NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026350

Metagenome / Metatranscriptome Family F026350

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026350
Family Type Metagenome / Metatranscriptome
Number of Sequences 198
Average Sequence Length 45 residues
Representative Sequence VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILAS
Number of Associated Samples 163
Number of Associated Scaffolds 198

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 99.49 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 156
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.424 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.263 % of family members)
Environment Ontology (ENVO) Unclassified
(27.778 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.949 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 38.89%    β-sheet: 0.00%    Coil/Unstructured: 61.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 198 Family Scaffolds
PF14031D-ser_dehydrat 68.18
PF13561adh_short_C2 17.68
PF00106adh_short 1.52
PF04199Cyclase 1.01
PF11139SfLAP 1.01
PF02782FGGY_C 0.51
PF01557FAA_hydrolase 0.51
PF00324AA_permease 0.51
PF13466STAS_2 0.51
PF14486DUF4432 0.51
PF00296Bac_luciferase 0.51
PF08445FR47 0.51
PF07582Obsolete Pfam Family 0.51
PF13602ADH_zinc_N_2 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 198 Family Scaffolds
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 1.01
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.51
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.51
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.51
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.51
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.93 %
UnclassifiedrootN/A7.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_97210All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300002245|JGIcombinedJ26739_101277745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300004063|Ga0055483_10011421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2391Open in IMG/M
3300004091|Ga0062387_101479598All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4544Open in IMG/M
3300004092|Ga0062389_103125866All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4620Open in IMG/M
3300004092|Ga0062389_103213042All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300004479|Ga0062595_101234153All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4667Open in IMG/M
3300005169|Ga0066810_10058429All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4772Open in IMG/M
3300005332|Ga0066388_101585732All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300005332|Ga0066388_102979570All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005332|Ga0066388_103779377All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4773Open in IMG/M
3300005332|Ga0066388_105799805All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005363|Ga0008090_15877708All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300005436|Ga0070713_100532199All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41111Open in IMG/M
3300005437|Ga0070710_10255766All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41127Open in IMG/M
3300005440|Ga0070705_101454693All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4573Open in IMG/M
3300005451|Ga0066681_10445746All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300005455|Ga0070663_100462076All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300005458|Ga0070681_11572409All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4583Open in IMG/M
3300005468|Ga0070707_101303694All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300005471|Ga0070698_100671455All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4978Open in IMG/M
3300005518|Ga0070699_100924927All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4799Open in IMG/M
3300005530|Ga0070679_100515110All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300005610|Ga0070763_10737894All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005764|Ga0066903_103922682All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005842|Ga0068858_100947176All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4843Open in IMG/M
3300005844|Ga0068862_101875305All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006175|Ga0070712_100009098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → unclassified Dongia → Dongia sp. URHE00606254Open in IMG/M
3300006176|Ga0070765_102122806All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4525Open in IMG/M
3300006176|Ga0070765_102204310All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300006577|Ga0074050_10001812All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41166Open in IMG/M
3300006806|Ga0079220_10740254All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300006852|Ga0075433_11528397All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4576Open in IMG/M
3300006854|Ga0075425_101197210All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300006904|Ga0075424_100991043All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4896Open in IMG/M
