NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026097

Metagenome / Metatranscriptome Family F026097

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026097
Family Type Metagenome / Metatranscriptome
Number of Sequences 199
Average Sequence Length 50 residues
Representative Sequence GYQLILSVPIVPNPPAIKSYSGPPEPGNKPYQLANYPDAVAALKQGA
Number of Associated Samples 163
Number of Associated Scaffolds 199

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.50 %
% of genes near scaffold ends (potentially truncated) 99.50 %
% of genes from short scaffolds (< 2000 bps) 94.97 %
Associated GOLD sequencing projects 152
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.864 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.618 % of family members)
Environment Ontology (ENVO) Unclassified
(19.095 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.734 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 17.33%    β-sheet: 0.00%    Coil/Unstructured: 82.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 199 Family Scaffolds
PF02057Glyco_hydro_59 13.07
PF01425Amidase 5.53
PF13091PLDc_2 3.02
PF07883Cupin_2 3.02
PF09206ArabFuran-catal 3.02
PF11774Lsr2 2.01
PF05270AbfB 2.01
PF02771Acyl-CoA_dh_N 1.51
PF12852Cupin_6 1.01
PF00296Bac_luciferase 1.01
PF03704BTAD 1.01
PF00069Pkinase 1.01
PF00441Acyl-CoA_dh_1 1.01
PF07690MFS_1 1.01
PF01734Patatin 0.50
PF12680SnoaL_2 0.50
PF00903Glyoxalase 0.50
PF05729NACHT 0.50
PF01243Putative_PNPOx 0.50
PF08837DUF1810 0.50
PF08021FAD_binding_9 0.50
PF00486Trans_reg_C 0.50
PF13302Acetyltransf_3 0.50
PF01494FAD_binding_3 0.50
PF04191PEMT 0.50
PF13360PQQ_2 0.50
PF00005ABC_tran 0.50
PF01565FAD_binding_4 0.50
PF01554MatE 0.50
PF00528BPD_transp_1 0.50
PF07592DDE_Tnp_ISAZ013 0.50
PF04738Lant_dehydr_N 0.50
PF13460NAD_binding_10 0.50
PF13546DDE_5 0.50
PF13560HTH_31 0.50
PF13450NAD_binding_8 0.50
PF04679DNA_ligase_A_C 0.50
PF12840HTH_20 0.50
PF13281MAP3K_TRAF_bd 0.50
PF10009DUF2252 0.50
PF01433Peptidase_M1 0.50
PF00132Hexapep 0.50
PF02894GFO_IDH_MocA_C 0.50
PF00782DSPc 0.50
PF04545Sigma70_r4 0.50
PF01370Epimerase 0.50
PF12973Cupin_7 0.50
PF00300His_Phos_1 0.50

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 199 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 5.53
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 4.02
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 2.51
COG0543NAD(P)H-flavin reductaseEnergy production and conversion [C] 1.01
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.01
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.01
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 1.01
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 1.01
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.50
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.50
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.50
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.50
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.50
COG1018Flavodoxin/ferredoxin--NADP reductaseEnergy production and conversion [C] 0.50
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.50
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.50
COG2375NADPH-dependent ferric siderophore reductase, contains FAD-binding and SIP domainsInorganic ion transport and metabolism [P] 0.50
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.50
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.50
COG5579Uncharacterized conserved protein, DUF1810 familyFunction unknown [S] 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.37 %
UnclassifiedrootN/A26.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02HHXDOAll Organisms → cellular organisms → Bacteria511Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_102022564All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300003505|JGIcombinedJ51221_10164256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300004091|Ga0062387_100543601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300004092|Ga0062389_101512645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia854Open in IMG/M
3300005331|Ga0070670_101469021Not Available626Open in IMG/M
3300005332|Ga0066388_104557513Not Available705Open in IMG/M
3300005332|Ga0066388_107240577All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005343|Ga0070687_100276218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1055Open in IMG/M
3300005347|Ga0070668_100729424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia876Open in IMG/M
3300005355|Ga0070671_101387296Not Available621Open in IMG/M
3300005434|Ga0070709_10968286All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005434|Ga0070709_11333211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300005436|Ga0070713_100309468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1456Open in IMG/M
3300005439|Ga0070711_100509307All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300005456|Ga0070678_101690174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300005541|Ga0070733_10780450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea roseoviolacea641Open in IMG/M
3300005556|Ga0066707_10621984Not Available687Open in IMG/M
