Basic Information | |
---|---|
Family ID | F025979 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 199 |
Average Sequence Length | 41 residues |
Representative Sequence | FTFTKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA |
Number of Associated Samples | 148 |
Number of Associated Scaffolds | 199 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 94.97 % |
% of genes from short scaffolds (< 2000 bps) | 78.89 % |
Associated GOLD sequencing projects | 142 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (68.844 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (12.563 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.201 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.291 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 199 Family Scaffolds |
---|---|---|
PF10145 | PhageMin_Tail | 2.01 |
PF05065 | Phage_capsid | 0.50 |
COG ID | Name | Functional Category | % Frequency in 199 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.50 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.88 % |
Unclassified | root | N/A | 24.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001282|B570J14230_10182045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300001843|RCM34_1106500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300001850|RCM37_1350613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300001851|RCM31_10221038 | Not Available | 515 | Open in IMG/M |
3300002040|GOScombined01_106374718 | Not Available | 1063 | Open in IMG/M |
3300003616|JGI25928J51866_1133854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300004770|Ga0007804_1020756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1826 | Open in IMG/M |
3300005527|Ga0068876_10039670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2907 | Open in IMG/M |
3300005527|Ga0068876_10054519 | All Organisms → Viruses → Predicted Viral | 2432 | Open in IMG/M |
3300005528|Ga0068872_10039894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2995 | Open in IMG/M |
3300005528|Ga0068872_10150665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1355 | Open in IMG/M |
3300005662|Ga0078894_10047597 | Not Available | 3620 | Open in IMG/M |
3300005662|Ga0078894_10218777 | Not Available | 1725 | Open in IMG/M |
3300006108|Ga0007862_1006447 | All Organisms → Viruses → Predicted Viral | 2854 | Open in IMG/M |
3300006639|Ga0079301_1201713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300006875|Ga0075473_10236751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300007165|Ga0079302_1026338 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
3300007171|Ga0102977_1064536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1499 | Open in IMG/M |
3300007177|Ga0102978_1152884 | Not Available | 1038 | Open in IMG/M |
3300007545|Ga0102873_1026219 | Not Available | 1788 | Open in IMG/M |
3300007559|Ga0102828_1178867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300007597|Ga0102919_1033390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1593 | Open in IMG/M |
3300007624|Ga0102878_1093216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300007625|Ga0102870_1094919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
3300007632|Ga0102894_1216336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300007642|Ga0102876_1060628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
3300007708|Ga0102859_1208758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300007972|Ga0105745_1185422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300008055|Ga0108970_11061750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3549 | Open in IMG/M |
3300008107|Ga0114340_1059229 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
3300008107|Ga0114340_1061844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
3300008107|Ga0114340_1070986 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
3300008107|Ga0114340_1081074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1340 | Open in IMG/M |
3300008107|Ga0114340_1104799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
3300008108|Ga0114341_10044662 | All Organisms → Viruses → Predicted Viral | 2923 | Open in IMG/M |
3300008110|Ga0114343_1004085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11952 | Open in IMG/M |
3300008110|Ga0114343_1019752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3006 | Open in IMG/M |
3300008110|Ga0114343_1058376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