3300006954|Ga0079219_10456650All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300009012|Ga0066710_103606249All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300009093|Ga0105240_11139002All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300009148|Ga0105243_10191873All Organisms → cellular organisms → Bacteria1785Open in IMG/M
3300009522|Ga0116218_1390846All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4621Open in IMG/M
3300009545|Ga0105237_11587882All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4661Open in IMG/M
3300009553|Ga0105249_11064035All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4879Open in IMG/M
3300009792|Ga0126374_10277004All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300010047|Ga0126382_10845431All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4785Open in IMG/M
3300010047|Ga0126382_11420855All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300010047|Ga0126382_12036343All Organisms → cellular organisms → Archaea547Open in IMG/M
3300010048|Ga0126373_10117453All Organisms → cellular organisms → Bacteria2483Open in IMG/M
3300010048|Ga0126373_13017045Not Available525Open in IMG/M
3300010325|Ga0134064_10197225All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300010358|Ga0126370_10243119All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41390Open in IMG/M
3300010359|Ga0126376_10089191All Organisms → cellular organisms → Bacteria2318Open in IMG/M
3300010359|Ga0126376_11167955All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300010359|Ga0126376_12425994Not Available571Open in IMG/M
3300010360|Ga0126372_11801088All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4655Open in IMG/M
3300010361|Ga0126378_11479399All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4770Open in IMG/M
3300010362|Ga0126377_11459996All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300010366|Ga0126379_12124890All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4663Open in IMG/M
3300010376|Ga0126381_100490979Not Available1730Open in IMG/M
3300010376|Ga0126381_100666303Not Available1486Open in IMG/M
3300010376|Ga0126381_103159843Not Available652Open in IMG/M
3300010403|Ga0134123_12292248Not Available603Open in IMG/M
3300010867|Ga0126347_1529040All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41239Open in IMG/M
3300010880|Ga0126350_10226426All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4634Open in IMG/M
3300010880|Ga0126350_11332083All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4821Open in IMG/M
3300012189|Ga0137388_10206707All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300012201|Ga0137365_10008456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8198Open in IMG/M
3300012209|Ga0137379_10410877All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41263Open in IMG/M
3300012349|Ga0137387_10799994All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012960|Ga0164301_11184215All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4613Open in IMG/M
3300012984|Ga0164309_11894111All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4511Open in IMG/M
3300014166|Ga0134079_10754445All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4502Open in IMG/M
3300016341|Ga0182035_10508048All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41030Open in IMG/M
3300016341|Ga0182035_10982059All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4748Open in IMG/M
3300017924|Ga0187820_1157655All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4687Open in IMG/M
3300017943|Ga0187819_10174702All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41274Open in IMG/M
3300017959|Ga0187779_10696138All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300017966|Ga0187776_10486457All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4842Open in IMG/M
3300017974|Ga0187777_10651906All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4744Open in IMG/M
3300018001|Ga0187815_10017135All Organisms → cellular organisms → Bacteria3135Open in IMG/M
3300018001|Ga0187815_10213086All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4818Open in IMG/M
3300018060|Ga0187765_11080264All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4555Open in IMG/M
3300018431|Ga0066655_10961138All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4588Open in IMG/M
3300019890|Ga0193728_1027492All Organisms → cellular organisms → Bacteria2835Open in IMG/M
3300020002|Ga0193730_1070402All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4996Open in IMG/M
3300020080|Ga0206350_10076236All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4986Open in IMG/M
3300020140|Ga0179590_1046599Not Available1109Open in IMG/M
3300020199|Ga0179592_10088347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1423Open in IMG/M
3300020580|Ga0210403_10405628All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41113Open in IMG/M
3300020580|Ga0210403_10869007All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300020581|Ga0210399_10287523All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41372Open in IMG/M