3300005577|Ga0068857_101370428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300005578|Ga0068854_100077328All Organisms → cellular organisms → Bacteria2448Open in IMG/M
3300005618|Ga0068864_102298997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300005718|Ga0068866_10506341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia800Open in IMG/M
3300006028|Ga0070717_10759585All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300006028|Ga0070717_11811934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300006052|Ga0075029_101348708All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300006173|Ga0070716_100253346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1200Open in IMG/M
3300006175|Ga0070712_101693667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300006237|Ga0097621_101832756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300006237|Ga0097621_102438840All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006575|Ga0074053_11983525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium845Open in IMG/M
3300006755|Ga0079222_10495048All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300006755|Ga0079222_12007339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae569Open in IMG/M
3300006755|Ga0079222_12171292All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300006806|Ga0079220_10526412All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300006806|Ga0079220_11058363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora globispora651Open in IMG/M
3300006871|Ga0075434_102489011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora globispora519Open in IMG/M
3300006893|Ga0073928_10142517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1943Open in IMG/M
3300006914|Ga0075436_100300308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1151Open in IMG/M
3300006954|Ga0079219_11997680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300007076|Ga0075435_101487995Not Available594Open in IMG/M
3300009177|Ga0105248_12246972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium621Open in IMG/M
3300009521|Ga0116222_1197390All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300009523|Ga0116221_1030120Not Available2704Open in IMG/M
3300009698|Ga0116216_10251434All Organisms → cellular organisms → Bacteria → Terrabacteria group1080Open in IMG/M
3300009700|Ga0116217_10809492Not Available577Open in IMG/M
3300010322|Ga0134084_10313310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium587Open in IMG/M
3300010361|Ga0126378_12103970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300010371|Ga0134125_11788352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora globispora668Open in IMG/M
3300010379|Ga0136449_100422240All Organisms → cellular organisms → Bacteria2354Open in IMG/M
3300010396|Ga0134126_10946995All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300010396|Ga0134126_12318680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300010400|Ga0134122_10082581All Organisms → cellular organisms → Bacteria2517Open in IMG/M
3300010401|Ga0134121_12961475All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300010880|Ga0126350_10728889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia862Open in IMG/M
3300012502|Ga0157347_1067704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300012924|Ga0137413_11749331All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012951|Ga0164300_10589957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia654Open in IMG/M
3300012955|Ga0164298_10048809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2022Open in IMG/M
3300012957|Ga0164303_10370741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia873Open in IMG/M
3300012958|Ga0164299_11524081All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012988|Ga0164306_10656283All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300013100|Ga0157373_10275124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1192Open in IMG/M
3300014968|Ga0157379_11615115All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300016270|Ga0182036_10949631Not Available707Open in IMG/M
3300016341|Ga0182035_10486728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori1052Open in IMG/M
3300016371|Ga0182034_11576463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300016387|Ga0182040_11130830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300016404|Ga0182037_12161230Not Available501Open in IMG/M
3300016422|Ga0182039_10581215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori977Open in IMG/M
3300016445|Ga0182038_11906838All Organisms → cellular organisms → Bacteria → Terrabacteria group537Open in IMG/M
3300017822|Ga0187802_10458596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae505Open in IMG/M
3300017823|Ga0187818_10012355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae3658Open in IMG/M
3300017926|Ga0187807_1215573All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300017928|Ga0187806_1135086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii807Open in IMG/M
3300017933|Ga0187801_10061703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1377Open in IMG/M
