NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026551

Metagenome / Metatranscriptome Family F026551

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026551
Family Type Metagenome / Metatranscriptome
Number of Sequences 197
Average Sequence Length 40 residues
Representative Sequence MAKVKSTDSRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGK
Number of Associated Samples 146
Number of Associated Scaffolds 197

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 16.75 %
% of genes near scaffold ends (potentially truncated) 16.75 %
% of genes from short scaffolds (< 2000 bps) 60.41 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.883 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(10.660 % of family members)
Environment Ontology (ENVO) Unclassified
(48.223 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(54.822 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.35%    β-sheet: 0.00%    Coil/Unstructured: 95.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 197 Family Scaffolds
PF00182Glyco_hydro_19 9.64
PF00436SSB 7.11
PF00166Cpn10 3.55
PF03796DnaB_C 2.54
PF13539Peptidase_M15_4 2.54
PF00534Glycos_transf_1 2.03
PF08291Peptidase_M15_3 2.03
PF08299Bac_DnaA_C 1.52
PF01541GIY-YIG 1.02
PF00081Sod_Fe_N 1.02
PF04851ResIII 1.02
PF01520Amidase_3 1.02
PF07728AAA_5 1.02
PF13482RNase_H_2 1.02
PF03167UDG 1.02
PF07460NUMOD3 1.02
PF02777Sod_Fe_C 1.02
PF12838Fer4_7 1.02
PF01510Amidase_2 1.02
PF07603DUF1566 0.51
PF04984Phage_sheath_1 0.51
PF00149Metallophos 0.51
PF13426PAS_9 0.51
PF00583Acetyltransf_1 0.51
PF04860Phage_portal 0.51
PF13589HATPase_c_3 0.51
PF14550Peptidase_S78_2 0.51
PF00959Phage_lysozyme 0.51
PF04480DUF559 0.51
PF03237Terminase_6N 0.51
PF00271Helicase_C 0.51
PF09374PG_binding_3 0.51
PF03692CxxCxxCC 0.51
PF01075Glyco_transf_9 0.51
PF01183Glyco_hydro_25 0.51
PF05766NinG 0.51
PF01653DNA_ligase_aden 0.51
PF00692dUTPase 0.51
PF12957DUF3846 0.51
PF05257CHAP 0.51
PF13479AAA_24 0.51
PF14902DUF4494 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 197 Family Scaffolds
COG3179Chitinase, GH19 familyCarbohydrate transport and metabolism [G] 9.64
COG3979ChitodextrinaseCarbohydrate transport and metabolism [G] 9.64
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 7.11
COG2965Primosomal replication protein NReplication, recombination and repair [L] 7.11
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 3.55
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 2.54
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 2.54
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 2.03
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 1.52
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 1.02
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 1.02
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 1.02
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 1.02
COG0272NAD-dependent DNA ligaseReplication, recombination and repair [L] 0.51
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.51
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 0.51
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 0.51
COG3497Phage tail sheath protein FIMobilome: prophages, transposons [X] 0.51
COG3757Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 familyCell wall/membrane/envelope biogenesis [M] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.88 %
All OrganismsrootAll Organisms41.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000439|TBL_comb48_EPIDRAFT_1000012All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales132374Open in IMG/M
3300000882|FwDRAFT_10014802All Organisms → cellular organisms → Bacteria8517Open in IMG/M
3300000882|FwDRAFT_10217095All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300001275|B570J13894_1020711Not Available621Open in IMG/M
3300001838|RCM33_1093706Not Available502Open in IMG/M
3300001839|RCM40_1045144Not Available806Open in IMG/M
3300001847|RCM41_1136803Not Available748Open in IMG/M
3300001848|RCM47_1051387All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300001851|RCM31_10103288All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300001968|GOS2236_1030644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctEw721848Open in IMG/M
3300002092|JGI24218J26658_1014976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1159Open in IMG/M
3300002098|JGI24219J26650_1005372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2613Open in IMG/M
3300002161|JGI24766J26685_10030466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1289Open in IMG/M
3300002408|B570J29032_109930943Not Available3067Open in IMG/M
3300002835|B570J40625_100892083All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium771Open in IMG/M
3300002835|B570J40625_100969729Not Available729Open in IMG/M
3300003808|Ga0007844_1000006All Organisms → cellular organisms → Bacteria23952Open in IMG/M
3300003815|Ga0007856_1000105Not Available9291Open in IMG/M