3300020583|Ga0210401_11017039All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4687Open in IMG/M
3300021168|Ga0210406_10955632All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4641Open in IMG/M
3300021171|Ga0210405_10420711All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41051Open in IMG/M
3300021171|Ga0210405_10637314All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4828Open in IMG/M
3300021180|Ga0210396_11517575All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4550Open in IMG/M
3300021402|Ga0210385_11425911All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4529Open in IMG/M
3300021445|Ga0182009_10478092All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300021478|Ga0210402_10641361All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4983Open in IMG/M
3300021478|Ga0210402_11129017All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4711Open in IMG/M
3300021560|Ga0126371_11548728All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300021560|Ga0126371_12266980All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4656Open in IMG/M
3300025504|Ga0208356_1008885All Organisms → cellular organisms → Bacteria2303Open in IMG/M
3300025898|Ga0207692_10992125All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4554Open in IMG/M
3300025906|Ga0207699_11290737All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4540Open in IMG/M
3300025910|Ga0207684_10955954All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300025912|Ga0207707_10149780All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300025912|Ga0207707_10671377All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4872Open in IMG/M
3300025915|Ga0207693_10180079Not Available1663Open in IMG/M
3300025915|Ga0207693_10796162All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4729Open in IMG/M
3300025915|Ga0207693_11081991All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4610Open in IMG/M
3300025916|Ga0207663_11595692All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4525Open in IMG/M
3300025917|Ga0207660_11700722Not Available507Open in IMG/M
3300025922|Ga0207646_10098620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2618Open in IMG/M
3300025924|Ga0207694_11816240Not Available512Open in IMG/M
3300026035|Ga0207703_11007186All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4799Open in IMG/M
3300026078|Ga0207702_11282156All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4727Open in IMG/M
3300026088|Ga0207641_12405245Not Available526Open in IMG/M
3300026217|Ga0209871_1026970All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41074Open in IMG/M
3300027063|Ga0207762_1032259All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4796Open in IMG/M
3300027502|Ga0209622_1064822All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4666Open in IMG/M
3300027671|Ga0209588_1282531All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4502Open in IMG/M
3300027854|Ga0209517_10041631All Organisms → cellular organisms → Bacteria → Proteobacteria3615Open in IMG/M
3300027855|Ga0209693_10491856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300027909|Ga0209382_10812906All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300028138|Ga0247684_1089096All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4514Open in IMG/M
3300029943|Ga0311340_11322334All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4573Open in IMG/M
3300030007|Ga0311338_11736079All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4565Open in IMG/M
3300030013|Ga0302178_10174856All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41048Open in IMG/M
3300030524|Ga0311357_11269186All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4634Open in IMG/M
3300030580|Ga0311355_10866193All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4823Open in IMG/M
3300031236|Ga0302324_101072987All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41086Open in IMG/M
3300031543|Ga0318516_10426713All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4763Open in IMG/M
3300031543|Ga0318516_10484864All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4710Open in IMG/M
3300031543|Ga0318516_10641619All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4605Open in IMG/M
3300031572|Ga0318515_10495368All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4652Open in IMG/M
3300031573|Ga0310915_10264546All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41211Open in IMG/M
3300031680|Ga0318574_10350069All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4861Open in IMG/M
3300031715|Ga0307476_11392018All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4510Open in IMG/M
3300031716|Ga0310813_11449534All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4638Open in IMG/M
3300031718|Ga0307474_10582926All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4881Open in IMG/M
3300031719|Ga0306917_11321985All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4557Open in IMG/M
3300031723|Ga0318493_10494286All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4676Open in IMG/M
3300031724|Ga0318500_10110251All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41261Open in IMG/M