3300017933|Ga0187801_10103453All Organisms → cellular organisms → Bacteria → Proteobacteria1082Open in IMG/M
3300017937|Ga0187809_10073987Not Available1118Open in IMG/M
3300017937|Ga0187809_10223389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia674Open in IMG/M
3300017943|Ga0187819_10628117Not Available608Open in IMG/M
3300017943|Ga0187819_10861359Not Available508Open in IMG/M
3300017955|Ga0187817_11009810All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300017959|Ga0187779_10218268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300017959|Ga0187779_10555401All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300017961|Ga0187778_11039258Not Available568Open in IMG/M
3300017961|Ga0187778_11316184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300017973|Ga0187780_10361765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1026Open in IMG/M
3300017974|Ga0187777_10318517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora1065Open in IMG/M
3300017975|Ga0187782_10276620Not Available1265Open in IMG/M
3300018001|Ga0187815_10504103Not Available519Open in IMG/M
3300018007|Ga0187805_10012255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3632Open in IMG/M
3300018062|Ga0187784_10560505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia919Open in IMG/M
3300018085|Ga0187772_10711947Not Available720Open in IMG/M
3300018085|Ga0187772_11261692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii546Open in IMG/M
3300018086|Ga0187769_10406590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1024Open in IMG/M
3300018086|Ga0187769_11453956All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300018088|Ga0187771_11447171Not Available583Open in IMG/M
3300018090|Ga0187770_10258472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1350Open in IMG/M
3300018090|Ga0187770_10983863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia678Open in IMG/M
3300018090|Ga0187770_11337748Not Available581Open in IMG/M
3300020580|Ga0210403_10763889All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300020581|Ga0210399_10922468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300020583|Ga0210401_11300224Not Available585Open in IMG/M
3300021088|Ga0210404_10045302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2045Open in IMG/M
3300021088|Ga0210404_10548090Not Available655Open in IMG/M
3300021180|Ga0210396_11364111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300021181|Ga0210388_11001902Not Available716Open in IMG/M
3300021403|Ga0210397_10524315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria899Open in IMG/M
3300021403|Ga0210397_10638194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia816Open in IMG/M
3300021407|Ga0210383_10307289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1364Open in IMG/M
3300021407|Ga0210383_10958066Not Available727Open in IMG/M
3300021432|Ga0210384_11510926Not Available577Open in IMG/M
3300021474|Ga0210390_10381138Not Available1192Open in IMG/M
3300021474|Ga0210390_10799570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium781Open in IMG/M
3300021477|Ga0210398_11031398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300021559|Ga0210409_11366747Not Available584Open in IMG/M
3300022557|Ga0212123_10438019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium865Open in IMG/M
3300024055|Ga0247794_10229490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium608Open in IMG/M
3300024325|Ga0247678_1043641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300024331|Ga0247668_1050951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia841Open in IMG/M
3300025906|Ga0207699_10736051All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300025906|Ga0207699_11182642All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300025916|Ga0207663_10060111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2407Open in IMG/M
3300025916|Ga0207663_10205929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1422Open in IMG/M
3300025916|Ga0207663_11624548All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300025924|Ga0207694_10783619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia805Open in IMG/M
3300025924|Ga0207694_11268584All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300025928|Ga0207700_11091517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300025928|Ga0207700_11091536All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300025931|Ga0207644_11125871All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300025937|Ga0207669_10752461All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300025939|Ga0207665_10206734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1432Open in IMG/M
3300025945|Ga0207679_11194027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300025961|Ga0207712_11535826All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300025972|Ga0207668_11613634All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300026023|Ga0207677_10990985Not Available761Open in IMG/M
3300026121|Ga0207683_10006337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10135Open in IMG/M