3300003852|Ga0031655_10005776Not Available6689Open in IMG/M
3300003859|Ga0031653_10117742All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300004461|Ga0066223_1295133All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300004481|Ga0069718_15655823Not Available698Open in IMG/M
3300004771|Ga0007797_1157841Not Available577Open in IMG/M
3300004774|Ga0007794_10104886Not Available843Open in IMG/M
3300005527|Ga0068876_10000338All Organisms → cellular organisms → Bacteria37499Open in IMG/M
3300005581|Ga0049081_10000756All Organisms → cellular organisms → Bacteria12301Open in IMG/M
3300005581|Ga0049081_10006829All Organisms → cellular organisms → Bacteria4316Open in IMG/M
3300005581|Ga0049081_10119714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes974Open in IMG/M
3300005585|Ga0049084_10219316Not Available645Open in IMG/M
3300005662|Ga0078894_10457802Not Available1149Open in IMG/M
3300005805|Ga0079957_1000906All Organisms → cellular organisms → Bacteria27114Open in IMG/M
3300005805|Ga0079957_1001911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-5218728Open in IMG/M
3300005805|Ga0079957_1017027Not Available5202Open in IMG/M
3300005805|Ga0079957_1027846Not Available3793Open in IMG/M
3300005805|Ga0079957_1287134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes746Open in IMG/M
3300006103|Ga0007813_1042190Not Available968Open in IMG/M
3300006484|Ga0070744_10209744Not Available553Open in IMG/M
3300006639|Ga0079301_1154628Not Available676Open in IMG/M
3300006802|Ga0070749_10006110All Organisms → cellular organisms → Bacteria7908Open in IMG/M
3300006805|Ga0075464_10733212Not Available612Open in IMG/M
3300006875|Ga0075473_10071993Not Available1352Open in IMG/M
3300006875|Ga0075473_10290064Not Available662Open in IMG/M
3300007165|Ga0079302_1081012Not Available697Open in IMG/M
3300007538|Ga0099851_1226111Not Available675Open in IMG/M
3300007548|Ga0102877_1041116Not Available1344Open in IMG/M
3300007553|Ga0102819_1043954Not Available755Open in IMG/M
3300007559|Ga0102828_1058073Not Available907Open in IMG/M
3300007559|Ga0102828_1158897All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300007562|Ga0102915_1005808All Organisms → Viruses → Predicted Viral4120Open in IMG/M
3300007624|Ga0102878_1223561Not Available536Open in IMG/M
3300007625|Ga0102870_1130352Not Available727Open in IMG/M
3300007735|Ga0104988_10792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29589Open in IMG/M
3300007973|Ga0105746_1010501All Organisms → Viruses → Predicted Viral2628Open in IMG/M
3300007974|Ga0105747_1064517Not Available1100Open in IMG/M
3300007974|Ga0105747_1074767Not Available1031Open in IMG/M
3300007992|Ga0105748_10058677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin4191498Open in IMG/M
3300007992|Ga0105748_10148108Not Available961Open in IMG/M
3300008107|Ga0114340_1095078Not Available1202Open in IMG/M
3300008108|Ga0114341_10366323Not Available716Open in IMG/M
3300008110|Ga0114343_1007626All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin2165510Open in IMG/M
3300008113|Ga0114346_1204893All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300008116|Ga0114350_1003002Not Available10800Open in IMG/M
3300008267|Ga0114364_1000177Not Available41376Open in IMG/M
3300008267|Ga0114364_1009613All Organisms → cellular organisms → Bacteria5201Open in IMG/M
3300008267|Ga0114364_1026483All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2324Open in IMG/M
3300008450|Ga0114880_1029901Not Available2442Open in IMG/M
3300008450|Ga0114880_1041178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2004Open in IMG/M
3300008450|Ga0114880_1164130Not Available784Open in IMG/M
3300008999|Ga0102816_1021982Not Available1842Open in IMG/M
3300009037|Ga0105093_10023173Not Available2641Open in IMG/M
3300009050|Ga0102909_1091285Not Available741Open in IMG/M
3300009068|Ga0114973_10001587Not Available16815Open in IMG/M
3300009075|Ga0105090_10455327Not Available779Open in IMG/M
3300009081|Ga0105098_10432314Not Available659Open in IMG/M
3300009085|Ga0105103_10078100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1699Open in IMG/M
3300009085|Ga0105103_10194171All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1084Open in IMG/M
3300009085|Ga0105103_10383382Not Available776Open in IMG/M
3300009151|Ga0114962_10000019Not Available124635Open in IMG/M
3300009151|Ga0114962_10000549Not Available33459Open in IMG/M
3300009151|Ga0114962_10133190All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1571510Open in IMG/M
3300009151|Ga0114962_10656558Not Available539Open in IMG/M
3300009157|Ga0105092_10150796All Organisms → Viruses → Predicted Viral1291Open in IMG/M
3300009159|Ga0114978_10031946All Organisms → cellular organisms → Bacteria3753Open in IMG/M
3300009163|Ga0114970_10000123All Organisms → cellular organisms → Bacteria50206Open in IMG/M
3300009165|Ga0105102_10011613All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3385Open in IMG/M