3300031736|Ga0318501_10522834All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4648Open in IMG/M
3300031740|Ga0307468_101143693All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4697Open in IMG/M
3300031744|Ga0306918_11124472All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4608Open in IMG/M
3300031744|Ga0306918_11503041All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4515Open in IMG/M
3300031764|Ga0318535_10507726All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4536Open in IMG/M
3300031765|Ga0318554_10165416All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41257Open in IMG/M
3300031768|Ga0318509_10527705All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4659Open in IMG/M
3300031768|Ga0318509_10802828All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4520Open in IMG/M
3300031769|Ga0318526_10026480All Organisms → cellular organisms → Bacteria2080Open in IMG/M
3300031777|Ga0318543_10177423All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4942Open in IMG/M
3300031781|Ga0318547_10175592All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41271Open in IMG/M
3300031781|Ga0318547_11049016All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4510Open in IMG/M
3300031796|Ga0318576_10494591All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4577Open in IMG/M
3300031805|Ga0318497_10855593All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4510Open in IMG/M
3300031819|Ga0318568_10936699All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4535Open in IMG/M
3300031821|Ga0318567_10497861All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4692Open in IMG/M
3300031846|Ga0318512_10201441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia974Open in IMG/M
3300031846|Ga0318512_10385655All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4703Open in IMG/M
3300031879|Ga0306919_10906084All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4676Open in IMG/M
3300031879|Ga0306919_11174138All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4584Open in IMG/M
3300031890|Ga0306925_11353026All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4705Open in IMG/M
3300031890|Ga0306925_11644264All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4622Open in IMG/M
3300031890|Ga0306925_12232683All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4508Open in IMG/M
3300031897|Ga0318520_10151449All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41345Open in IMG/M
3300031938|Ga0308175_101107968All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4878Open in IMG/M
3300031941|Ga0310912_10917742All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4674Open in IMG/M
3300031946|Ga0310910_10076281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2432Open in IMG/M
3300031947|Ga0310909_10093371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2407Open in IMG/M
3300031954|Ga0306926_11718435All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300032001|Ga0306922_11638451All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4639Open in IMG/M
3300032001|Ga0306922_12208771Not Available530Open in IMG/M
3300032009|Ga0318563_10541047All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4629Open in IMG/M
3300032043|Ga0318556_10525907All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4618Open in IMG/M
3300032044|Ga0318558_10653403All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4526Open in IMG/M
3300032052|Ga0318506_10529940All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4522Open in IMG/M
3300032054|Ga0318570_10329055All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4695Open in IMG/M
3300032054|Ga0318570_10350198All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4672Open in IMG/M
3300032064|Ga0318510_10306433All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4663Open in IMG/M
3300032066|Ga0318514_10743536All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4522Open in IMG/M
3300032068|Ga0318553_10708637All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4526Open in IMG/M
3300032089|Ga0318525_10036839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2402Open in IMG/M
3300032090|Ga0318518_10402399All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4702Open in IMG/M
3300032174|Ga0307470_11642287Not Available539Open in IMG/M
3300032180|Ga0307471_100674639All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41197Open in IMG/M
3300032261|Ga0306920_100159101All Organisms → cellular organisms → Bacteria3367Open in IMG/M
3300032261|Ga0306920_102775418All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4667Open in IMG/M
3300032770|Ga0335085_10693638All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300032770|Ga0335085_10735091All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41093Open in IMG/M
3300032828|Ga0335080_10484358All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_41315Open in IMG/M
3300032829|Ga0335070_10346209Not Available1431Open in IMG/M
3300032892|Ga0335081_10185290All Organisms → cellular organisms → Bacteria2907Open in IMG/M