3300008110|Ga0114343_1058934 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
3300008110|Ga0114343_1120029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300008113|Ga0114346_1028624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2930 | Open in IMG/M |
3300008113|Ga0114346_1028627 | All Organisms → Viruses → Predicted Viral | 4123 | Open in IMG/M |
3300008113|Ga0114346_1103054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1303 | Open in IMG/M |
3300008113|Ga0114346_1127517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
3300008113|Ga0114346_1280628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300008116|Ga0114350_1017981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2984 | Open in IMG/M |
3300008116|Ga0114350_1067407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2601 | Open in IMG/M |
3300008117|Ga0114351_1116386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1530 | Open in IMG/M |
3300008120|Ga0114355_1101136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
3300008258|Ga0114840_1059131 | Not Available | 595 | Open in IMG/M |
3300008259|Ga0114841_1043416 | All Organisms → Viruses → Predicted Viral | 2639 | Open in IMG/M |
3300008261|Ga0114336_1023130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3561 | Open in IMG/M |
3300008261|Ga0114336_1026670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3263 | Open in IMG/M |
3300008262|Ga0114337_1062544 | All Organisms → Viruses → Predicted Viral | 2699 | Open in IMG/M |
3300008448|Ga0114876_1093124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
3300008448|Ga0114876_1264487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300008996|Ga0102831_1054261 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
3300009026|Ga0102829_1181211 | Not Available | 681 | Open in IMG/M |
3300009050|Ga0102909_1006891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3115 | Open in IMG/M |
3300009058|Ga0102854_1089681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
3300009059|Ga0102830_1019302 | Not Available | 2149 | Open in IMG/M |
3300009159|Ga0114978_10650438 | Not Available | 605 | Open in IMG/M |
3300009164|Ga0114975_10280231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300009181|Ga0114969_10015051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5565 | Open in IMG/M |
3300009181|Ga0114969_10162257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
3300009181|Ga0114969_10162261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
3300009181|Ga0114969_10203106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
3300009221|Ga0103849_1052918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300009257|Ga0103869_10064876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300010354|Ga0129333_10235973 | Not Available | 1653 | Open in IMG/M |
3300010354|Ga0129333_10676938 | Not Available | 889 | Open in IMG/M |
3300010354|Ga0129333_11234455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300010354|Ga0129333_11483378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300010370|Ga0129336_10356115 | Not Available | 805 | Open in IMG/M |
3300010885|Ga0133913_11006508 | Not Available | 2154 | Open in IMG/M |
3300012970|Ga0129338_1389521 | Not Available | 599 | Open in IMG/M |
3300013087|Ga0163212_1058828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1276 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10195391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1280 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10282081 | Not Available | 1194 | Open in IMG/M |
3300013295|Ga0170791_13186786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
3300020074|Ga0194113_10210292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1547 | Open in IMG/M |
3300020109|Ga0194112_10100303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2600 | Open in IMG/M |
3300020151|Ga0211736_10185073 | Not Available | 2923 | Open in IMG/M |
3300020172|Ga0211729_10619546 | Not Available | 2885 | Open in IMG/M |
3300020196|Ga0194124_10290035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300020200|Ga0194121_10214740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
3300020214|Ga0194132_10488441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300020221|Ga0194127_10598211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300020486|Ga0208698_112255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300020498|Ga0208050_1015483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300020543|Ga0208089_1014850 | Not Available | 1182 | Open in IMG/M |