3300027049|Ga0207806_1035484All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300027096|Ga0208099_1049481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces600Open in IMG/M
3300027297|Ga0208241_1078451Not Available530Open in IMG/M
3300027523|Ga0208890_1065827All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300027609|Ga0209221_1098017Not Available755Open in IMG/M
3300027703|Ga0207862_1037745Not Available1454Open in IMG/M
3300027775|Ga0209177_10202282All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300027867|Ga0209167_10075598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1690Open in IMG/M
3300027968|Ga0209061_1101261Not Available1011Open in IMG/M
3300028379|Ga0268266_10335306All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300028716|Ga0307311_10194458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300028782|Ga0307306_10106025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium753Open in IMG/M
3300028787|Ga0307323_10125976All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300028875|Ga0307289_10056147All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300029943|Ga0311340_11182698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia616Open in IMG/M
3300029943|Ga0311340_11464875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia536Open in IMG/M
3300029999|Ga0311339_10893066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia844Open in IMG/M
3300030058|Ga0302179_10261216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia763Open in IMG/M
3300030617|Ga0311356_10657003Not Available1009Open in IMG/M
3300031234|Ga0302325_12606604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia599Open in IMG/M
3300031561|Ga0318528_10189622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1099Open in IMG/M
3300031573|Ga0310915_11288170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus albus503Open in IMG/M
3300031751|Ga0318494_10725910Not Available582Open in IMG/M
3300031763|Ga0318537_10190877Not Available762Open in IMG/M
3300031768|Ga0318509_10422795Not Available745Open in IMG/M
3300031768|Ga0318509_10710027Not Available558Open in IMG/M
3300031770|Ga0318521_10853637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300031770|Ga0318521_11027010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300031778|Ga0318498_10333786Not Available678Open in IMG/M
3300031792|Ga0318529_10283911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium771Open in IMG/M
3300031799|Ga0318565_10137963Not Available1181Open in IMG/M
3300031799|Ga0318565_10543351Not Available560Open in IMG/M
3300031819|Ga0318568_10719485Not Available620Open in IMG/M
3300031821|Ga0318567_10271397Not Available954Open in IMG/M
3300031821|Ga0318567_10858582Not Available514Open in IMG/M
3300031859|Ga0318527_10223149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria800Open in IMG/M
3300031859|Ga0318527_10308646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300031860|Ga0318495_10358696Not Available645Open in IMG/M
3300031893|Ga0318536_10421313Not Available674Open in IMG/M
3300031897|Ga0318520_10178895Not Available1243Open in IMG/M
3300031912|Ga0306921_10372301Not Available1669Open in IMG/M
3300031912|Ga0306921_12159817Not Available588Open in IMG/M
3300031941|Ga0310912_10876522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300031942|Ga0310916_10303985Not Available1351Open in IMG/M
3300031947|Ga0310909_11286155Not Available589Open in IMG/M
3300031996|Ga0308176_10524835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1206Open in IMG/M
3300032025|Ga0318507_10512096Not Available522Open in IMG/M
3300032035|Ga0310911_10632332Not Available621Open in IMG/M
3300032042|Ga0318545_10168615Not Available780Open in IMG/M
3300032043|Ga0318556_10587717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300032063|Ga0318504_10070584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1514Open in IMG/M
3300032063|Ga0318504_10365594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300032515|Ga0348332_14697942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia696Open in IMG/M
3300032782|Ga0335082_10602164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria960Open in IMG/M
3300032828|Ga0335080_10532092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1244Open in IMG/M
3300032895|Ga0335074_10370690All Organisms → cellular organisms → Bacteria1576Open in IMG/M
3300032896|Ga0335075_10772009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium907Open in IMG/M
3300032896|Ga0335075_11423105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300032898|Ga0335072_11143291All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300032954|Ga0335083_10884817Not Available710Open in IMG/M
3300033134|Ga0335073_10468139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1450Open in IMG/M
3300033134|Ga0335073_10801979Not Available1010Open in IMG/M