3300009165|Ga0105102_10403375Not Available727Open in IMG/M
3300009169|Ga0105097_10606715Not Available616Open in IMG/M
3300009183|Ga0114974_10008175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7666Open in IMG/M
3300010157|Ga0114964_10001329All Organisms → cellular organisms → Bacteria18043Open in IMG/M
3300010157|Ga0114964_10022166Not Available3611Open in IMG/M
3300010158|Ga0114960_10523304Not Available567Open in IMG/M
3300010354|Ga0129333_10013532All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-527744Open in IMG/M
3300010354|Ga0129333_10038318Not Available4524Open in IMG/M
3300010354|Ga0129333_10223697Not Available1706Open in IMG/M
3300010354|Ga0129333_10284393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → unclassified Sphingobacteriia → Sphingobacteriia bacterium 28-36-521483Open in IMG/M
3300010354|Ga0129333_10321895Not Available1380Open in IMG/M
3300010354|Ga0129333_10799334Not Available804Open in IMG/M
3300010354|Ga0129333_10845083Not Available778Open in IMG/M
3300010885|Ga0133913_10326761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4061Open in IMG/M
3300010885|Ga0133913_10514971Not Available3151Open in IMG/M
3300010885|Ga0133913_11493905Not Available1712Open in IMG/M
3300012017|Ga0153801_1051852Not Available722Open in IMG/M
3300012017|Ga0153801_1054307Not Available704Open in IMG/M
3300013004|Ga0164293_10130497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1891Open in IMG/M
(restricted) 3300013129|Ga0172364_10380311Not Available909Open in IMG/M
3300013372|Ga0177922_10811168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
(restricted) 3300014720|Ga0172376_10286363All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
(restricted) 3300014720|Ga0172376_10602489Not Available602Open in IMG/M
3300017754|Ga0181344_1010451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2982Open in IMG/M
3300017766|Ga0181343_1107481All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300018775|Ga0188848_1005482Not Available1428Open in IMG/M
3300019784|Ga0181359_1118119All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes952Open in IMG/M
3300019784|Ga0181359_1120968Not Available936Open in IMG/M
3300020084|Ga0194110_10750039Not Available598Open in IMG/M
3300020141|Ga0211732_1414108Not Available4308Open in IMG/M
3300020151|Ga0211736_10187574Not Available1389Open in IMG/M
3300020151|Ga0211736_10498217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5850Open in IMG/M
3300020151|Ga0211736_10839808Not Available12575Open in IMG/M
3300020159|Ga0211734_11317042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes775Open in IMG/M
3300020161|Ga0211726_10345265Not Available641Open in IMG/M
3300020161|Ga0211726_10865263Not Available802Open in IMG/M
3300020164|Ga0194037_1175341Not Available699Open in IMG/M
3300020205|Ga0211731_11525948Not Available826Open in IMG/M
3300020222|Ga0194125_10711464All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157584Open in IMG/M
3300020229|Ga0194042_1143763All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Taibaiella → Taibaiella soli643Open in IMG/M
3300020512|Ga0207936_1002083All Organisms → Viruses3965Open in IMG/M
3300020518|Ga0208721_1027386Not Available709Open in IMG/M
3300020563|Ga0208082_1030389Not Available1034Open in IMG/M
3300020731|Ga0214170_1000216All Organisms → cellular organisms → Bacteria24266Open in IMG/M
3300021079|Ga0194055_10003411Not Available12203Open in IMG/M
3300021131|Ga0214206_1008837Not Available1501Open in IMG/M
3300021142|Ga0214192_1009921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3906Open in IMG/M
3300021354|Ga0194047_10000162Not Available46996Open in IMG/M
3300021961|Ga0222714_10023858All Organisms → cellular organisms → Bacteria4704Open in IMG/M
3300022179|Ga0181353_1018521Not Available1818Open in IMG/M
3300022179|Ga0181353_1041333Not Available1218Open in IMG/M
3300022407|Ga0181351_1164864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300022407|Ga0181351_1275328All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300022752|Ga0214917_10198274Not Available993Open in IMG/M
3300023184|Ga0214919_10052369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3887Open in IMG/M
3300024346|Ga0244775_10119519Not Available2234Open in IMG/M
3300024346|Ga0244775_11203100Not Available590Open in IMG/M
3300024346|Ga0244775_11278032Not Available569Open in IMG/M
3300025896|Ga0208916_10306118Not Available692Open in IMG/M
3300027186|Ga0208797_1037120Not Available628Open in IMG/M
3300027244|Ga0208173_1072655Not Available593Open in IMG/M
3300027659|Ga0208975_1003026All Organisms → cellular organisms → Bacteria6500Open in IMG/M
3300027659|Ga0208975_1033282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1637Open in IMG/M
3300027693|Ga0209704_1221744Not Available552Open in IMG/M
3300027708|Ga0209188_1000167Not Available73524Open in IMG/M
3300027710|Ga0209599_10060895Not Available992Open in IMG/M