3300032893|Ga0335069_11410720All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4753Open in IMG/M
3300032954|Ga0335083_10172240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia bannensis2014Open in IMG/M
3300033289|Ga0310914_10194466All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300033290|Ga0318519_10954437All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4531Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.03%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.53%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.53%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.53%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.02%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.02%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.02%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.02%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.52%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.01%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.01%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.01%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.01%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.01%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.51%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.51%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.51%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.51%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025504Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_014749602199352025SoilVAVEDRSTSQGTVKTELRENAVGLPGMLMQGNRDDR
JGIcombinedJ26739_10127774523300002245Forest SoilVAVGAGQSSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVGF
Ga0055483_1001142133300004063Natural And Restored WetlandsVTVETGQSSKGSVRTELRENAVGLPGMLMQGIATIGPSFAIL
Ga0062387_10147959823300004091Bog Forest SoilMAVEAGKPSTGSIKTDLRENAVGLPGILMQGIATIGPSFAILASFVF
Ga0062389_10312586623300004092Bog Forest SoilMALKAGQSSTGTVKTELRENAVSLPGILMQGIATIGPSFAILASFVFIVGF
Ga0062389_10321304223300004092Bog Forest SoilVAVEAGQSGTGKGTVPSELRENAVGLPGILMQGIATIGPSFAILASFVFIVGYAGIV
Ga0062595_10123415313300004479SoilMAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILASFVFIV
Ga0066810_1005842923300005169SoilMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFA
Ga0066388_10158573213300005332Tropical Forest SoilVGVIPAKGAVESEPRTGFKTDLQEGAVGLPGMLMQGIATIAPAFAILA
Ga0066388_10297957023300005332Tropical Forest SoilVAVDDRTSGTGTIKTELRENAVGLPGMLMQGIATIAPAFAI
Ga0066388_10377937713300005332Tropical Forest SoilVAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVS
Ga0066388_10579980523300005332Tropical Forest SoilVAVEDRRTSEGTVKTELRENAVGLPGMLMQGIATIAPAFAILASFVFIV
Ga0008090_1587770823300005363Tropical Rainforest SoilVAVEAGQSSEGTIRTELRENAVGLPGMLMQGIATIAPSFAILATFVFIVTYAGV
Ga0070713_10053219933300005436Corn, Switchgrass And Miscanthus RhizosphereMAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILA
Ga0070710_1025576613300005437Corn, Switchgrass And Miscanthus RhizosphereVTVEAGKTSTGSVRTELRENAVGLPGILMQGIATIGPSFAILASF
Ga0070705_10145469313300005440Corn, Switchgrass And Miscanthus RhizosphereMAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILASFVFIVSFA
Ga0066681_1044574613300005451SoilVAVEDRWTSQGTVKTELRENAVGLPGMLMQGIATIAPAFA
Ga0070663_10046207623300005455Corn RhizosphereVATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIV
Ga0070681_1157240913300005458Corn RhizosphereVAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFVFIV
Ga0070707_10130369413300005468Corn, Switchgrass And Miscanthus RhizosphereMRNDRKGWTVAIETGRTGEGTVRTELRENAVGLPGMLMQGIATIAPSFAILAS
Ga0070698_10067145513300005471Corn, Switchgrass And Miscanthus RhizosphereMAVEAGQSSTGTVKTDLRENAVGLPGILMQGIATIGPSFAILASFVFIV
Ga0070699_10092492713300005518Corn, Switchgrass And Miscanthus RhizosphereMAVEAGQSSTGTVKTDLRENAVGLPGILMQGIATIGPSFAILASFVF
Ga0070679_10051511013300005530Corn RhizosphereVATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAILAT
Ga0070763_1073789423300005610SoilVAVEAGQSSQSSKGTVPTELRENAVGLPGMLMQGIATIGPSFAILASFVFI
Ga0066903_10392268223300005764Tropical Forest SoilVAIENQMSSEGTVKTELRENAVGLPGMLMQGIATIAPSFAI
Ga0068858_10094717623300005842Switchgrass RhizosphereVAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAILA
Ga0068862_10187530523300005844Switchgrass RhizosphereVAGAVKNNGRRGAVAVEADQSGRGTIGTDLRENAVGLPGMLMQGIATIAP
Ga0070712_10000909813300006175Corn, Switchgrass And Miscanthus RhizosphereVAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPSFAILA
Ga0070765_10212280623300006176SoilMAVEAGQSSTGTVKTELRENAVGLPGILMQGIATIGPSFAI
Ga0070765_10220431023300006176SoilVAVEAGQSSQSSKGTVPTELRENAVGLPGMLMQGIATIGPSFAILA
Ga0074050_1000181223300006577SoilMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAIL
Ga0079220_1074025413300006806Agricultural SoilVAVEDRKTSQGTIQTGLQENAVGLPGILMQGIATIAPSFAILASFVFIVSFASV
Ga0075433_1152839713300006852Populus RhizosphereVSVEAGKTSTGSVRTELRENAVGLPGILMQGIATIGPSF
Ga0075425_10119721023300006854Populus RhizosphereVAVEIGKTGGTVKTELRENAVGLPGMLMQGIATIAPAFAILASF
Ga0075424_10099104323300006904Populus RhizosphereVAIEAGQTSKGSVKTELRENAVGLPGMLMQGIATIGPSFA