3300033158|Ga0335077_10556241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1204Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland8.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.04%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.52%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.02%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.51%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.01%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.01%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.51%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.00%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.50%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.50%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.50%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.50%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.50%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.50%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027049Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes)EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027968Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_076547302170459010Grass SoilLSVPIFPNPPTIKSYSGPPEPGHKSYQLADYPDAVAALRQGA
INPhiseqgaiiFebDRAFT_10202256423300000364SoilLSVPIFPNPPTIKSYSGPPEPGHKPYQLADYPDAVAALRQGA*
JGIcombinedJ51221_1016425623300003505Forest SoilWESAGYRLILSVPIVPNPPAIESYSGPPEPGNKPYQLADYPDAVAALRQGA*
Ga0062387_10054360123300004091Bog Forest SoilDIIPNPPVIKSYSGPPEPGNKPYQLSGYPDAVAALKQGLR*
Ga0062389_10151264523300004092Bog Forest SoilQPVLAPWEHAGYRVILSVPIVPLPPAVKSYSGPPEPGNKPYQLADYPDAVAALRRGASSCSASSC*
Ga0070670_10146902123300005331Switchgrass RhizosphereQPVLAPWQHAGYQLILSVPIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA*
Ga0066388_10455751313300005332Tropical Forest SoilGYQLILSVPMVPNPPAIKSYNGPPEPGNKTYQLADYPDAVAALKRGA*
Ga0066388_10724057723300005332Tropical Forest SoilHAGYQLILSVPMIPNPPTIKSYSGPPEPGHKPYQLANYPDAVAALRQGL*
Ga0070687_10027621823300005343Switchgrass RhizosphereGYQLVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPR*
Ga0070668_10072942413300005347Switchgrass RhizosphereDIIPNPPAIKSYSGPPEPGNTPYQLSGYPDAVAALKHGPG*
Ga0070671_10138729613300005355Switchgrass RhizosphereAGYQLILSVPIFPNPPAIKSYSGPAEPGNKSYQLADYPDVVAALRQGA*
Ga0070709_1096828623300005434Corn, Switchgrass And Miscanthus RhizosphereAQPVLAPWLHAGYRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALRQGA*
Ga0070709_1133321123300005434Corn, Switchgrass And Miscanthus RhizosphereLVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPR*
Ga0070713_10030946813300005436Corn, Switchgrass And Miscanthus RhizosphereWLHTGYRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALRQGA*
Ga0070711_10050930723300005439Corn, Switchgrass And Miscanthus RhizospherePLVPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQGA*
Ga0070678_10169017413300005456Miscanthus RhizosphereYQLVLSVDIIPNPPVIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPG*
Ga0070733_1078045023300005541Surface SoilAGYQLVLSVDIIPNPPVVKSYSGPAEPGNKPYQLSGYPDAVAALKQGLG*
Ga0066707_1062198413300005556SoilGYRLILSVPLVPNPPAIKSYSGPPEPGNRSYQLVDYPDSVAALRQGA*
Ga0068857_10137042823300005577Corn RhizosphereDATAQPVLAPWENAGYQLVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPR*
Ga0068854_10007732823300005578Corn RhizosphereGYQLILSVPIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA*
Ga0068864_10229899723300005618Switchgrass RhizospherePAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPR*
Ga0068866_1050634123300005718Miscanthus RhizospherePPVIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPG*
Ga0070717_1075958533300006028Corn, Switchgrass And Miscanthus RhizosphereVLAPWLHAGYRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALKKGG*
Ga0070717_1181193423300006028Corn, Switchgrass And Miscanthus RhizosphereNPPAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPR*
Ga0075029_10134870823300006052WatershedsGYQLILSVPIVPNPPAIKSYSGPPEPGNKPYQLANYPDAVAALKQGA*
Ga0070716_10025334623300006173Corn, Switchgrass And Miscanthus RhizosphereGYRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALRQGA*
Ga0070712_10169366723300006175Corn, Switchgrass And Miscanthus RhizospherePNPPAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPR*
Ga0097621_10183275623300006237Miscanthus RhizosphereLVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAIAALKHGPG*
Ga0097621_10243884023300006237Miscanthus RhizosphereVLAPWQHAGYQLILSVPIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA*
Ga0074053_1198352533300006575SoilADQPVLAPWQHAGYQLILSVPIIPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQSGR
Ga0079222_1049504813300006755Agricultural SoilIFPNPPEIKSYSGPPEPGHKHHKLADYPDAVAALRRGA*
Ga0079222_1200733913300006755Agricultural SoilMPNPPAIKSYSGPPEPDHKSYQLADYPDAVAALRQGGR*
Ga0079222_1217129223300006755Agricultural SoilPSEKLDQPVLAPWQHAGYQLILSVPMFPNPAEIKSYSGPPEPRNKVYQLADYPDTVAALRRGA*
Ga0079220_1052641213300006806Agricultural SoilPWQHAGYQLILSVPMFPNPPEIKSYSGPPEPGNKVYQLADYPDTVAALRRGA*
Ga0079220_1105836323300006806Agricultural SoilQPVLAPWLHAGYRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALRQGG*
Ga0075434_10248901113300006871Populus RhizosphereLSVPLVPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQGA*
Ga0073928_1014251723300006893Iron-Sulfur Acid SpringYRLVLSVNIVPNPPAIKSYSGPPMPGHKPNRLADYPDAVAALRRGLG*
Ga0075436_10030030833300006914Populus RhizosphereYQLVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAIAALKHGPG*
Ga0079219_1199768013300006954Agricultural SoilAGYQLVLSVDIIPNPPVIKSYSGPPEPGNKPYQLSAYPDAVAALKHGSG*