3300020549|Ga0207942_1002387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3173 | Open in IMG/M |
3300020561|Ga0207934_1022086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1074 | Open in IMG/M |
3300020578|Ga0194129_10061088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2776 | Open in IMG/M |
3300021376|Ga0194130_10602362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300021438|Ga0213920_1096758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300021961|Ga0222714_10076302 | Not Available | 2201 | Open in IMG/M |
3300021961|Ga0222714_10216217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
3300021963|Ga0222712_10187954 | All Organisms → Viruses → Predicted Viral | 1363 | Open in IMG/M |
3300021963|Ga0222712_10755213 | Not Available | 541 | Open in IMG/M |
3300023174|Ga0214921_10018033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 7772 | Open in IMG/M |
3300023184|Ga0214919_10256728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
3300024289|Ga0255147_1001825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 5207 | Open in IMG/M |
3300024346|Ga0244775_10121882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2209 | Open in IMG/M |
3300024346|Ga0244775_10200879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1673 | Open in IMG/M |
3300024346|Ga0244775_10919682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300024346|Ga0244775_11008964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300024348|Ga0244776_10283265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
3300024351|Ga0255141_1045820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300024352|Ga0255142_1007321 | Not Available | 1848 | Open in IMG/M |
3300024484|Ga0256332_1041407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300024500|Ga0255143_1003505 | Not Available | 2764 | Open in IMG/M |
3300024500|Ga0255143_1079277 | Not Available | 527 | Open in IMG/M |
3300024509|Ga0255175_1024635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1199 | Open in IMG/M |
3300024536|Ga0256338_1125722 | Not Available | 574 | Open in IMG/M |
3300024555|Ga0255280_1102550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300024559|Ga0255284_1127301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300024866|Ga0255272_1116483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300025382|Ga0208256_1028192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300025399|Ga0208107_1090839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300025413|Ga0208614_1067629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300025423|Ga0208746_1011240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1767 | Open in IMG/M |
3300025838|Ga0208872_1275456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300026566|Ga0256334_1041110 | Not Available | 1061 | Open in IMG/M |
3300026569|Ga0255277_1066735 | Not Available | 922 | Open in IMG/M |
3300026571|Ga0255289_1157170 | Not Available | 511 | Open in IMG/M |
3300027121|Ga0255074_1037951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300027156|Ga0255078_1029479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
3300027231|Ga0208172_1080380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300027260|Ga0208027_1023652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
3300027294|Ga0208441_1084064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300027339|Ga0255210_1095281 | Not Available | 546 | Open in IMG/M |
3300027467|Ga0255154_1081118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300027499|Ga0208788_1111036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300027508|Ga0255072_1027504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
3300027529|Ga0255077_1036094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
3300027578|Ga0255075_1013920 | Not Available | 1606 | Open in IMG/M |
3300027581|Ga0209651_1132615 | Not Available | 684 | Open in IMG/M |
3300027621|Ga0208951_1109776 | Not Available | 746 | Open in IMG/M |
3300027621|Ga0208951_1197571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300027631|Ga0208133_1078497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300027720|Ga0209617_10071094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1434 | Open in IMG/M |