Ga0079219_1045665013300006954Agricultural SoilMAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILASFVFIVG
Ga0066710_10360624913300009012Grasslands SoilMVTEPVTGGVRTELRESAVGLPGMLMQGIATIAPACAILAICVFIVG
Ga0105240_1113900223300009093Corn RhizosphereVAIEDRTSGAGTIKTELRENAVGLPGMLMQGIATIAP
Ga0105243_1019187313300009148Miscanthus RhizosphereMAVEAGKPSTGSVKTELRENALGLPGMLMQGIATIGPSFAILASFVFIVSFAGL
Ga0116218_139084623300009522Peatlands SoilVAVEDLKPTQGTIKTGLQENAIGLPGILMQGIATIAPSF
Ga0105237_1158788223300009545Corn RhizosphereVAVEDLKPSQGTVKTGLRENAVGLPGMLMQGIATIAP
Ga0105249_1106403523300009553Switchgrass RhizosphereMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIV
Ga0126374_1027700433300009792Tropical Forest SoilVAIETGRGEGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVT
Ga0126382_1084543113300010047Tropical Forest SoilVALEADQTAQGTIRTELQENAVGIPGILMQGIATI
Ga0126382_1142085523300010047Tropical Forest SoilVAIENQMSSEGTVKTELRENAVGLPGMLMQGIATIA
Ga0126382_1203634323300010047Tropical Forest SoilVAVETGKTGAGTVKTELRENAVGLPGMLMQGIATIARAFAILASFVF
Ga0126373_1011745313300010048Tropical Forest SoilMGRRLTVAVEDLSAGQGTVKTELRETAVGRPGMLMQGIATIAPSFAILAS
Ga0126373_1301704513300010048Tropical Forest SoilVAVEAGKSGVGSVKTELRENAVGLPGMLMQGIATIAP
Ga0134064_1019722523300010325Grasslands SoilVAIDDRTSGAGTIKTELRENAVGLPGMLMQGIATIAPAFAILA
Ga0126370_1024311913300010358Tropical Forest SoilVAVEAGEASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVTYAGV
Ga0126376_1008919143300010359Tropical Forest SoilVAGRRLTVAVEAGQTSTGSVRTELRENAVGLPGILMQGIATIGPSFAILA
Ga0126376_1116795513300010359Tropical Forest SoilVAVDDRTSGAGTIKTELRENAVGLPGMLMQGIATIAPSFAILASFVF
Ga0126376_1242599413300010359Tropical Forest SoilVAIEAGKSGVGSVKTELRENAVGLPGMLMQGIATIAPS
Ga0126372_1180108813300010360Tropical Forest SoilVAVEDLSTGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFI
Ga0126378_1147939913300010361Tropical Forest SoilVALEAGQTAQGTIRTELQENAVGIPGILMQGIATIAPSFAILASFVFIVTYA
Ga0126377_1145999613300010362Tropical Forest SoilVAVDDRTSGTGTIKTELRENAVGLPGMLMQGIATIAPSFA
Ga0126379_1212489013300010366Tropical Forest SoilMLHGSRSCFRWVTGRRLTVAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFA
Ga0126381_10049097913300010376Tropical Forest SoilMLCIGGSCFRLVTGRRLTVAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPS
Ga0126381_10066630313300010376Tropical Forest SoilMGRRLTVAVEDLSAGQGTVKTELRENAVGLPGMLMQGIATIAPSFAI
Ga0126381_10315984313300010376Tropical Forest SoilVAIEAGKSGVGSVKTELRENAVGLPGMLMQGIATIAPSFAI
Ga0134123_1229224823300010403Terrestrial SoilVATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAI
Ga0126347_152904023300010867Boreal Forest SoilVAVEAGQSGTTKGTVASELQANAVGLPGILMQGIATIGPSF
Ga0126350_1022642613300010880Boreal Forest SoilVAVEADQSGTSKGTVASELQANAVGLPGILMQGIATIGPSFAILAS
Ga0126350_1133208313300010880Boreal Forest SoilVAVEAGESSKGTVASELQANAVGLPGILMQGIATIGPSFAILASFV
Ga0137388_1020670713300012189Vadose Zone SoilVAVEAGQSKEGTVGTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFAG
Ga0137365_1000845613300012201Vadose Zone SoilVAVEDRSTSQGTVKTELRENAVGLPGMLMQGIATIAPAFAILA
Ga0137379_1041087713300012209Vadose Zone SoilVAVEELKPSQGTVKTGLKENAVGLPGMLMQGIATIAPS
Ga0137387_1079999413300012349Vadose Zone SoilVAVEDRSTSQGTVKTELRENAVGLPGMLMQGIATIAPAYAILASF
Ga0164301_1118421513300012960SoilVAVEDLKTSQGTVKTGLQENAVGLPGMLMQGIATIA
Ga0164309_1189411113300012984SoilVAVEDLKTSQGTVKTGLRENAVGLPGMLMQGIATIAPSFAILASFVFIVSFASVV
Ga0134079_1075444513300014166Grasslands SoilVAVEDLKTSQGTVKTGLRENAVGLPGMLMQGIATIAPSFAILASF
Ga0182035_1050804813300016341SoilVAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFA
Ga0182035_1098205913300016341SoilVAVEDLKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILAS
Ga0187820_115765513300017924Freshwater SedimentVAVEDLEPSSKTIKTGLQENAIGLPGILMQGIATIAPSFAILASFVFIVT
Ga0187819_1017470213300017943Freshwater SedimentMAVEDLKSSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILAS
Ga0187779_1069613813300017959Tropical PeatlandVASVDAGSNQGTIKTELRENAVGLPGMLMQGIATIAPSFA
Ga0187776_1048645723300017966Tropical PeatlandMAVEDLKGSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILAS
Ga0187777_1065190613300017974Tropical PeatlandMAVEDLKSSTGTVKTGLQENAIGIPGILMQGIATIAPS
Ga0187815_1001713553300018001Freshwater SedimentMAVEDLKSSPGTVKTGLQENAIGLPGILMQGIATIAPSFAI
Ga0187815_1021308623300018001Freshwater SedimentVAVEDLKSSPGTVKTGLQENAIGLPGILMQGIATIAPSFAI
Ga0187765_1108026413300018060Tropical PeatlandVAVEDVKPSQGTIGTELRENAIGIPGILMQGIATIAPSFAILASFVFIVSFA
Ga0066655_1096113813300018431Grasslands SoilMAVEAGKPSTGSVKTELREHAVGLPGMLMQGIATMGPSFAILAS
Ga0193728_102749243300019890SoilVAVEAGQSSKGTVASELRENAVGLPGILMQGIATIGPSFAILA
Ga0193730_107040213300020002SoilVAVESGQASKGSVKTDLRENAVGLPGMLMQGIATIAPSFAILASFVFIVTYAG
Ga0206350_1007623623300020080Corn, Switchgrass And Miscanthus RhizosphereMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVSFAG
Ga0179590_104659913300020140Vadose Zone SoilMAVEAGQSGTGTVKTELRENAVGLPGILMQGIATI
Ga0179592_1008834713300020199Vadose Zone SoilMAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILAS
Ga0210403_1040562813300020580SoilVAVEDLKPSSTTIKTGLQENAIGLPGILMQGIATIA
Ga0210403_1086900723300020580SoilVATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAILA
Ga0210399_1028752313300020581SoilVAVEDLKPSTGTVKTGLKENAIGIPGILMQGIATIAPSFAILAS
Ga0210401_1101703923300020583SoilVAVEDLKPSSTTIKTGLQENAIGLPGILMQGIATI
Ga0210406_1095563213300021168SoilVAVEDLKTSQGTVKTGLQENAVGLPGMLMQGIATIAPSFAILASFV
Ga0210405_1042071113300021171SoilMAIEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILASFVFIVGFAG
Ga0210405_1063731413300021171SoilVAVEDLKSTQGTVKTGLQENAIGLPGILMQGIATIAPSFAILASFVF
Ga0210396_1151757513300021180SoilMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFI
Ga0210385_1142591113300021402SoilVAVEDLKPSSTTIKTGLRENAIGLPGILMQGIATIAPSFA
Ga0182009_1047809223300021445SoilVAIDDRTSGAGTIKTELRENAVGLPGMLMQGIATIAPAYAILASFVFIV
Ga0210402_1064136113300021478SoilMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSF
Ga0210402_1112901723300021478SoilVAIEAGQTSKGSVKTELRENAVGLPGMLMQGIATIGPSF
Ga0126371_1154872813300021560Tropical Forest SoilLAVEAGQSGTGTIGTDLRENAVGLPGMLMQGIATIAPSFAILASFVFIVGYAGLST
Ga0126371_1226698023300021560Tropical Forest SoilVAVEADKPGQGTVKTELRENAVGLPGMLMQGIATI
Ga0208356_100888533300025504Arctic Peat SoilVAVEAGQSSKGSKGSIGTELRENAVGLPGILMQGIATIGPTARWPSCSTK
Ga0207692_1099212523300025898Corn, Switchgrass And Miscanthus RhizosphereVTVEAGKTSTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFAFIVTFAGI
Ga0207699_1129073723300025906Corn, Switchgrass And Miscanthus RhizosphereVTVEAGKTSTGSVRTELRENAVGLPGILMQGIATIG
Ga0207684_1095595413300025910Corn, Switchgrass And Miscanthus RhizosphereVAVETGRGEGTVKTELRENAVGLPGMLMQGIATIAPAFAILA
Ga0207707_1014978013300025912Corn RhizosphereMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVSFAGL
Ga0207707_1067137723300025912Corn RhizosphereVAIEAGQTSKGSVKTELRENAVGLPGMLMQGIATIGPSFAILA
Ga0207693_1018007933300025915Corn, Switchgrass And Miscanthus RhizosphereVAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPSFAILAAF
Ga0207693_1079616223300025915Corn, Switchgrass And Miscanthus RhizosphereVAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAI
Ga0207693_1108199113300025915Corn, Switchgrass And Miscanthus RhizosphereVSVEAGQTSTGSVRTELRENAVGLPGILMQGIATIGP
Ga0207663_1159569213300025916Corn, Switchgrass And Miscanthus RhizosphereVAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFV
Ga0207660_1170072213300025917Corn RhizosphereVATVDSGSNQGTVKTELRENAVGLPGMLLQGIATIAPSLAI
Ga0207646_1009862043300025922Corn, Switchgrass And Miscanthus RhizosphereVAIEAGKSGVGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVT
Ga0207694_1181624013300025924Corn RhizosphereVATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAIL
Ga0207703_1100718613300026035Switchgrass RhizosphereVAIEAGQTSKGSVKTELRENAVGLPGMLMQGIATIG
Ga0207702_1128215623300026078Corn RhizosphereVSVEAGKTSTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFAFIV
Ga0207641_1240524513300026088Switchgrass RhizosphereVATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFV
Ga0209871_102697013300026217Permafrost SoilVAVESGQSSKGSVTTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVGF
Ga0207762_103225923300027063Tropical Forest SoilMAVEDLKGSPGTVKTGLQENAIGIPGILMQGIATIAPSF
Ga0209622_106482223300027502Forest SoilVAVEDLKTSTGTIKTGLRENAIGLPGILMQGIATIAPSFAILASFVFIV
Ga0209588_128253123300027671Vadose Zone SoilMAVETGQSSTGSVKTDLRENAVGLPGMLMQGIATIGPSFAILASFVFIVGFA
Ga0209517_1004163113300027854Peatlands SoilMAVETGQSSTGSIKTDLRENAVGLPGILMQGIATIGPSFAILASFVFIVGFAGLV
Ga0209693_1049185623300027855SoilVAVGAGQSSTGSVKTELRENAVGLPGMLMQGIATIGP
Ga0209382_1081290613300027909Populus RhizosphereVATDTGRSGQQGFRTELREGAVGLPGVLMQGVATIAPSFAILASFVFIVGFAGI
Ga0247684_108909623300028138SoilVAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFVFIVGFAGVV
Ga0311340_1132233413300029943PalsaMAVEAGQSGTGTVKTELRENAVSLPGILMQGIATIGPSFAILASFVFI
Ga0311338_1173607913300030007PalsaVAVDAGQSSKGTVASELRENAVGLPGILMQGIATIGPSFAILASFVFIVGFAG
Ga0302178_1017485613300030013PalsaMAVEAGQSGPGTVKTELRENAVSLPGILMQGIATIGPSFAILASFVFIVSF
Ga0311357_1126918623300030524PalsaVAVDAGQSSKGTVASELRENAVGLPGILMQGIATIG
Ga0311355_1086619313300030580PalsaMAVEAGQSGTGTVKTELRENAVSLPGILMQGIATIGPSFAILASFVFIVS
Ga0302324_10107298723300031236PalsaVAVGAGQSSKGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFV
Ga0318516_1042671313300031543SoilVAVEDARTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFI
Ga0318516_1048486423300031543SoilVAVEDLKSSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIVTYA
Ga0318516_1064161913300031543SoilVAVEAGEASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFV
Ga0318515_1049536823300031572SoilVAVEDVKPSPTTVKTGLQENAIGIPGILMQGIATIAPSF
Ga0310915_1026454613300031573SoilVAVEDLKTSPGTIKTGLQENAIGLPGILMQGIATIAPSFAILAS
Ga0318574_1035006913300031680SoilVAVDAGQASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFV
Ga0307476_1139201823300031715Hardwood Forest SoilVAVEDLKPSSTTIKTGLQENAIGLPGILMQGIATIAPSFAILASFVFI
Ga0310813_1144953413300031716SoilMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVSFAGLV
Ga0307474_1058292623300031718Hardwood Forest SoilVAVEAGQSGTSKGTVASELQANAVGLPGILMQGIATIGPSFAILASFVFIVG
Ga0306917_1132198513300031719SoilVAVEDLKPSSTTVKTGLQENAIGLPGILMQGIATIAPSF