3300027736|Ga0209190_1000102All Organisms → cellular organisms → Bacteria55992Open in IMG/M
3300027743|Ga0209593_10004820Not Available5626Open in IMG/M
3300027747|Ga0209189_1000038Not Available124552Open in IMG/M
3300027759|Ga0209296_1046321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2295Open in IMG/M
3300027763|Ga0209088_10084729Not Available1477Open in IMG/M
3300027782|Ga0209500_10009846All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5937Open in IMG/M
3300027793|Ga0209972_10044375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium2464Open in IMG/M
3300027805|Ga0209229_10072055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1549Open in IMG/M
3300027805|Ga0209229_10221330Not Available845Open in IMG/M
3300027816|Ga0209990_10000038All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota126638Open in IMG/M
3300027900|Ga0209253_10154241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium1858Open in IMG/M
3300027900|Ga0209253_10233934Not Available1453Open in IMG/M
3300027972|Ga0209079_10052962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1371Open in IMG/M
3300028025|Ga0247723_1003471All Organisms → cellular organisms → Bacteria7847Open in IMG/M
3300028392|Ga0304729_1111989Not Available917Open in IMG/M
3300031746|Ga0315293_10031905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales4646Open in IMG/M
3300031758|Ga0315907_10593658Not Available860Open in IMG/M
3300031784|Ga0315899_10612835Not Available1025Open in IMG/M
3300031787|Ga0315900_10580302Not Available826Open in IMG/M
3300031857|Ga0315909_10478606All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales867Open in IMG/M
3300031952|Ga0315294_10407742Not Available1270Open in IMG/M
3300031952|Ga0315294_10824777Not Available796Open in IMG/M
3300032053|Ga0315284_10086827All Organisms → Viruses → Predicted Viral4215Open in IMG/M
3300032053|Ga0315284_10858832Not Available1042Open in IMG/M
3300032053|Ga0315284_10971218Not Available961Open in IMG/M
3300032516|Ga0315273_10216455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2616Open in IMG/M
3300033978|Ga0334977_0011232Not Available5109Open in IMG/M
3300033980|Ga0334981_0002956All Organisms → cellular organisms → Bacteria10794Open in IMG/M
3300033981|Ga0334982_0000351All Organisms → cellular organisms → Bacteria28321Open in IMG/M
3300034012|Ga0334986_0317313Not Available820Open in IMG/M
3300034018|Ga0334985_0037675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium3655Open in IMG/M
3300034061|Ga0334987_0108940Not Available2112Open in IMG/M
3300034061|Ga0334987_0369556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes921Open in IMG/M
3300034104|Ga0335031_0158180Not Available1562Open in IMG/M
3300034116|Ga0335068_0070149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2011Open in IMG/M
3300034118|Ga0335053_0017026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5261Open in IMG/M
3300034118|Ga0335053_0369904Not Available878Open in IMG/M
3300034272|Ga0335049_0571531Not Available706Open in IMG/M
3300034279|Ga0335052_0048348Not Available2632Open in IMG/M
3300034355|Ga0335039_0473377Not Available632Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.66%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.66%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake7.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.09%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.58%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.57%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.06%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.06%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.55%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.55%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.05%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.05%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.54%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake2.54%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton2.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.54%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.54%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.03%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater2.03%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.03%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.52%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.52%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic1.02%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine1.02%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.51%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.51%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.51%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.51%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.51%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.51%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000439Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300001275Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300001838Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2aEnvironmentalOpen in IMG/M