Ga0075435_10148799513300007076Populus RhizosphereYRLVLSVPLVPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQGA*
Ga0105248_1224697223300009177Switchgrass RhizosphereVSVQAPTAASSAQPVLAPWLHAGYRLVLSVPLVPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQGA*
Ga0116222_119739013300009521Peatlands SoilKKADYQLVLRVDIIPDPPAIRSYSGPPEPGNQPYRLANYPDAVMALQQGLG*
Ga0116221_103012043300009523Peatlands SoilYQLILSVPMVPNPPAIKSYSGPPEPGNKPYQLADYPDAVAALKQGS*
Ga0116216_1025143413300009698Peatlands SoilPPIIKSYSGPPEPGGKPYQLSGYPDVIAKLRQGFG*
Ga0116217_1080949223300009700Peatlands SoilVLAPWENAGYQLVLSVDIIPNPPIIKSYSGPSEPGGKPYQLSGYPDVVAKLRQAFG*
Ga0134084_1031331013300010322Grasslands SoilKADQPVLAPWQHAGYQLILSVPMFPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQGA
Ga0126378_1210397013300010361Tropical Forest SoilKWFSEKVDQPLLAPWRHAGYRVILSVPMVPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRRGV*
Ga0134125_1178835213300010371Terrestrial SoilPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALKKGG*
Ga0136449_10042224043300010379Peatlands SoilATAQPILAPWKKADYQLVLSVDIIPDPPAIRSYSGPPEPGNQPYQLANYPDAVMALQQGLG*
Ga0134126_1094699533300010396Terrestrial SoilSEKADQPVLAPWQHAGYQLILSVPIFPNPPAIKSYSGPPEPGHKSYQLADYPDTVAALRRGA*
Ga0134126_1231868013300010396Terrestrial SoilQLVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPR*
Ga0134122_1008258113300010400Terrestrial SoilWQHAGYQLILSVPIFPNPPTIKSYSGPPEPGHKSYQLADYPDVVAALRQGA*
Ga0134121_1296147523300010401Terrestrial SoilAGYQLILSVPIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA*
Ga0126350_1072888913300010880Boreal Forest SoilPLPPTIKSYSGPPEPGDKPYQLADYPDAVAAIKQGL*
Ga0157347_106770413300012502Arabidopsis RhizospherePAIKSYSGPPEPGNKPYQLSSYPDAIAALKHGPG*
Ga0137413_1174933113300012924Vadose Zone SoilLVPLPPTIKSYSGPPEPGNKIYQLTDYPDAVAALKQGA*
Ga0164300_1058995713300012951SoilPWENAGYQLVLSVDIIPNPPAIKSYSGPPEPGNTPYQLSGYPDAVAALKHGPG*
Ga0164298_1004880913300012955SoilAGYQLILSVPMFPNPPAIKSYSGPPEPGNKVYQLADYPDTVAALRRGA*
Ga0164303_1037074123300012957SoilYQLVLSVDIIPNPPVIKSYSGPPEPGNKPYQLSAYPDAVAALKHGSG*
Ga0164299_1152408123300012958SoilVEEPVLAPWVNAGYQLILSVPIVPNHPWIKSYSGPPEPGNKPYQLADYPDAVAALRQGA*
Ga0164306_1065628313300012988SoilLILSVPIFPNPPTIKSYSGPPEPGHKSYQLADYPDAVAALRQGA*
Ga0157373_1027512433300013100Corn RhizosphereVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPR*
Ga0157379_1161511523300014968Switchgrass RhizospherePIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA*
Ga0182036_1094963123300016270SoilWLVPWEHSDYRLILSVPVVPNPPAIKSYSGPPEPGKKPYKLANYPDAVAALRQGA
Ga0182035_1048672823300016341SoilPWENAGYQLVLSVDIIPDPPIIKSYSGPPEPGSKPYQLYGYPDAVAALKQGLG
Ga0182034_1157646313300016371SoilGYQLVLAVDIIPNPAAIKSYSGPSEPGNKGYQLSSYPDAVAALKKGLG
Ga0182040_1113083023300016387SoilLLAPWQHAGYRVILSVPMVPNPPAIKSYSGPPVPGHRSFKLADYPDAVAALRRGA
Ga0182037_1216123023300016404SoilIPNPAAIKSYSGPSEPGNKGYQLSSYPDAVAALKKGLG
Ga0182039_1058121533300016422SoilVLSVDIIPNPPIIKSYSGPSEPGSKPYQLSGYPDAVAALKQGLG
Ga0182038_1190683813300016445SoilAGYQLVLGVDIVPNPPAIKPYSGPPEPGKGPYQLSSYPDAVAALRQGLR
Ga0187802_1045859613300017822Freshwater SedimentDSQWVSDSADEPVLAPWQQAGYQLILSVPIIPNPPSIPSYSGPPQPGGVPYQIANYPDAVAALRKGA
Ga0187818_1001235513300017823Freshwater SedimentIPDPATIKSYSGPPEPGNRPYQLSSYPDAVIALIQGLG
Ga0187807_121557323300017926Freshwater SedimentHAGYQLVLSVDIIPNPPATKPYSGPPEPGNKGYQLSDYPNAVAELKQGLG
Ga0187806_113508613300017928Freshwater SedimentGAGYQLVLSVNIIPDPATIKSYSGPPEPGNRPYQLSSYPDAVIALIQGLG
Ga0187801_1006170333300017933Freshwater SedimentLSVDIIPNPPIIKSYSGPPEPGSKPYQLSGYPDAVAALKQALG
Ga0187801_1010345323300017933Freshwater SedimentLSVDIIPNPPIIKSYSGPPEPGSKPYQLSGYPDAVAALKQGLG
Ga0187809_1007398723300017937Freshwater SedimentISNATAQPVLAPWENAGYQLVLSVDVVPNPPSIKSYSGPPGNKPYQLADYPDAVTALKQGLG
Ga0187809_1022338913300017937Freshwater SedimentATAQPVLAPWENAGYQLVLSVDIIPNPPAIKSYSGPSEPGNKGYQLSSYPDAVAALKQGL
Ga0187819_1062811713300017943Freshwater SedimentAGYRLVLSVDIIPNPPTIKSYSGPPEPGNKPYQLSGYPDAVAALKQGLG
Ga0187819_1086135913300017943Freshwater SedimentDQPVLAPWEYAGYQLILSVPIVPNPPAIKSYSGPPEPGNKRYQLANYPDAVAALRRGA
Ga0187817_1100981023300017955Freshwater SedimentEHAGYQLVLSVDIIPNPPATKPYSGPPEPGNKGYQLSGYPNAVAELKQGLG
Ga0187779_1021826813300017959Tropical PeatlandLVLSVDIIPNTPVIKSYSGPPEPGNKPYQLSSYPDAVAALKQGLG
Ga0187779_1055540113300017959Tropical PeatlandQLVLSVDIIPNPPVIKSYSGPSEPGGEPYHLSSYPDAVTALEQGLR
Ga0187778_1103925813300017961Tropical PeatlandAGYQLVLSVDIIPNPPATQSYSGPPEPGNKGYQLSGYPDAVTALRQGLG
Ga0187778_1131618413300017961Tropical PeatlandKSYSGPSEPGNKGYQLSSYPDAVAALKQGLTTASPTG
Ga0187780_1036176513300017973Tropical PeatlandGYQLVLSVDIIPNPPATQSYSGPPEPGNKGYQLSGYPDAVTALRQGLG
Ga0187777_1031851713300017974Tropical PeatlandISDATAQPVLAPWENAGYQLVLSVDIIPNPPAIKSYSGPPEPGNKGYQLSSYPDAVAALKQGLG
Ga0187782_1027662013300017975Tropical PeatlandDIIPNPPATKSYSGPPEPGNKGYQLSDYPDAVAALKQGLG
Ga0187815_1050410313300018001Freshwater SedimentQPVLAPWENAGYQLVLSVDVVPNPPSIKSYSGPSGNKPYQLADYPDAVTALKQGLG
Ga0187805_1001225513300018007Freshwater SedimentAQPLLAPWEGAGYQLVLSVNIIPDPATIKSYSGPPEPGNRPYQLSSYPDAVIALIQGLG
Ga0187784_1056050513300018062Tropical PeatlandENAGYQLILSVDIISNSPTTKSYSGPPEPGDKPYQLSDYPDAVAALKQGLR