Ga0318493_1049428623300031723SoilVAVEDLKPSTGTVKTGLKENAIGIPGILMQGIATIAPSFAI
Ga0318500_1011025113300031724SoilVAVEDLKTSPGTIKTGLQENAIGLPGILMQGIATIAPSFAILATFVFI
Ga0318501_1052283423300031736SoilVAVGDLKPSQGTIGTELRENAVGIPGMLMQGIATIAPSFAILA
Ga0307468_10114369313300031740Hardwood Forest SoilMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATI
Ga0306918_1112447213300031744SoilVAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFAG
Ga0306918_1150304113300031744SoilVAVEAGQSKEGTVKTELRENAVGLPGMLMQGIATIAPSFAIL
Ga0318535_1050772613300031764SoilVAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILATFVFIVGFAG
Ga0318554_1016541613300031765SoilVAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFAG
Ga0318509_1052770523300031768SoilVAVEDVKPDATTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVF
Ga0318509_1080282823300031768SoilVAVEDLKTSPGTIKTGLQENAIGLPGILMQGIATIAP
Ga0318526_1002648033300031769SoilVAVEDLKSSQGTVKTGLQENAVGLPGILMQGIATIAPSFAILASFVFIVTWAG
Ga0318543_1017742313300031777SoilVAVEAGQSKEGTVKTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVTYAGVV
Ga0318547_1017559223300031781SoilVAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILATFVFIVGFA
Ga0318547_1104901613300031781SoilVAVEDVKTSQGTVKTGLQENAIGIPGILMQGIATIAPSF
Ga0318576_1049459123300031796SoilVAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFI
Ga0318497_1085559313300031805SoilVAVEDLKTGTGTIKTGLQENAIGLPGILMQGIATIAPSFAILASFVFIVT
Ga0318568_1093669913300031819SoilVAVDDLKSSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFV
Ga0318567_1049786113300031821SoilVAVDAGQASEGTVRTELRENAVGLPGMLMQGIATIA
Ga0318512_1020144123300031846SoilVAVEDLKSSQGTVKTGLQENAIGIPGILMQGIATIA
Ga0318512_1038565523300031846SoilVAVDDLKSSPGTVKTGLQENAIGIPGILMQGIPIA
Ga0306919_1090608413300031879SoilMAVEDLKTSPGTVKTGLQENAIGIPGILMQGIATI
Ga0306919_1117413813300031879SoilVAVEDVKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFV
Ga0306925_1135302623300031890SoilMAVEDLKSSTGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIVTYAL
Ga0306925_1164426423300031890SoilVAVEDLKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIVSFAA
Ga0306925_1223268313300031890SoilVAVDAGQASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFVFI
Ga0318520_1015144923300031897SoilVAVEAGQSKEGTVKTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVGYAGIVT
Ga0308175_10110796823300031938SoilMAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVSFA
Ga0310912_1091774213300031941SoilVAVEAGQSKEGTVKTELRENAVGLPGMLMQGIATIAPSFAILATFV
Ga0310910_1007628113300031946SoilVAVEDLKTSPGTVKTGLQENAIGLPGILMQGIATIAPSFAI
Ga0310909_1009337113300031947SoilVAVEDLKTGTGTIKTGLQENAIGLPGILMQGIATIAPSFAILA
Ga0306926_1171843513300031954SoilVAVEDRSTSPGTVKTELRENAVGLPGMLMQGIATIAPSFAIL
Ga0306922_1163845123300032001SoilVAVEAGEASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVTYA
Ga0306922_1220877113300032001SoilVAVEDHRTSEGTIRTGLRENAVGLPGMLMQGIATIAPAFAILASFVFITGFAG
Ga0318563_1054104723300032009SoilVAVEDVKTSQGTVKTGLQENAIGIPGILMQGIATI
Ga0318556_1052590723300032043SoilVAVGDLKPSQGTIGTELRENAVGIPGMLMQGIATIAPSFAILATFV
Ga0318558_1065340323300032044SoilVAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILAS
Ga0318506_1052994023300032052SoilVAVDDLKSSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIVTYAG
Ga0318570_1032905513300032054SoilVAVEDVKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAIL
Ga0318570_1035019823300032054SoilVAVEDLKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFA
Ga0318510_1030643323300032064SoilVAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILATFVFIVG
Ga0318514_1074353613300032066SoilVAVGDLKPSQGTIGTELRENAVGIPGMLMQGIATIAPSFAILATFVFIVTYAGVV
Ga0318553_1070863713300032068SoilVAVDAGQASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVTYAGIVT
Ga0318525_1003683933300032089SoilVAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFA
Ga0318518_1040239923300032090SoilVAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFLF
Ga0307470_1164228723300032174Hardwood Forest SoilVATVDSGSNQGTVKTELRENAVGLPGMLMQGIATI
Ga0307471_10067463913300032180Hardwood Forest SoilVAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPSFAILASFVF
Ga0306920_10015910143300032261SoilVAVEDLKSSTGTVKTGLQGNAIGIPGILMQGIATIAPSFAILASFVFIVTY
Ga0306920_10277541823300032261SoilVAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAI
Ga0335085_1069363813300032770SoilVASVDAGSNQGTIKTELRENAVGLPGMLMQGIATIAP
Ga0335085_1073509113300032770SoilVAVEDARTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIV
Ga0335080_1048435813300032828SoilVAVEDLGTGRGTIKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVSFAG
Ga0335070_1034620923300032829SoilVAVEDARTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILAS
Ga0335081_1018529013300032892SoilVAVEDLEPSTGTVKTGLQENAIGLPGILMQGIATIAPSFAILASFVFIVTY
Ga0335069_1141072013300032893SoilVAVEDRKTSQGTIQTGLQENAVGLPGILMQGIATIAPSFAILA
Ga0335083_1017224023300032954SoilVAVEDRKTSQGTITTGLQENAVGLPGILMQGIATIAPSFAILASFVFIVS
Ga0310914_1019446633300033289SoilVAVEDLKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIV
Ga0318519_1095443723300033290SoilVAVEDLKTGTGTIKTGLQENAIGLPGILMQGIATIAPSFAILASFV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.