3300001839Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3bEnvironmentalOpen in IMG/M
3300001847Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2aEnvironmentalOpen in IMG/M
3300001848Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3aEnvironmentalOpen in IMG/M
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300002098Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenomeEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003808Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07EnvironmentalOpen in IMG/M
3300003815Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07EnvironmentalOpen in IMG/M
3300003852Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HBEnvironmentalOpen in IMG/M
3300003859Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BREnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004771Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5MEnvironmentalOpen in IMG/M
3300004774Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5MEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007165Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007553Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300018775Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020164Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020229Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-12mEnvironmentalOpen in IMG/M
3300020512Freshwater microbial communities from Lake Mendota, WI - 19NOV2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020518Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020563Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020731Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnionEnvironmentalOpen in IMG/M
3300021079Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9mEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300021142Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300021354Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5mEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027244Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TBL_comb48_EPIDRAFT_10000121093300000439FreshwaterMAKGSVTNANKVTFGSRKGGKAKKSSGPKDKKVSKYIGQGK*
FwDRAFT_10014802163300000882Freshwater And MarineMAKVTGNSTKLSFGKRKGGKAQKTQGPKQKSVSKYRGQGK*
FwDRAFT_1021709523300000882Freshwater And MarineMSKGKSLGATKVTFGKRKGGKAVKSRSPKDKKVSKYKGQGR*
B570J13894_102071113300001275FreshwaterMAKSKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK*
RCM33_109370623300001838Marine PlanktonMAKKQGKTGTAAGIKISFGVRKGGKHKKFRGPKEKMVSKYRGQGR*
RCM40_104514423300001839Marine PlanktonMAKSKAADSKKISFGKRKGGKAAKTKGPKDKAVSKYRGQGK*LSL*
RCM41_113680323300001847Marine PlanktonSVGNSTKLSFGKRKSGKARKSRSPKDKNVSKYRGQGK*
RCM47_105138723300001848Marine PlanktonMAKSVGNSTKLSFGKRKSGKARKSRSPKDKNVSKYRGQGK*
RCM31_1010328813300001851Marine PlanktonMAKATRGEARKVTFGKRKKGKAAKFKGPKDKPVSKYRGQGR*
GOS2236_103064423300001968MarineMAKPKGSADKKKITFGTRKGGKPRKSRGPKDKGVSKYQGQGR*
JGI24218J26658_101497613300002092LenticKSANSNKITFGKRKGGKARKTSGPKDKNKKPNVGQGH*
JGI24219J26650_100537213300002098LenticMAKAKAISSTKLTFGKRKGGRAQKRSGPKDKPVSKYIGQGK*
JGI24766J26685_1003046633300002161Freshwater And SedimentMAGKVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR*
B570J29032_10993094333300002408FreshwaterMAKSVNSNKLTFGKRKGGKAKKTSGPKDAPTKIYRGQGKKH*
B570J40625_10089208323300002835FreshwaterKVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR*
B570J40625_10096972913300002835FreshwaterMAKITNANKVSFGKRKGGKASKSRGPKDKRVSKYIGQGK*
Ga0007844_1000006123300003808FreshwaterMAKAVGNTRKLTFGKRKGGKAKKSSGPKDKKVSKYRSQGR*
Ga0007856_100010593300003815FreshwaterMAGKKSSADNRKVTFGKRXRGKASKTKGPKDKPVKQYQGQGR*
Ga0031655_1000577673300003852Freshwater Lake SedimentMAKSKSTDSRKISFGKRKGGKAAKTSGPKDKPVKKYRGQGK*
Ga0031653_1011774223300003859Freshwater Lake SedimentMAKATTTSNKINFGKRKGGKYKKSSGPKDKNVSRYRGQGK*
Ga0066223_129513323300004461MarineMAKVLGNSTKLSFGKRKGGKAKNSKSPKEKNVSQYKGQGK*
Ga0069718_1565582323300004481SedimentMAKGKGSSDRQKISFGKRKGGKAAKTSGPKDKNKKAYRGQGK*
Ga0007797_115784123300004771FreshwaterMAKAASSVKKISFGKRKGGKASKTKGPKAKAVSKYRGQGK*
Ga0007794_1010488613300004774FreshwaterMAKLKGVSSNKVTFGKRKGGKAAKRSGPKDKPVSKYIGQGK*
Ga0068876_10000338673300005527Freshwater LakeMAKGKLTDSRKITFGKRKGGKAAKSRGPKDKSVSKYRAQGR*
Ga0049081_10000756153300005581Freshwater LenticMAKVTKSASSTKISFGKRKGGKATKSSGPKDKSVSAYRSQGR*
Ga0049081_1000682983300005581Freshwater LenticMAKGTFSANKIVFGKRKGGKPAKSKGPKDKSVSKYRGQGKA*
Ga0049081_1011971413300005581Freshwater LenticMAKATGNSTKLSFGKRKGGKAQKTRGPKQKSVSQYRGQGK*
Ga0049084_1021931623300005585Freshwater LenticMAKAKVGDSRKITFGKRRAGRLRKRSGPKAKKVSKYRGQGR*
Ga0078894_1045780223300005662Freshwater LakeMAKPKAGESRKISFGKRKGGRLRKRSGPKDKKVSKYRGQGK*
Ga0079957_1000906453300005805LakeMAKSTSAVTKITFGKRKGGKARKGAGPKDKAVSKYRGQGR*