3300027734|Ga0209087_1020014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3294 | Open in IMG/M |
3300027746|Ga0209597_1343516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300027753|Ga0208305_10042675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1778 | Open in IMG/M |
3300027754|Ga0209596_1002944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13715 | Open in IMG/M |
3300027756|Ga0209444_10060966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1663 | Open in IMG/M |
3300027763|Ga0209088_10156873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
3300027793|Ga0209972_10036990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2768 | Open in IMG/M |
3300027793|Ga0209972_10189380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300027793|Ga0209972_10225541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300027816|Ga0209990_10262764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300027892|Ga0209550_10128932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1838 | Open in IMG/M |
3300027892|Ga0209550_10328219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300027969|Ga0209191_1163480 | Not Available | 900 | Open in IMG/M |
3300028025|Ga0247723_1112293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
(restricted) 3300028114|Ga0247835_1174242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300028258|Ga0255214_1045392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300028394|Ga0304730_1267474 | Not Available | 607 | Open in IMG/M |
3300031758|Ga0315907_10147146 | All Organisms → Viruses → Predicted Viral | 1997 | Open in IMG/M |
3300031758|Ga0315907_10504771 | Not Available | 956 | Open in IMG/M |
3300031758|Ga0315907_10541652 | Not Available | 913 | Open in IMG/M |
3300031787|Ga0315900_10094528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2933 | Open in IMG/M |
3300031787|Ga0315900_10260327 | All Organisms → Viruses → Predicted Viral | 1473 | Open in IMG/M |
3300031787|Ga0315900_10424771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1038 | Open in IMG/M |
3300031787|Ga0315900_10882185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300031857|Ga0315909_10363005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
3300031857|Ga0315909_10765577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300031951|Ga0315904_10406818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
3300031951|Ga0315904_10467238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1122 | Open in IMG/M |
3300031951|Ga0315904_10653675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
3300031963|Ga0315901_10757800 | Not Available | 710 | Open in IMG/M |
3300032050|Ga0315906_10055972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4084 | Open in IMG/M |
3300032050|Ga0315906_10267522 | Not Available | 1560 | Open in IMG/M |
3300032050|Ga0315906_10355331 | Not Available | 1295 | Open in IMG/M |
3300032050|Ga0315906_10811823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300032050|Ga0315906_11240000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300032093|Ga0315902_10458511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
3300032093|Ga0315902_10483024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1085 | Open in IMG/M |
3300032093|Ga0315902_11036942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300032116|Ga0315903_10511400 | Not Available | 945 | Open in IMG/M |
3300032116|Ga0315903_10511525 | Not Available | 945 | Open in IMG/M |
3300032677|Ga0316227_1126405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
3300033996|Ga0334979_0134337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1510 | Open in IMG/M |
3300034061|Ga0334987_0046772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3626 | Open in IMG/M |
3300034061|Ga0334987_0379104 | Not Available | 904 | Open in IMG/M |
3300034066|Ga0335019_0375441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300034106|Ga0335036_0776928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300034108|Ga0335050_0174562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300034109|Ga0335051_0163045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1130 | Open in IMG/M |
3300034120|Ga0335056_0118230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1609 | Open in IMG/M |
3300034168|Ga0335061_0131199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