Ga0187772_1071194723300018085Tropical PeatlandLEDQEPISDAAAQPVLAPWQNAGYQLVLSVDVIPTPPATKSYSGPPEPGDKPYQLSDYPDAVAALRQGLG
Ga0187772_1126169223300018085Tropical PeatlandVIPNPPATKSYSGPPEPGDRPYQLSGYPGAVAALRQGLG
Ga0187769_1040659013300018086Tropical PeatlandLAPWQQAGYQLILSVPIVPNPPAIKSYSGPPEPGKKPYQLSDYPDAVAALQQGA
Ga0187769_1145395623300018086Tropical PeatlandVLAPWEHAGYRLVLSVPIVPNPPTIKSYSGPPEPEKKTYQLADYPDAVAALRHGA
Ga0187771_1144717113300018088Tropical PeatlandEATAQPVLAPWENAGYQLVLSVDIIPNPPTIKSYSGPPEPGNRPYQLSNYPDAVTALKQGLG
Ga0187770_1025847233300018090Tropical PeatlandGYQLVLSVDVIPNPPATKSYSGPPEPGDRPYQLSDYPGAVAALRQGLG
Ga0187770_1098386313300018090Tropical PeatlandHSGYQLVLSVDIVPNAPATKSYSGPAEPGEQPYQLSGYPDAVAALRQGLR
Ga0187770_1133774823300018090Tropical PeatlandLGVDIVPNPPATKSYSGPAEPGKQPYQLSGYPDAVAALRQGLG
Ga0210403_1076388913300020580SoilNVDIIPNPPVIKSYSGPAEPGSKPYQLSGYPDAVAALKQGLR
Ga0210399_1092246823300020581SoilWEHAGYRLILSVPLVLNPPAIKSYSGPPEPGNKLYQLAEYPDAVAALKQGAYPAGSG
Ga0210401_1130022423300020583SoilWENAGYQLVLSVDIIPNPPVIKSYSGPAEPGSKPYQLSGYPDAVAALKQGLG
Ga0210404_1004530233300021088SoilGYQLVLSVDIIPNPPVIKSYSGPAEPGSKPYQLSGYPDAVAALKQGLR
Ga0210404_1054809033300021088SoilENAGYQLVLCVDIIPNPPAIKSYSGPPQPGDKPYQLADYPDAVAALRQGLR
Ga0210396_1136411123300021180SoilYRLILSVPMVPNPPAIKSYSGPPEPGNKPYQLADYPDAVAALKKGA
Ga0210388_1100190223300021181SoilIVPNPPAIKSYSGPPEPGNKPYQLRDYPDAVAALKKGA
Ga0210397_1052431533300021403SoilSKVQQVLGPWEHAGYRLILSVPLVRNPPTIKSYSGPPEPGNKLYQLAEYPDAVAALKQGAYPAGSG
Ga0210397_1063819413300021403SoilWEHAGYRLILSVPLVPNPPAIKSYSGPPEPGNRVYQLADHPDAVAALRKGA
Ga0210383_1030728923300021407SoilTAQPVLAQWEHAGYRLVLGVNIIPNPPAIKSYSGPPQPGDKPYQLADYPDAVAALRQGLG
Ga0210383_1095806623300021407SoilQLVLSVDIIPNPPIIKSYSGPAEPGSKPYQLSGYPDAVAALKKGLG
Ga0210384_1151092613300021432SoilWFSASVDQPVLVPWVNSGYRLILSVPLVPNPPSIKSYSGPPEPGNKEYQLANYPDAVAALKQGV
Ga0210390_1038113823300021474SoilLGVDIIPNPPVIKSYSGPSEPGSKPYQLSAYPDAIAALRPK
Ga0210390_1079957033300021474SoilLVLSVNIIPDPSTIKSYSGPPEPGNKPYQLSNYPDAVTALIQGLG
Ga0210398_1103139823300021477SoilLAPWENAGYQLVLGVDIIPNPPVIKSYSGPSEPGSKPYQLSAYPDAIAALRPK
Ga0210409_1136674713300021559SoilGYQLVLSVDIIPNPPIIKSYSGPAEPGSKPYQLSGYPDAVAALKKGLG
Ga0212123_1043801923300022557Iron-Sulfur Acid SpringIIPNPPVIKSYSGPAEPGSKPYQLAGYPDAVAALSQGLR
Ga0247794_1022949023300024055SoilPSEEVDQPVLAPWQHAGYQLILSVPMIPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQGR
Ga0247678_104364113300024325SoilQPVLAPWENAGYQLVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAIAALKHGPG
Ga0247668_105095113300024331SoilENAGYQLVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAVAALKHGPG
Ga0207699_1073605113300025906Corn, Switchgrass And Miscanthus RhizosphereKWPSASSAQPVLAPWLHAGYRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALRQGA
Ga0207699_1118264213300025906Corn, Switchgrass And Miscanthus RhizosphereNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA
Ga0207663_1006011113300025916Corn, Switchgrass And Miscanthus RhizosphereLAPWLHAGYRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALRQGA
Ga0207663_1020592933300025916Corn, Switchgrass And Miscanthus RhizosphereDQPVLAPWEHAGYRLILSVPLVPNPPTIKSYSGPPEPGNRSYQLVDYPDSVAALRQGA
Ga0207663_1162454823300025916Corn, Switchgrass And Miscanthus RhizosphereWQHAGYQLILSVPMFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA
Ga0207694_1078361923300025924Corn RhizosphereVLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAIAALKHGPG
Ga0207694_1126858423300025924Corn RhizosphereSVPIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA
Ga0207700_1109151713300025928Corn, Switchgrass And Miscanthus RhizospherePNPPTIKSYSGPPEPGNRVYQLADYPDAVAALRKGA
Ga0207700_1109153613300025928Corn, Switchgrass And Miscanthus RhizosphereGKWPSASSAEPVLAPWLHTGYRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALRQGA
Ga0207644_1112587123300025931Switchgrass RhizosphereSEEADQPVLAPWQHAGYQLILSVPIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA
Ga0207669_1075246113300025937Miscanthus RhizosphereAGYQVILSVPMIPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA
Ga0207665_1020673423300025939Corn, Switchgrass And Miscanthus RhizosphereRLVLSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDAVAALRQGA
Ga0207679_1119402723300025945Corn RhizosphereLSVDIIPNPPAIKSYSGPPEPGNKPYQLSSYPDAIAALKHGPG
Ga0207712_1153582613300025961Switchgrass RhizospherePSEKADQPVLAPWQHAGYQLILSVPIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA
Ga0207668_1161363413300025972Switchgrass RhizosphereIPNPTAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA
Ga0207677_1099098513300026023Miscanthus RhizosphereILSVPMIPNPPAIKSYSGPPEPGNKSYQLAAYPDVVAALRQGA
Ga0207683_1000633713300026121Miscanthus RhizosphereYQLILSVPIFPNPPAIKSYSGPAEPGNKSYQLADYPDVVAALRQGA
Ga0207806_103548423300027049Tropical Forest SoilAPWEHAGYQLILSVDIIPNPPAIKPYSGPSEIKPYQLSSYPDAVAALRQGLG
Ga0208099_104948113300027096Forest SoilVLSVPLVPNPSVIPSYSGPPEPDDQPYQLANYPDAVAALAQGAALDRRA
Ga0208241_107845113300027297Forest SoilPNPPVIKSYSGPSEPGSKPYQLSGYPDAVAALKKGLG
Ga0208890_106582723300027523SoilPSEKADQPVLAPWQHAGYQLILSVPIIPNPPAIKSYSGPPEPGHKSYQLADYPDAVAVLRQSGR
Ga0209221_109801723300027609Forest SoilLAPWEHAGYQVILSVPIVPLPPTVKSYSGPPEPGNKPYQLADYPDAVAALQRGAAGS