Ga0079957_1001911153300005805LakeMAKINGAANKITFGTRKGRKARKSRGPKDKGISKYRGQGR*
Ga0079957_101702713300005805LakeMAKATGTSAKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0079957_102784653300005805LakeMAKVKSADSRKTTFGKRKGGKASKLRGPKDKPVSKYRGQGR*
Ga0079957_128713423300005805LakeMAKNNSSNKVVFGTRKGGKAKKSRGPKDKKISKYQGQGR*
Ga0007813_104219023300006103FreshwaterMAKSTGSASSIKTVFGKRKCGKAKKSSGPKDKKVSKYVGQGK*
Ga0070744_1020974423300006484EstuarineMAKVKSDSRKVSFGKRKGGKATKTSGPKAKKISKYR
Ga0079301_115462833300006639Deep SubsurfaceVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0070749_10006110143300006802AqueousMAKATGNSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK*
Ga0075464_1073321223300006805AqueousMAKTISSIKATFGKRKGGKAQKRKGPKDKAVSKYKGQGKL*
Ga0075473_1007199333300006875AqueousMAKSISGANKVTFGKRKGGKPSKSKGPKVKSTSLYRGQGR*
Ga0075473_1029006423300006875AqueousMAKAKGGEVRKISFGKRKGGKAKKTTGPKDKAVSKYRGQ
Ga0079302_108101213300007165Deep SubsurfaceINFMAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0099851_122611133300007538AqueousMAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0102877_104111613300007548EstuarineMAKVKSDSRKVSFGKRKGGKATKTSGPKAKAVSKYRGQGR*
Ga0102819_104395423300007553EstuarineMAKVKSDSRKISFGKRKGGKATKTSGPKAKKISQYRGQGR*
Ga0102828_105807313300007559EstuarineMAKSKAIGDVKKVTFGARKTGKAKKGSGPKDKSVSKYRGQGR*
Ga0102828_115889723300007559EstuarineAKSKAVSSIKATFGKRKGGKAQKRSGPKDKPVSKYIGQGK*
Ga0102915_100580833300007562EstuarineMAKVKSDSRKISFGKRKGGKASKTSGPKAKAVSKYRGQGR*
Ga0102878_122356113300007624EstuarineMAKVKSDSRKISFGKRKTGRAYKTSGPKAKKISKY
Ga0102870_113035213300007625EstuarineMAKAKGGSTSMKITFGKRRNGKYAKSTGPKAKKVSK
Ga0104988_10792123300007735FreshwaterMAKTISSNKLSFGKRKGGKARKSKGPKDKNVSKYKGQGK*
Ga0105746_101050113300007973Estuary WaterAKSSGESKKLNFGKRKNGKASKTRGPKDKPVSAYRGQGK*
Ga0105747_106451713300007974Estuary WaterMAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK*
Ga0105747_107476713300007974Estuary WaterMAKAKLTSGKATFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0105748_1005867733300007992Estuary WaterMAKSSGESKKLNFGKRKNGKASKTRGPKDKPVSAYRGQGK*
Ga0105748_1014810833300007992Estuary WaterMAKSIGNATKQTFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0114340_109507833300008107Freshwater, PlanktonMAKGKITDSKKITFGKRKGGKAAKSRGPKDKSVSQYRGQGR*
Ga0114341_1036632333300008108Freshwater, PlanktonFQMAKIKSSESRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGR*
Ga0114343_100762693300008110Freshwater, PlanktonMSLSSANTRKLTFGRRKKGQSRKSSGPKAKKYSRYRGQGK*
Ga0114346_120489313300008113Freshwater, PlanktonMAKASRGEAKKVTFGKRRTGKAKKFSGPKDKDVSKYRGQGR*
Ga0114350_100300223300008116Freshwater, PlanktonMAKSIGNATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0114364_100017773300008267Freshwater, PlanktonMAKTLSSANKTTFGKRKGGKPKKGKGPKEKSVSKYRGQGK*
Ga0114364_100961333300008267Freshwater, PlanktonMAKTKSADSKKITFGKRKGGKAAKSRGPKDKPVSKYRGQG*
Ga0114364_102648323300008267Freshwater, PlanktonMAKTKSSDSKKITFGKRKGGKAAKSRGPKDKAVSKYRGQG*
Ga0114880_102990143300008450Freshwater LakeMAKATSNNNKQSFGKRKGGKAKKTLSPKDKQISKYKGQGRG*
Ga0114880_104117833300008450Freshwater LakeMAKGSKNESRKISFGKRKGGKAAKVRGPKAKKVSAYRGQGR*
Ga0114880_116413013300008450Freshwater LakeMAKIKSTDSKKTTFGKRKGGKAQKSRGPKDKPVSKYQGQGR*
Ga0102816_102198223300008999EstuarineMAKAKVGDSRKITFGKRRSGRLRKTSGPKCKKVSKYRGQGR*
Ga0105093_1002317383300009037Freshwater SedimentMAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0102909_109128513300009050EstuarineTCIIFKKTTMAKVKSDSRKISFGKLKTGRAYKTSGPKAKKISKYRGQGR*
Ga0114973_10001587143300009068Freshwater LakeMARALSSDSRKVTFGSRKKGKAKKGSGPKDKSVSKYRAQGR*
Ga0105090_1045532723300009075Freshwater SedimentMAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0105098_1043231423300009081Freshwater SedimentMAKVTGNSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK*
Ga0105103_1007810053300009085Freshwater SedimentVAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV*
Ga0105103_1019417133300009085Freshwater SedimentMAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQ*
Ga0105103_1038338233300009085Freshwater SedimentMAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV*
Ga0114962_10000019613300009151Freshwater LakeMAKTTTGANKITFGARKSGKSKKSSGPKDKKVSKYVGQG*
Ga0114962_10000549543300009151Freshwater LakeMARSISSDSRKLTFGARKKGKAKKGSGPKDKAVSKYRAQGR*
Ga0114962_1013319023300009151Freshwater LakeMAKTTGDSRKTTFGKRKGGKAKKSKGPKEKNVSKYRSQGR*
Ga0114962_1065655833300009151Freshwater LakeMAKVTASSVKSTFGKRKGGKAQKRKGPKDKAVSKYKGQGKL*
Ga0105092_1015079633300009157Freshwater SedimentVAKAVSNSNKVTFGKRKGGKAKKRKSPRDKAVSKPRGQGNV*
Ga0114978_1003194643300009159Freshwater LakeMAKVTGTSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK*
Ga0114970_10000123333300009163Freshwater LakeMAKVLGNSTKLSFGKRKSGKAKKSRSPKDKLVSKYRGQGK*
Ga0105102_1001161363300009165Freshwater SedimentMAKATGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK*