3300034200|Ga0335065_0182815 | Not Available | 1379 | Open in IMG/M |
3300034356|Ga0335048_0166686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 12.56% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.56% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 11.06% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.54% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.04% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.53% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.53% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.02% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.02% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.51% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.51% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.01% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.51% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.51% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.51% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.00% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.00% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.00% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.50% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.50% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.50% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.50% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.50% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.50% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.50% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.50% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009221 | Microbial communities of water from Amazon river, Brazil - RCM2 | Environmental | Open in IMG/M |
3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020486 | Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025399 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027231 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027260 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027294 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027339 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
3300028258 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8d | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J14230_101820452 | 3300001282 | Freshwater | YDIQGHTFTKEHPFVAMDPKTAQEIFDKEEGFRLATPKEVQEYYN* |
RCM34_11065002 | 3300001843 | Marine Plankton | TKDHPFVAMSEEDAQKIFDSEEGFRLATPKEVQDFYN* |
RCM37_13506133 | 3300001850 | Marine Plankton | VQGYTFTTEHPFVAMPESDAQSVFDSQTGFRLATPRE |
RCM31_102210382 | 3300001851 | Marine Plankton | IQGFTFTKEHPFVAMSSNKAQLICNKEEGFRLATPAEVQEFYS* |
GOScombined01_1063747183 | 3300002040 | Marine | MGYVFTKEHPFIAMSESEAQSIFDTEIGFRPATPKEAQNFIVNRG* |
JGI25928J51866_11338542 | 3300003616 | Freshwater Lake | HRYDALGFTFTKEHPFVAMSSEAAQEIFDKEEGFRLATPREVQDFYS* |
Ga0007804_10207561 | 3300004770 | Freshwater | GYIFTQEHPFMAMSETDAQKIFDTQAGFRLATPREAQEYYA* |
Ga0068876_100396701 | 3300005527 | Freshwater Lake | EHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN* |
Ga0068876_100545191 | 3300005527 | Freshwater Lake | DHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYN* |
Ga0068872_100398945 | 3300005528 | Freshwater Lake | MGHTFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0068872_101506653 | 3300005528 | Freshwater Lake | TKEHPFVAMHKADAQKIFDKEEGFRLATPKEVQEYYN* |
Ga0078894_100475976 | 3300005662 | Freshwater Lake | DILGFTFTKEHPFVAMTEDNAQEIFDKEEGFRLATPKEVQEYYA* |
Ga0078894_102187774 | 3300005662 | Freshwater Lake | HPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0007862_10064476 | 3300006108 | Freshwater | YTFTREHPFVAMSESEAQAIFDHQDGFRLATPREAQEFYA* |
Ga0007859_11007072 | 3300006118 | Freshwater | QHPFVAMPEEHAQQIFDTQIGFRLATPREAQEFYS* |
Ga0079301_12017131 | 3300006639 | Deep Subsurface | TFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN* |
Ga0075473_102367511 | 3300006875 | Aqueous | ALGFTFTREHPFVAMMPDVAQEIFDKEEGFRLATPREVQEYYN* |
Ga0079302_10263381 | 3300007165 | Deep Subsurface | RYDIMGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN* |
Ga0102977_10645361 | 3300007171 | Freshwater Lake | TRANFRYDIMGHTFTKEHPFVAMAQDKAQAIFDKEEGFRLATPKEVQEFYN* |
Ga0102978_11528842 | 3300007177 | Freshwater Lake | GHTFTKEHPFVAMDKDTAQAIFDKEEGFVMATPKEVQEFYN* |
Ga0102873_10262194 | 3300007545 | Estuarine | GFTFTKEHPFVAIPSVKAEEIFEKEEGFRLATATEVQDFYA* |
