKGPKDKPVSKYRGQGR |
Ga0181343_11074812 | 3300017766 | Freshwater Lake | MAKATGNSIKLNFGKRKGGKAQKTRGPKQKAVSKYRGQGK |
Ga0188848_10054823 | 3300018775 | Freshwater Lake | MAKAKVGDSKKITFGKRRTGRLRKRSGPKAKKVSKYRGQGK |
Ga0181359_11181192 | 3300019784 | Freshwater Lake | MAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK |
Ga0181359_11209682 | 3300019784 | Freshwater Lake | MAKSIGNATKQTFGKRKGGKARKSSGPKDAPKSKYRGQGK |
Ga0194110_107500393 | 3300020084 | Freshwater Lake | MAKSTRGDAKKVTFGKRRVGKARKFKGPKDKPVSKYRGQGR |
Ga0211732_141410811 | 3300020141 | Freshwater | MAKVKSDSRKISFGKRKGGKAYKTSGPKAKKISTYRGQGR |
Ga0211736_101875746 | 3300020151 | Freshwater | FMAKATGTSTKLSFGKRKGGKSQKTRGPKQKSVSHYRGQGK |
Ga0211736_104982174 | 3300020151 | Freshwater | MAKVKSDSRKITFGKRRKGKYAKCSGPKAKKVSKYRGQGR |
Ga0211736_1083980825 | 3300020151 | Freshwater | MAKGKSDSRKISFGKRKGGKASKTSGPRDKAVSKYRGQGR |
Ga0211734_113170422 | 3300020159 | Freshwater | MAKATGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK |
Ga0211726_103452653 | 3300020161 | Freshwater | MAKSVNSNKLTFGKRKSGKAKKTSGPKDAPTKIYRGQGKKH |
Ga0211726_108652632 | 3300020161 | Freshwater | MAKVKSDSRKINFGKRKGGKASKTQGPKDKPVKKYRGQGK |
Ga0194037_11753412 | 3300020164 | Anoxic Zone Freshwater | MAKTTTGANKVIFGSRKGGKSKKSSGPKDKKVSKYVGQGK |
Ga0211731_115259483 | 3300020205 | Freshwater | MARALSSDSRKVTFGVRKKGKAKKGHGPKDKSVSKYRAQGR |
Ga0194125_107114643 | 3300020222 | Freshwater Lake | KSSGESRKIIFGRRKGGKARKYSGPKERKASKYRGQGR |
Ga0194042_11437632 | 3300020229 | Anoxic Zone Freshwater | MAKTTGDSRKTTFGKRKGGKAKKSKGPKEKNVSKYRSQGR |
Ga0207936_10020832 | 3300020512 | Freshwater | MAKSKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK |
Ga0208721_10273862 | 3300020518 | Freshwater | MAKSVNSNKLTFGKRKGGKAKKTSGPKDAPTKIYRGQGKKH |
Ga0208082_10303892 | 3300020563 | Freshwater | MAKITNANKVSFGKRKGGKASKSRGPKDKRVSKYIGQGK |
Ga0214170_100021621 | 3300020731 | Freshwater | MAKGSVTNANKVTFGSRKGGKAKKSSGPKDKKVSKYIGQGK |
Ga0194055_1000341111 | 3300021079 | Anoxic Zone Freshwater | MAKTVSDSRKVTFGARKSGKAFKSKGPKDKKVSKYRGQGR |
Ga0214206_10088372 | 3300021131 | Freshwater | MAKSKSTDSRKISFGKRKGGKAAKTSGPKDKPVKKYRGQGK |
Ga0214192_10099216 | 3300021142 | Freshwater | MAKAVGNTRKLTFGKRKGGKAKKSSGPKDKKVSKYRSQGR |
Ga0194047_1000016216 | 3300021354 | Anoxic Zone Freshwater | MAKATSSVKKISFGKRKGGKASKTKGPNDKAVSKYRGQGK |
Ga0222714_100238582 | 3300021961 | Estuarine Water | MAKSTRGDAKKVTFGKRRTGKAQKFRGPKDKPVSKYRGQGR |
Ga0181353_10185214 | 3300022179 | Freshwater Lake | MAKSKLDSHKVTFGKRKGGKAKKHNGPKEAPKSKYKGQGR |
Ga0181353_10413332 | 3300022179 | Freshwater Lake | MAKSIRSESNKISFGKRKGGKAQKTKGPKDKPTKKYVGQGR |
Ga0181351_11648642 | 3300022407 | Freshwater Lake | MAKPKAGDARKIQFGKRKGGKPIKSKGPKDKKISKYRGQGK |
Ga0181351_12753281 | 3300022407 | Freshwater Lake | MAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSKYRGQ |
Ga0214917_101982741 | 3300022752 | Freshwater | MAKSTQELRKINFGRRKGGKARKSRGPKDKKVSKYRSQGR |
Ga0214919_100523692 | 3300023184 | Freshwater | VAKAKSTSNNKISFGKRKGGKPAKTSGPKAKPVKQYRGQGR |
Ga0244775_101195194 | 3300024346 | Estuarine | MAKSKAIGDVKKVTFGARKTGKAKKGSGPKDKSVSKYRGQGR |
Ga0244775_112031002 | 3300024346 | Estuarine | MAKSKAVSSIKATFGKRKGGKAQKRSGPKDKPVSKYIGQGK |
Ga0244775_112780322 | 3300024346 | Estuarine | MAKVKSDSRKISFGKRKGGKASKTSGPKAKAVGKYRGQGR |
Ga0208916_103061182 | 3300025896 | Aqueous | MAKTISSIKATFGKRKGGKAQKRKGPKDKAVSKYKGQGKL |
Ga0208797_10371201 | 3300027186 | Estuarine | MAKAKVGDSRKITFGKRRSGRLRKTSGPKAKKVSKYRGQG |
Ga0208173_10726552 | 3300027244 | Estuarine | MAKVKSDSRKISFGKRKTGRAYKTSGPKAKKISKYRGQG |
Ga0208975_100302610 | 3300027659 | Freshwater Lentic | MAKGTFSANKIVFGKRKGGKPAKSKGPKDKSVSKYRGQGKA |
Ga0208975_10332821 | 3300027659 | Freshwater Lentic | MAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSQYRGQGK |
Ga0209704_12217442 | 3300027693 | Freshwater Sediment | MAKVTGNSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK |
Ga0209188_1000167117 | 3300027708 | Freshwater Lake | MARSISSDSRKLTFGARKKGKAKKGSGPKDKAVSKYRAQGR |
Ga0209599_100608951 | 3300027710 | Deep Subsurface | MAKVKSDSRKVSFGKRKGGKATKTSGPKAKKISKYRGQG |
Ga0209190_100010240 | 3300027736 | Freshwater Lake | MAKVLGNSTKLSFGKRKSGKAKKSRSPKDKLVSKYRGQGK |
Ga0209593_100048204 | 3300027743 | Freshwater Sediment | MAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV |
Ga0209189_100003886 | 3300027747 | Freshwater Lake | MAKTTTGANKITFGARKSGKSKKSSGPKDKKVSKYVGQG |
Ga0209296_10463212 | 3300027759 | Freshwater Lake | MAKVTGNSTKLSFGKRKGGRAQKTRGPKQKAVSHYRGQGK |
Ga0209088_100847294 | 3300027763 | Freshwater Lake | MAKTKVGDSRKVTFGKRKGGRLRKSNGPKAKKVSKYR |
Ga0209134_102960702 | 3300027764 | Freshwater Lake | MARAISSDSRKVTFGVRKKGKAKKGHGPKEKSVSKYRAQGR |
Ga0209500_1000984611 | 3300027782 | Freshwater Lake | MAKVTGTSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK |
Ga0209972_100443751 | 3300027793 | Freshwater Lake | MAKGKSLGESRKIVFGKRKGGKAKKSSGPKDKKVSKYRGQ |
Ga0209229_100720551 | 3300027805 | Freshwater And Sediment | MAGKVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR |
Ga0209229_102213301 | 3300027805 | Freshwater And Sediment | MAKAKGSKAGESRKVTFGKRKGGKAAKSRGPKDKAVS |
Ga0209990_10000038130 | 3300027816 | Freshwater Lake | MAKGKLTDSRKITFGKRKGGKAAKSRGPKDKSVSKYRAQGR |
Ga0209253_101542412 | 3300027900 | Freshwater Lake Sediment | MAKATTTSNKINFGKRKGGKYKKSSGPKDKNVSRYRGQGK |
Ga0209253_102339342 | 3300027900 | Freshwater Lake Sediment | MAKVKSDSRKISFGKRKGGKAKKTSGPKVKAVSKYRGQGR |
Ga0209079_100529622 | 3300027972 | Freshwater Sediment | MAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK |
Ga0247723_10034711 | 3300028025 | Deep Subsurface Sediment | MAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSKYRGQGK |
Ga0304729_11119892 | 3300028392 | Freshwater Lake | MAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK |
Ga0315293_100319056 | 3300031746 | Sediment | MAKAIGISTKLTFGKRKGGKARKSKKAKGKNVSEYRGQGKLNR |
Ga0315907_105936581 | 3300031758 | Freshwater | MKKSTASNKPISFGKRKGGKAAKSRGPKDKKVSKYRG |
Ga0315907_111029273 | 3300031758 | Freshwater | TSSTKLTFGKRKVGKAKKRLGPKDKNVKRYNKQGR |
Ga0315899_106128352 | 3300031784 | Freshwater | MAKGKGSSDRQKISFGKRKGGKAAKTSGPKDKNKKAYRGQGK |
Ga0315900_105803022 | 3300031787 | Freshwater | MAKVKSTDSKKTTFGKRKGGKAQKSRGPKDKPVSKYQGQGR |
Ga0315909_104786062 | 3300031857 | Freshwater | MAKTLSSANKTTFGKRKGGKPKKGKGPKEKSVSKYRGQGK |
Ga0315294_104077422 | 3300031952 | Sediment | MAKVKAISSIKATFGKRKGGKAQKRKGPKDKAVSKYVGQGK |
Ga0315294_108247772 | 3300031952 | Sediment | MAKAKAISSTKLTFGKRKGGKAQKRSGPKDKPVSKYIGQGK |
Ga0315284_100868276 | 3300032053 | Sediment | MARTIANSAYKVNFGRRKSGKAKKSRGPKEKRVSKYRSQGR |
Ga0315284_108588323 | 3300032053 | Sediment | MAKAKSIGASTKLSFGKRKGGKAKKSSSPKDKNVSKYRGQGK |
Ga0315284_109712181 | 3300032053 | Sediment | MAKSKGVSSNKVTFGKRKGGKASKFKGPKDKSVSKYIGQGK |
Ga0315273_102164552 | 3300032516 | Sediment | MAKAKAISSIKATFGKRKGGKAQKRKGPKDKSVSKYVGQGKL |
Ga0334977_0011232_3953_4066 | 3300033978 | Freshwater | MKNNSDKINFGRRKNGKARKSSGPKDKNKSKNRGQGK |
Ga0334981_0002956_9278_9406 | 3300033980 | Freshwater | MAKSKSSGDSRKISFGKRKGGKARKTSGPKDKKVSKYVGQGK |
Ga0334982_0000351_10635_10757 | 3300033981 | Freshwater | MKKGSSDSRKVIFGKRKGRRARKTKGPKDKAVSKYRGQGK |
Ga0334994_0076296_11_136 | 3300033993 | Freshwater | MKMASKESSIKISFGKRREGKHSKTSGPKAGNVKKYKGQGR |
Ga0334986_0317313_702_818 | 3300034012 | Freshwater | MAKSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQGQ |
Ga0334991_0194995_589_708 | 3300034013 | Freshwater | MAKSVGNSNKVSFGKRKGGKAQKTKGPKDKPTKKNVGQG |
Ga0334985_0037675_3299_3424 | 3300034018 | Freshwater | MAKVKSTDSRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGK |
Ga0334987_0108940_1645_1770 | 3300034061 | Freshwater | MAKIKVSNNKPTFGKRKGGKAAKSSGPKSKAVSKYRGQGRL |
Ga0334987_0369556_2_112 | 3300034061 | Freshwater | MAKATGNSIKLSFGKRKGGKAQKTRGPKQKAVSQYRG |
Ga0335031_0158180_172_300 | 3300034104 | Freshwater | MAKLKSTGSNKPTSFGKRKGGKATKSKGPKVKGVSKYRGQGK |
Ga0335068_0070149_1897_2010 | 3300034116 | Freshwater | MAKSKALGDSRKITFGKRKGGKAKKSSGPKDRKVSKYR |
Ga0335053_0017026_2_115 | 3300034118 | Freshwater | MAKSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQG |
Ga0335053_0369904_3_122 | 3300034118 | Freshwater | KSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQGQGR |
Ga0335049_0571531_401_523 | 3300034272 | Freshwater | MAKVTGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK |
Ga0335052_0048348_2227_2355 | 3300034279 | Freshwater | MAKLKSTGSNKPTSFGKRKGGKATKSKGPKVKGVSKYKGQGK |
Ga0335039_0473377_136_255 | 3300034355 | Freshwater | MAKTVNSNKLTFGKRKGNKAKKSSGPKDAPKSKYRGQGK |
⦗Top⦘ |