Ga0105102_1040337523300009165Freshwater SedimentMAKTKSSSNNKVSFGKRKGGKASKCKGPKDKNKSTYRGQGKLI*
Ga0105097_1060671523300009169Freshwater SedimentMAKLKSAGGSVKISFGKRKGGKASKTSGPKAKPTKPYRGQGK*
Ga0114974_1000817533300009183Freshwater LakeMAKVTGNSTKLSFGKRKGGRAQKTRGPKQKAVSHYRGQGK*
Ga0114964_10001329243300010157Freshwater LakeMAKTTGTSTKITFGTRKGGKAKKSSGPKDKKVSKYVGQGK*
Ga0114964_1002216623300010157Freshwater LakeMAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK*
Ga0114960_1052330413300010158Freshwater LakeKVTGSTIKITFGKRKTGKSKKRKGPKDKPVSKYIGQGN*
Ga0129333_1001353283300010354Freshwater To Marine Saline GradientMAKSVSSSRKTTFGKRKSGKRIKSRGPKDKAVSKYRGQGK*
Ga0129333_1003831893300010354Freshwater To Marine Saline GradientMAKPKAGESRKISFGKRKGGRPAKSKGPKDKKVSKYRGQG*
Ga0129333_1022369723300010354Freshwater To Marine Saline GradientMAKGKLTDIKKISFGKRKGGKAAKSSGPKDKAVSRYRGQGR*
Ga0129333_1028439333300010354Freshwater To Marine Saline GradientMAKISGAANKITFGTRKGRKARKSRGPKDKSISKYRGQGR*
Ga0129333_1032189543300010354Freshwater To Marine Saline GradientMAKGKLGDVKKVTFGKRKGGKPAKSSGPKAKAVSK
Ga0129333_1079933433300010354Freshwater To Marine Saline GradientMAKQTTQSIKTTFGKRKVGRAAKRSGPKVKHIKKYRGQGR*
Ga0129333_1084508323300010354Freshwater To Marine Saline GradientMAKGKLGDVKKVTFGKRKGGKAAKSRGPKDKSVSRYRAQGR*
Ga0133913_1032676133300010885Freshwater LakeMAKVTASSIKATFGKRKSGKARKNKGPKDKPVSKYIGQGKL*
Ga0133913_1051497113300010885Freshwater LakeSIMAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK*
Ga0133913_1149390513300010885Freshwater LakeMAKVTGSTIKITFGKRKTGKSKKRKGPKDKPVSKYIGQGN*
Ga0153801_105185233300012017FreshwaterSKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK*
Ga0153801_105430723300012017FreshwaterMAKSIGNATKTTFGKHKGGKARKSSGPKDAPKSKYRGQGK*
Ga0164293_1013049743300013004FreshwaterMAKVIASSIKSTFGKRKGGKAQKRKGPKDKAVSKYKGQGKL*
(restricted) Ga0172364_1038031113300013129SedimentMAKSIGRATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0177922_1081116823300013372FreshwaterMAGKASKQSNNKVSFGKRKGGKAAKVRGPKAKKVSAYRGQGR*
(restricted) Ga0172376_1028636343300014720FreshwaterMAKSKIGTNNKLTFGKRKTGKAKKTSGPKDKLVSKYRGQGKIG*
(restricted) Ga0172376_1060248913300014720FreshwaterINNIIMAKSIGRATKTTFGKRKGGKARKSSGPKDAPKSKYRGQGK*
Ga0134315_104413533300014962Surface WaterMAKGSKSSESRKITFGKRRVGKAKKSKGPKDKNVSPYRGQG*
Ga0181344_101045143300017754Freshwater LakeMAKATGTSTKLNFGKRKGGKAQKTRGPKQKSVSKYRGQGK
Ga0181343_103060923300017766Freshwater LakeMKKGEQFKITFGKRRKGKASKRKGPKDKPVSKYRGQGR
Ga0181343_110748123300017766Freshwater LakeMAKATGNSIKLNFGKRKGGKAQKTRGPKQKAVSKYRGQGK
Ga0188848_100548233300018775Freshwater LakeMAKAKVGDSKKITFGKRRTGRLRKRSGPKAKKVSKYRGQGK
Ga0181359_111811923300019784Freshwater LakeMAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK
Ga0181359_112096823300019784Freshwater LakeMAKSIGNATKQTFGKRKGGKARKSSGPKDAPKSKYRGQGK
Ga0194110_1075003933300020084Freshwater LakeMAKSTRGDAKKVTFGKRRVGKARKFKGPKDKPVSKYRGQGR
Ga0211732_1414108113300020141FreshwaterMAKVKSDSRKISFGKRKGGKAYKTSGPKAKKISTYRGQGR
Ga0211736_1018757463300020151FreshwaterFMAKATGTSTKLSFGKRKGGKSQKTRGPKQKSVSHYRGQGK
Ga0211736_1049821743300020151FreshwaterMAKVKSDSRKITFGKRRKGKYAKCSGPKAKKVSKYRGQGR
Ga0211736_10839808253300020151FreshwaterMAKGKSDSRKISFGKRKGGKASKTSGPRDKAVSKYRGQGR
Ga0211734_1131704223300020159FreshwaterMAKATGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK
Ga0211726_1034526533300020161FreshwaterMAKSVNSNKLTFGKRKSGKAKKTSGPKDAPTKIYRGQGKKH
Ga0211726_1086526323300020161FreshwaterMAKVKSDSRKINFGKRKGGKASKTQGPKDKPVKKYRGQGK
Ga0194037_117534123300020164Anoxic Zone FreshwaterMAKTTTGANKVIFGSRKGGKSKKSSGPKDKKVSKYVGQGK
Ga0211731_1152594833300020205FreshwaterMARALSSDSRKVTFGVRKKGKAKKGHGPKDKSVSKYRAQGR
Ga0194125_1071146433300020222Freshwater LakeKSSGESRKIIFGRRKGGKARKYSGPKERKASKYRGQGR
Ga0194042_114376323300020229Anoxic Zone FreshwaterMAKTTGDSRKTTFGKRKGGKAKKSKGPKEKNVSKYRSQGR
Ga0207936_100208323300020512FreshwaterMAKSKSSGDSRKVNFGKRKGGKARKTSGPKDKKVSKYVGQGK
Ga0208721_102738623300020518FreshwaterMAKSVNSNKLTFGKRKGGKAKKTSGPKDAPTKIYRGQGKKH
Ga0208082_103038923300020563FreshwaterMAKITNANKVSFGKRKGGKASKSRGPKDKRVSKYIGQGK
Ga0214170_1000216213300020731FreshwaterMAKGSVTNANKVTFGSRKGGKAKKSSGPKDKKVSKYIGQGK
Ga0194055_10003411113300021079Anoxic Zone FreshwaterMAKTVSDSRKVTFGARKSGKAFKSKGPKDKKVSKYRGQGR
Ga0214206_100883723300021131FreshwaterMAKSKSTDSRKISFGKRKGGKAAKTSGPKDKPVKKYRGQGK
Ga0214192_100992163300021142FreshwaterMAKAVGNTRKLTFGKRKGGKAKKSSGPKDKKVSKYRSQGR
Ga0194047_10000162163300021354Anoxic Zone FreshwaterMAKATSSVKKISFGKRKGGKASKTKGPNDKAVSKYRGQGK
Ga0222714_1002385823300021961Estuarine WaterMAKSTRGDAKKVTFGKRRTGKAQKFRGPKDKPVSKYRGQGR
Ga0181353_101852143300022179Freshwater LakeMAKSKLDSHKVTFGKRKGGKAKKHNGPKEAPKSKYKGQGR
Ga0181353_104133323300022179Freshwater LakeMAKSIRSESNKISFGKRKGGKAQKTKGPKDKPTKKYVGQGR
Ga0181351_116486423300022407Freshwater LakeMAKPKAGDARKIQFGKRKGGKPIKSKGPKDKKISKYRGQGK
Ga0181351_127532813300022407Freshwater LakeMAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSKYRGQ
Ga0214917_1019827413300022752FreshwaterMAKSTQELRKINFGRRKGGKARKSRGPKDKKVSKYRSQGR
Ga0214919_1005236923300023184FreshwaterVAKAKSTSNNKISFGKRKGGKPAKTSGPKAKPVKQYRGQGR
Ga0244775_1011951943300024346EstuarineMAKSKAIGDVKKVTFGARKTGKAKKGSGPKDKSVSKYRGQGR
Ga0244775_1120310023300024346EstuarineMAKSKAVSSIKATFGKRKGGKAQKRSGPKDKPVSKYIGQGK
Ga0244775_1127803223300024346EstuarineMAKVKSDSRKISFGKRKGGKASKTSGPKAKAVGKYRGQGR
Ga0208916_1030611823300025896AqueousMAKTISSIKATFGKRKGGKAQKRKGPKDKAVSKYKGQGKL
Ga0208797_103712013300027186EstuarineMAKAKVGDSRKITFGKRRSGRLRKTSGPKAKKVSKYRGQG
Ga0208173_107265523300027244EstuarineMAKVKSDSRKISFGKRKTGRAYKTSGPKAKKISKYRGQG
Ga0208975_1003026103300027659Freshwater LenticMAKGTFSANKIVFGKRKGGKPAKSKGPKDKSVSKYRGQGKA
Ga0208975_103328213300027659Freshwater LenticMAKATGTSTKLSFGKRKGGKAQKTRGPKQKSVSQYRGQGK
Ga0209704_122174423300027693Freshwater SedimentMAKVTGNSTKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK
Ga0209188_10001671173300027708Freshwater LakeMARSISSDSRKLTFGARKKGKAKKGSGPKDKAVSKYRAQGR
Ga0209599_1006089513300027710Deep SubsurfaceMAKVKSDSRKVSFGKRKGGKATKTSGPKAKKISKYRGQG
Ga0209190_1000102403300027736Freshwater LakeMAKVLGNSTKLSFGKRKSGKAKKSRSPKDKLVSKYRGQGK
Ga0209593_1000482043300027743Freshwater SedimentMAKAVSNSNKVTFGKRKGGKAKKRKSPRDKSVSKPRGQGNV
Ga0209189_1000038863300027747Freshwater LakeMAKTTTGANKITFGARKSGKSKKSSGPKDKKVSKYVGQG
Ga0209296_104632123300027759Freshwater LakeMAKVTGNSTKLSFGKRKGGRAQKTRGPKQKAVSHYRGQGK
Ga0209088_1008472943300027763Freshwater LakeMAKTKVGDSRKVTFGKRKGGRLRKSNGPKAKKVSKYR
Ga0209134_1029607023300027764Freshwater LakeMARAISSDSRKVTFGVRKKGKAKKGHGPKEKSVSKYRAQGR
Ga0209500_10009846113300027782Freshwater LakeMAKVTGTSTKLSFGKRKGGKAQKTRGPKQKAVSQYRGQGK
Ga0209972_1004437513300027793Freshwater LakeMAKGKSLGESRKIVFGKRKGGKAKKSSGPKDKKVSKYRGQ
Ga0209229_1007205513300027805Freshwater And SedimentMAGKVKAGDAKKVTFGVRKGGKAQKLRGPKQKKVSKYRGQGR
Ga0209229_1022133013300027805Freshwater And SedimentMAKAKGSKAGESRKVTFGKRKGGKAAKSRGPKDKAVS
Ga0209990_100000381303300027816Freshwater LakeMAKGKLTDSRKITFGKRKGGKAAKSRGPKDKSVSKYRAQGR
Ga0209253_1015424123300027900Freshwater Lake SedimentMAKATTTSNKINFGKRKGGKYKKSSGPKDKNVSRYRGQGK
Ga0209253_1023393423300027900Freshwater Lake SedimentMAKVKSDSRKISFGKRKGGKAKKTSGPKVKAVSKYRGQGR
Ga0209079_1005296223300027972Freshwater SedimentMAKVTGNSIKLSFGKRKGGKAQKTRGPKQKSVSKYRGQGK
Ga0247723_100347113300028025Deep Subsurface SedimentMAKATGNSTKLNFGKRKGGKAQKTRGPKQKAVSKYRGQGK
Ga0304729_111198923300028392Freshwater LakeMAKSKGVSSNKVTFGKRKGGKASKFKGPKDKPVSKYIGQGK
Ga0315293_1003190563300031746SedimentMAKAIGISTKLTFGKRKGGKARKSKKAKGKNVSEYRGQGKLNR
Ga0315907_1059365813300031758FreshwaterMKKSTASNKPISFGKRKGGKAAKSRGPKDKKVSKYRG
Ga0315907_1110292733300031758FreshwaterTSSTKLTFGKRKVGKAKKRLGPKDKNVKRYNKQGR
Ga0315899_1061283523300031784FreshwaterMAKGKGSSDRQKISFGKRKGGKAAKTSGPKDKNKKAYRGQGK
Ga0315900_1058030223300031787FreshwaterMAKVKSTDSKKTTFGKRKGGKAQKSRGPKDKPVSKYQGQGR
Ga0315909_1047860623300031857FreshwaterMAKTLSSANKTTFGKRKGGKPKKGKGPKEKSVSKYRGQGK
Ga0315294_1040774223300031952SedimentMAKVKAISSIKATFGKRKGGKAQKRKGPKDKAVSKYVGQGK
Ga0315294_1082477723300031952SedimentMAKAKAISSTKLTFGKRKGGKAQKRSGPKDKPVSKYIGQGK
Ga0315284_1008682763300032053SedimentMARTIANSAYKVNFGRRKSGKAKKSRGPKEKRVSKYRSQGR
Ga0315284_1085883233300032053SedimentMAKAKSIGASTKLSFGKRKGGKAKKSSSPKDKNVSKYRGQGK
Ga0315284_1097121813300032053SedimentMAKSKGVSSNKVTFGKRKGGKASKFKGPKDKSVSKYIGQGK
Ga0315273_1021645523300032516SedimentMAKAKAISSIKATFGKRKGGKAQKRKGPKDKSVSKYVGQGKL
Ga0334977_0011232_3953_40663300033978FreshwaterMKNNSDKINFGRRKNGKARKSSGPKDKNKSKNRGQGK
Ga0334981_0002956_9278_94063300033980FreshwaterMAKSKSSGDSRKISFGKRKGGKARKTSGPKDKKVSKYVGQGK
Ga0334982_0000351_10635_107573300033981FreshwaterMKKGSSDSRKVIFGKRKGRRARKTKGPKDKAVSKYRGQGK
Ga0334994_0076296_11_1363300033993FreshwaterMKMASKESSIKISFGKRREGKHSKTSGPKAGNVKKYKGQGR
Ga0334986_0317313_702_8183300034012FreshwaterMAKSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQGQ
Ga0334991_0194995_589_7083300034013FreshwaterMAKSVGNSNKVSFGKRKGGKAQKTKGPKDKPTKKNVGQG
Ga0334985_0037675_3299_34243300034018FreshwaterMAKVKSTDSRKTTFGKRKGGKAAKSRGPKDKPVSKYRGQGK
Ga0334987_0108940_1645_17703300034061FreshwaterMAKIKVSNNKPTFGKRKGGKAAKSSGPKSKAVSKYRGQGRL
Ga0334987_0369556_2_1123300034061FreshwaterMAKATGNSIKLSFGKRKGGKAQKTRGPKQKAVSQYRG
Ga0335031_0158180_172_3003300034104FreshwaterMAKLKSTGSNKPTSFGKRKGGKATKSKGPKVKGVSKYRGQGK
Ga0335068_0070149_1897_20103300034116FreshwaterMAKSKALGDSRKITFGKRKGGKAKKSSGPKDRKVSKYR
Ga0335053_0017026_2_1153300034118FreshwaterMAKSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQG
Ga0335053_0369904_3_1223300034118FreshwaterKSKAADSRKITFGKRKGGKATKSRGPKDKNVSKYQGQGR
Ga0335049_0571531_401_5233300034272FreshwaterMAKVTGTSTKLNFGKRKGGKAQKTRGPKQKAVSQYRGQGK
Ga0335052_0048348_2227_23553300034279FreshwaterMAKLKSTGSNKPTSFGKRKGGKATKSKGPKVKGVSKYKGQGK
Ga0335039_0473377_136_2553300034355FreshwaterMAKTVNSNKLTFGKRKGNKAKKSSGPKDAPKSKYRGQGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.