Ga0102828_11788672 | 3300007559 | Estuarine | HTFTKEHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYH* |
Ga0102913_12184672 | 3300007560 | Estuarine | TFGYSFSQEHPFVAMPMETAMEIFDTQEGFRLATPREVNEYYS* |
Ga0102919_10333901 | 3300007597 | Estuarine | TFTKEHPFIAMTEEDAQKIFDKEEGFRIATPKEVQEYYA* |
Ga0102878_10932162 | 3300007624 | Estuarine | TFTKEHPFVAMTSEDAQEIFDKEEGFRLATPKEVQEYYA* |
Ga0102870_10949192 | 3300007625 | Estuarine | YDIVGFTFTKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA* |
Ga0102894_12163361 | 3300007632 | Estuarine | TKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA* |
Ga0102876_10606282 | 3300007642 | Estuarine | GFTFTKEHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0102902_11463781 | 3300007644 | Estuarine | EHPFVAMRMEDALEILDTEEGFRLASPREVNEYYS* |
Ga0102859_12087581 | 3300007708 | Estuarine | KDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN* |
Ga0105745_11854221 | 3300007972 | Estuary Water | KEHPFIAMSNEEAQAIFDKEEGFRLATPREVQEYYN* |
Ga0108970_110617501 | 3300008055 | Estuary | EHPFVAMKPDVAQEIFDKEEGFRLATPREVQEYYN* |
Ga0114340_10592291 | 3300008107 | Freshwater, Plankton | DHPFVAMKDKEAQSIFDKEEGFRLATPKEVQEFYN* |
Ga0114340_10618441 | 3300008107 | Freshwater, Plankton | KEHPFVAMNKDDAQKIFDKEEGFRLATPKEVQEYYN* |
Ga0114340_10709863 | 3300008107 | Freshwater, Plankton | HTFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0114340_10810741 | 3300008107 | Freshwater, Plankton | YTFTKEHPFIAMKEEDAQKIFDVEEGFRLATPREAQEFYS* |
Ga0114340_11047991 | 3300008107 | Freshwater, Plankton | HPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN* |
Ga0114341_100446621 | 3300008108 | Freshwater, Plankton | TKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN* |
Ga0114343_10040851 | 3300008110 | Freshwater, Plankton | YDIQGFTFTKEHPYIAMNKEQAQAIFDKEAGFRLATPKEVQEFYH* |
Ga0114343_10197526 | 3300008110 | Freshwater, Plankton | HPFIAMSKEYAQEIFDKEDGFRLATPKEVQEYYN* |
Ga0114343_10583763 | 3300008110 | Freshwater, Plankton | EHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN* |
Ga0114343_10589341 | 3300008110 | Freshwater, Plankton | DHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0114343_11200292 | 3300008110 | Freshwater, Plankton | FTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN* |
Ga0114346_10286245 | 3300008113 | Freshwater, Plankton | YDIMGFTFTKEHPFIAMNNETAQAIFDKEEGFRLATPREVQEYYN* |
Ga0114346_10286275 | 3300008113 | Freshwater, Plankton | MGFTFTKEHPFIAMNNETAQAIFDKEEGFRLATPREVQEYYN* |
Ga0114346_11030541 | 3300008113 | Freshwater, Plankton | RDNFRYDIMGFTFTKEHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN* |
Ga0114346_11275171 | 3300008113 | Freshwater, Plankton | HPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0114346_12806282 | 3300008113 | Freshwater, Plankton | IMGVTFTKEHPFVAMSRDDAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0114350_10179815 | 3300008116 | Freshwater, Plankton | RFTKDHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYN* |
Ga0114350_10674071 | 3300008116 | Freshwater, Plankton | YDIMGFTFTKEHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN* |
Ga0114351_11163863 | 3300008117 | Freshwater, Plankton | KEHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0114355_11011361 | 3300008120 | Freshwater, Plankton | TMGYTFTQEHPFVAMSEDEAQAIFDKEEGFRLATPKEAQDFYN* |
Ga0114840_10591311 | 3300008258 | Freshwater, Plankton | FTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0114841_10434167 | 3300008259 | Freshwater, Plankton | TKEHPFVAMHKDDAQKIFDKEEGFRLATPKEVQEYYN* |
Ga0114336_10231301 | 3300008261 | Freshwater, Plankton | EHPFVAMTEEDAQKIFDKEEGFRIATPKEVQDYYA* |
Ga0114336_10266701 | 3300008261 | Freshwater, Plankton | TRDNFRYDIQGHTFTKEHPFVALTEAEAQKIFDVEEGFRVATPKEVQEFYN* |
Ga0114337_10625441 | 3300008262 | Freshwater, Plankton | DIMGFTFTKEHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0114876_10931241 | 3300008448 | Freshwater Lake | HPFVAMHKADAQKIFDKEEGFRLATPKEVQEYYN* |
Ga0114876_12644871 | 3300008448 | Freshwater Lake | FTFTKEHPFVAMQEEQAQEIFDKEEGFRLATPKEVQEYYG* |
Ga0102831_10542613 | 3300008996 | Estuarine | TFTKDHPFVAMSEEDAQKIFDSEEGFRLATPKEVQDFYN* |
Ga0102829_11812111 | 3300009026 | Estuarine | EHPFVAVSEDVAQEIFDKEEGFRLASPREVQEYYS* |
Ga0102909_10068916 | 3300009050 | Estuarine | FTKEHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYH* |
Ga0102854_10896811 | 3300009058 | Estuarine | KMDRSNSRYDALGFTFTREHPFVAMKPEVAQEIFDKEEGFRLATPREVQEYYN* |