Ga0207862_103774513300027703Tropical Forest SoilLVPWERAGYQLILSVPIVPNPPAIKSYSGPPEPGKKPYQLANYPDAVAALRQGA
Ga0209177_1020228213300027775Agricultural SoilPIFPNPPAIKSYSGPPEPGNKSYQLADYPDVVAALRQGA
Ga0209167_1007559813300027867Surface SoilALAPWENAGYQLVLSVDIIPNPPVVKSYSGPAEPGNKPYQLSGYPDAVAALKQGLG
Ga0209061_110126113300027968Surface SoilQLILSVPVIPNPPAIESYSGPPEPGNRPYQLAGYPDAVAALRQGA
Ga0268266_1033530623300028379Switchgrass RhizosphereHEWPSEEADQPVLAPWQHAGYQLILSVPIFPNPPAIKSYSGPAEPGNKSYQLADYPDVVAALRQGA
Ga0307311_1019445823300028716SoilQLILSVPIVPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQGG
Ga0307306_1010602513300028782SoilQPVLAPWVHAGYQLILSVPIVPNPPAIKSYSGPPEPGHKSYQLADYPDAVAALRQGG
Ga0307323_1012597623300028787SoilVLAPWQHAGYQLILSVPMIPNPPAIKSYSGPPEPGHKSYQLADYPDVVAALRQGA
Ga0307289_1005614723300028875SoilKADQPVLAPWQHAGYQLILSVPMIPNPPAIKSYSGPPEPGHKSYQLADYPDVVAALRQGA
Ga0311340_1118269813300029943PalsaVPIDPLPPTIKSYSGPPEPGDKPYQLADYPDAIAAIKQGL
Ga0311340_1146487513300029943PalsaSDSTDQAVLAPWENAGYRVILSVPIVPLPPAIKSYSGPPEPGGKPYQLADYPDAVAAIKQGL
Ga0311339_1089306633300029999PalsaNTGYQVILSVPIDPLPPTIKSYSGPPEPGDKPYQLADYPDAIAAIKQGL
Ga0302179_1026121613300030058PalsaILSVPIDPLPPTIKSYSGPPEPGDKPYQLADYPDAIAAIKQGL
Ga0311356_1065700323300030617PalsaQAVLAPWENAGYRVILSVPIVPLPPAIKSYSGPPEPGNKPYQLADYPDAVAAIKHGL
Ga0302325_1260660423300031234PalsaSVPIDPLPPTIKSYSGPPEPGDKPYQLADYPDAVAAIKQGL
Ga0318528_1018962213300031561SoilYQLILSVPLVPNPPAIKSYSGPPEPGHKPYQLADYPDAVAALRQGA
Ga0310915_1128817013300031573SoilVDIIPNPPATKSYSGPPEPGNKGYQLSGYPDAVTALRQGLG
Ga0318494_1072591023300031751SoilSTDQPVLAPWEHSGYRLILSVPIVPNPPAIKSYSGPPEPGNKPYQLANYPDAIAALKQSA
Ga0318537_1019087733300031763SoilIIPNPAGTKSYSGPPEPGNKGYQLSGYPDAVTALQQGLR
Ga0318509_1042279523300031768SoilWEHSDYRLILSVPVVPNPPAIKSYSGPPEPGKKPYKLANYPDAVAALRQGA
Ga0318509_1071002713300031768SoilENAGYQLVLSVDIIPNPPVIKSYSGPPEPGSKPYQLYGYPDAVAALKQGLG
Ga0318521_1085363723300031770SoilWFSEKIDQPVLAPWMHAGYRLILSVPITPNPPAIKSYSGPPEPGHRSYQLADYPDSVAALRRGL
Ga0318521_1102701013300031770SoilAQPVLAPWENAGYRLVLSVDIIPNPPIIKSYSGPPEPGSKPYQISGYPDAVAALKQGLG
Ga0318498_1033378623300031778SoilYQLVLSVDIIPNPPVVKSYSGPPEPGNKPYQLSSYPDAVTALRQGLG
Ga0318529_1028391133300031792SoilVLAPWENAGYRLVLSVDIIPNPPIIKSYSGPSEPGSKPYQLSGYPDAVAALKQGLG
Ga0318565_1013796333300031799SoilTAQPVLAPWENAGYQLVLSVDIIPNPPVVKSYSGPPEPGKQPYQLSSYPDAVTALRQGLG
Ga0318565_1054335123300031799SoilPWEHAGYKLILSVPIVPNPPVIKSYSGPPEPGNKPYKLANYPDAVAALRQGA
Ga0318568_1071948513300031819SoilPWENAGYRLVLSVDIIPNPPIIKSYSGPSEPGSKPYQLSGYPDAVAALKQGLG
Ga0318567_1027139733300031821SoilDATAQPVLAPWENAGYQLVLSVDIIPNPPVVKSYSGPPEPGKQPYQLSSYPDAVTALRQGLG
Ga0318567_1085858213300031821SoilFSESLDQPVLTPWEHAGYNVILSVPMVPNPPAIKSYNGPPEPGNKTYQLADYPDAVAALRQGA
Ga0318527_1022314913300031859SoilRVLAPWEHAGYQLILSVPLVPNPPAIKSYSGPPEPGHRSYQLADYPDSVAALRRGL
Ga0318527_1030864613300031859SoilTWFSERIDQPVLAPWQHAGYRLILSVPMVPNPPAIKSYSGPPEPGHRAYQLADYPDSVAALRRGV
Ga0318495_1035869613300031860SoilDHEWLSDSIDQPVLAPWEHAGYKLILSVPIVPNPPAIKSYSGPPEPGKKPYKLANYPDAVAALRQGA
Ga0318536_1042131313300031893SoilQPVLAPWENAGYQLVLSVDIIPDPPIIKSYSGPPEPGSKPYQISGYPDAVAALKQGLG
Ga0318520_1017889523300031897SoilDQPWLVPWEHSDYRLILSVPVVPNPPAIKSYSGPPEPGKKPYKLANYPDAVAALRQGA
Ga0306921_1037230113300031912SoilHAGYNVILSVPMVPNPPAIKSYNGPPEPGNKTYQLADYPDAVAALRQGA
Ga0306921_1215981723300031912SoilYQLVLSVDIIPNPPVVKSYSGPPEPGKQPYQLSSYPDAVTALRQGLG
Ga0310912_1087652223300031941SoilERIDQPVLAPWQHAGYRLILSVPMVPNPPAIKSYSGPPEPGHRAYQLADYPDSVAALRRG
Ga0310916_1030398523300031942SoilRQWLSDSVDRPWLVPWEHSDYRLILSVPVVPNPPAIKSYSGPPEPGKKPYKLANYPDAVAALRQGA
Ga0310909_1128615523300031947SoilENAGYQLVLSVDIIPNPPATKSYSGPPEPGNKGYQLSGYPDAVTALRQGLG
Ga0308176_1052483513300031996SoilVPLVPNPPAIKSYSGPPEPGHKSYQLADYPDSVAALRRGV
Ga0318507_1051209623300032025SoilSDSVDRPWLVPWEHSDYRLILSVPVVPNPPAIKSYSGPPEPGKKPYKLANYPDAVAALRQGA
Ga0310911_1063233213300032035SoilYQLVLAVDIIPNPAAIKSYSGPSEPGNKGYQLSSYPDAVAALKKGLG
Ga0318545_1016861523300032042SoilPWLVPWEHSDYRLILSVPVVPNPPAIKSYSGPPEPGKKPYKLANYPDAVAALRQGA
Ga0318556_1058771713300032043SoilIIPDSPIIKSYSGPPEPGSKPYQLSGYPDAVAALKQGLG
Ga0318504_1007058413300032063SoilPWMHAGYRLILSVPITPNPPAIKSYSGPPEPGHRSYQLADYPDSVAALRRGL
Ga0318504_1036559423300032063SoilSVPITPNPPAIKSYSGPPEPGHRSYQLADYPDSVAALRRGL
Ga0348332_1469794223300032515Plant LitterDIIPNPPIIKSYSGPSEPGSKPYQLSGYPGAVAALKQGLG
Ga0335082_1060216423300032782SoilILARWQHTRYRLILSVPMVPNPPEIKSYSGPPEPGHKSYQLADYPDSVAALRRGVQR
Ga0335080_1053209213300032828SoilLGVDIIPNPPAVKPYSGPPEPGNKPYQLSSYPDAVAALKQGLR
Ga0335074_1037069013300032895SoilVLAPWQGAGYRVILSVPMVPNPPAIKSYSGPPEPGNRPYQLADYPDAVAALRQGA
Ga0335075_1077200933300032896SoilLAPWEHAGYRLVLSVDIIPNPVTIKAYSGPPVPSHKQYQLSSYPDAVAALKQGLG
Ga0335075_1142310513300032896SoilRVDQAVLAPWQGAGYRVILSVPMVPNPPAIKSYSGPPEPGNRPYQLADYPDAVAALKQGA
Ga0335072_1114329123300032898SoilILSVPLVANPPAIKSYSGPPEPGNQPYQLIDYADAVAALRQGA
Ga0335083_1088481713300032954SoilVLAPWLHAGYRLILSVPMVPNPQEIKSYSGPPEPGHKQRKLADYPDVVAALQQGT
Ga0335073_1046813933300033134SoilYRLILSVPMVPNPPEIKSYSGPPEPGHKSYQLADYPDSVAALRRGV
Ga0335073_1080197923300033134SoilLSVNIIPDPLTIKSYSGPPEPGNKPYQLSDYPDAVAALQQGLG
Ga0335077_1055624133300033158SoilILSVPITPNPPAIKSYSGPPEPGHKSYQLADYPDSVAALRRGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.