Ga0102830_10193024 | 3300009059 | Estuarine | GFTFTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0114978_106504382 | 3300009159 | Freshwater Lake | RYDIMGFTFTKEHPFVALVSDKAQEIFDKEEGFRLANPKEVQDYYN* |
Ga0114975_102802311 | 3300009164 | Freshwater Lake | NEHPFVAMNEEDAQSIFDKEDGFRLATPKEVQEFYN* |
Ga0114969_100150519 | 3300009181 | Freshwater Lake | TFTQAHPFVAMKPDAAQEIFDKEDGFRLATPREVQEYYN* |
Ga0114969_101622571 | 3300009181 | Freshwater Lake | GYTFTKDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYS* |
Ga0114969_101622611 | 3300009181 | Freshwater Lake | GYTFTKDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN* |
Ga0114969_102031063 | 3300009181 | Freshwater Lake | LGFTFTKEHPFVAMTEDDAQEIFDKEEGFRLATPKEVQEYYA* |
Ga0103849_10529181 | 3300009221 | River Water | YTFTREHPFVAMSESDAQKIFDTQYGFRLATPREAQEYYS* |
Ga0103869_100648762 | 3300009257 | River Water | MGYTFTQQHPFVAMSEDDAQRIFDTQTGFRLATPREAQEFYS* |
Ga0129333_102359734 | 3300010354 | Freshwater To Marine Saline Gradient | HPFVAMDKDTAQAIFDKEEGFVVATPNEVQEFYN* |
Ga0129333_106769382 | 3300010354 | Freshwater To Marine Saline Gradient | HPFVAMKPEKAQQIFDKEEGFRLATPREVQEYYN* |
Ga0129333_112344551 | 3300010354 | Freshwater To Marine Saline Gradient | NFRYDIQGFTFTKEHPYVAMHKDYAQKIFDKEEGFRLATPKEVQDFYN* |
Ga0129333_114833782 | 3300010354 | Freshwater To Marine Saline Gradient | RANFRYDIMGFTFTREHPFVAMSNENAQAIFDKEEGFRLATPKEVQEFYN* |
Ga0129336_103561152 | 3300010370 | Freshwater To Marine Saline Gradient | EHPFVAMTKDQAQSIFDKEEGFRLANPTEVQSFYS* |
Ga0133913_110065081 | 3300010885 | Freshwater Lake | TFTKEHPFVAMSSDKAQAIFDKEEGFRPATPKEAQDFYS* |
Ga0129338_13895211 | 3300012970 | Aqueous | KEHPFVAMDKDTAQAIFDKEEGFVLATPKEVQEFYS* |
Ga0163212_10588281 | 3300013087 | Freshwater | FTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN* |
(restricted) Ga0172367_101953911 | 3300013126 | Freshwater | RYDIAGHTFTKEHPFVAMNPDVAQEIFDKEEGFRLATPREVQEYYN* |
(restricted) Ga0172372_102820811 | 3300013132 | Freshwater | FTKEHPFVAMNPDVAQEIFDKEEGFRLATPREVQEYYN* |
Ga0170791_131867861 | 3300013295 | Freshwater | IGFTFTKEHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN* |
Ga0194113_102102921 | 3300020074 | Freshwater Lake | FRYDTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN |
Ga0194112_101003031 | 3300020109 | Freshwater Lake | YDIAGHTFTKDHPFVAMNPNVAQEIFDKEEGFRLATPREVQEYYN |
Ga0211736_101850731 | 3300020151 | Freshwater | EHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN |
Ga0211729_106195461 | 3300020172 | Freshwater | FTFTKEHPFIAMTEENAQEIFDKEEGFRLATPNEVQEYYN |
Ga0194124_102900352 | 3300020196 | Freshwater Lake | YDTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN |
Ga0194121_102147401 | 3300020200 | Freshwater Lake | VGFTFTKEHPFVAMASEDAQKIFDKEEGFRLATPTEVQEYYS |
Ga0194132_104884411 | 3300020214 | Freshwater Lake | MGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN |
Ga0194127_105982111 | 3300020221 | Freshwater Lake | YRYDIAGHTFTKDHPFVAMNPNVAQEIFDKEEGFRLATPREVQEYYN |
Ga0208698_1122551 | 3300020486 | Freshwater | FTFTKDHPFVAMDKEKAQEIFDKEEGFRLATPKEVQEYYG |
Ga0208050_10154831 | 3300020498 | Freshwater | GHTFTKEHPFVAMNEKNAQEIFDKEEGFRLATPKEVQEYYN |
Ga0208089_10148501 | 3300020543 | Freshwater | RDHPFVAMKPDVAQEIFDKEEGFRLATPREVQEYYN |
Ga0207942_10023871 | 3300020549 | Freshwater | YTFTNDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN |
Ga0207934_10220862 | 3300020561 | Freshwater | KDHPFIAMNEKDAQSIFDKEEGFRLATPKEVQEFYS |
Ga0194129_100610885 | 3300020578 | Freshwater Lake | DTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN |
Ga0194130_106023622 | 3300021376 | Freshwater Lake | RYDTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN |
Ga0213920_10967581 | 3300021438 | Freshwater | VMGYTFSQQHPFVAMSEEDAQRIFDTQDGFRLATPREAQEFYA |
Ga0222714_100763021 | 3300021961 | Estuarine Water | FTKEHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN |
Ga0222714_102162172 | 3300021961 | Estuarine Water | IMGFTFTKEHPFIAMSNEQAQAIFDKEEGFRLATPREVQEYYN |
Ga0222712_101879541 | 3300021963 | Estuarine Water | FRYDIMGFTFTKEHPFVAMNKDDAQKIFDKEEGFRLATPKEDQEYYN |
Ga0222712_107552131 | 3300021963 | Estuarine Water | HTFTKDHPFVAMKEKEAQEIFDKEEGFRLATPKELQDFYG |
Ga0214921_100180331 | 3300023174 | Freshwater | KEHPFVAMTEDDAQEIFDKEEGFRLATPKEVQEYYA |
Ga0214919_102567281 | 3300023184 | Freshwater | HTFTREHPFIAMSEKDAQLIFDNEEGFRMATPKEVQDFYS |
Ga0255147_10018251 | 3300024289 | Freshwater | MTRPNYSYEIMGHTFTKEHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYN |
Ga0244775_101218821 | 3300024346 | Estuarine | TKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA |
Ga0244775_102008791 | 3300024346 | Estuarine | MRYDIHGRTFTKDHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYN |
Ga0244775_109196822 | 3300024346 | Estuarine | YDILGYTFTKDHPFVAMKEDDAQKIFDVEEGFRLATPKEAQEYYS |
Ga0244775_110089641 | 3300024346 | Estuarine | SHTFTKEHPFVAMTEEDAQKIFDTEEGFRLATPKEVQDFYH |
Ga0244776_102832651 | 3300024348 | Estuarine | HGHTFTKEHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYH |
Ga0255141_10458201 | 3300024351 | Freshwater | YDIAGFTFTKDHPFVAMKRDKAQWIFDKEAGFRLATPKEVQEFYG |
Ga0255142_10073214 | 3300024352 | Freshwater | NYSYEIMGHTFTKEHPFVAMDKDTAQAIFDKEEGFVMATPLEVQEFYN |
Ga0256332_10414072 | 3300024484 | Freshwater | EHPFVAMDKDTAQDIFDKEEGFRLATPKEVQEFYN |
Ga0255143_10035055 | 3300024500 | Freshwater | FTKEHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYN |
Ga0255143_10792771 | 3300024500 | Freshwater | TKEHPYIAMNKEQAQAIFDKEAGFRLATPKEVQEFYH |
Ga0255175_10246353 | 3300024509 | Freshwater | EFTFTKENPFIVMSEKDAQEIFDTQEGFRLATPKEVQEFYS |
Ga0256338_11257221 | 3300024536 | Freshwater | IMGHTFTKEHPFVAMDKDKAQAIFDKEEGFVMATPLEVQEFYN |
Ga0255280_11025502 | 3300024555 | Freshwater | VNEFTFTKENPFIVMSEKDAQEIFDTQEGFRLATPKEVQEFYS |
Ga0255284_11273011 | 3300024559 | Freshwater | NGYTFTKEHPFVAMPEDDAQKIFDKEEGFRLATPKEVQEYYS |
Ga0255272_11164831 | 3300024866 | Freshwater | KDHPFVAMKRDRAQWIFDKEAGFRLATPKEVQEFYG |
Ga0208256_10281921 | 3300025382 | Freshwater | GYIFTQEHPFMAMSETDAQKIFDTQAGFRLATPREAQEYYA |
Ga0208107_10908391 | 3300025399 | Freshwater | FQFTQEHPSLAMSEADAQKIFDTEQGFRLATPREAQEYYA |
Ga0208614_10676292 | 3300025413 | Freshwater | MGFEFSQEHPFVAMSETDAQKIFDTQDGFRIATPREAQEYYA |
Ga0208746_10112404 | 3300025423 | Freshwater | TQEHPFMAMSETDAQKIFDTQAGFRLATPREAQEYYA |
Ga0208872_12754561 | 3300025838 | Freshwater | TAGFEFTQEHPFVAMSETDAQRIFDTQEGFRIATPREAQEYYA |
Ga0256334_10411102 | 3300026566 | Freshwater | YEIMGHTFTKEHPFVAMDKDTAQAIFDKEEGFVMATPLEVQEFYN |
Ga0255277_10667351 | 3300026569 | Freshwater | RYDVLGFTFTKDHPFVAMPSEKAQQIFDKEEGFRLASPREVQEYYN |
Ga0255289_11571702 | 3300026571 | Freshwater | ANFRYDAMGFTFTKEHPFVAMPTEKAEEIFEKEEGFRLATPVEVREFYA |
Ga0255074_10379511 | 3300027121 | Freshwater | RYDIMGHTFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN |
Ga0255078_10294791 | 3300027156 | Freshwater | TREHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN |
Ga0208172_10803801 | 3300027231 | Estuarine | DIVGFTFTKEHPFIAMTEEDAQKIFDKEEGFRIATPKEVQEYYA |
Ga0208027_10236521 | 3300027260 | Estuarine | TFTKEHPFIAMTEEDAQKIFDKEEGFRIATPKEVQEYYA |
Ga0208441_10840641 | 3300027294 | Estuarine | TFAKEHPFVAMTEEDAQKIFDKEEGFRIATPKEVQDYYA |
Ga0255210_10952812 | 3300027339 | Freshwater | IRGYTFTKEHPFVAMDKDTAQAIFDKEEGFVLATPAEVQEFYN |
Ga0255154_10811182 | 3300027467 | Freshwater | DNFRYDIQGFTFTKEHPYIAMNKEQAQAIFDKEAGFRLATPKEVQEFYH |
Ga0208788_11110362 | 3300027499 | Deep Subsurface | FRYDIMGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0255072_10275041 | 3300027508 | Freshwater | IDGFTFTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN |
Ga0255077_10360941 | 3300027529 | Freshwater | IMGFTFTKEHPFIAMSKEYAQEIFDKEDGFRLATPKEVQEYYN |
Ga0208682_11481211 | 3300027531 | Estuarine | SFSQEHPFVAMRMEDALEILDTEEGFRLASPREVNEYYS |
Ga0255075_10139201 | 3300027578 | Freshwater | FTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN |
Ga0209651_11326151 | 3300027581 | Freshwater Lake | EHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYA |
Ga0208951_11097761 | 3300027621 | Freshwater Lentic | ITFTKEHPFVAVSEDVAQEIFDKEEGFRLASPREVQEYYS |
Ga0208951_11975712 | 3300027621 | Freshwater Lentic | GYTFTKDHPFVAMVEDDAQKIFDTEEGFRLATPKEVQDFYN |
Ga0208133_10784971 | 3300027631 | Estuarine | GFTFTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN |
Ga0209617_100710943 | 3300027720 | Freshwater And Sediment | EHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN |
Ga0209087_10200146 | 3300027734 | Freshwater Lake | YDIHGYTFTKDHPFVAMSEEDAQNIFDTEEGFRLATPKEVQDFYN |
Ga0209597_13435161 | 3300027746 | Freshwater Lake | LNYTFTKEHPFVAMTSEDAQEIFDKEEGFRLATPKEVQEYYA |
Ga0208305_100426754 | 3300027753 | Estuarine | FTFTKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA |
Ga0209596_10029441 | 3300027754 | Freshwater Lake | FTKDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN |
Ga0209444_100609661 | 3300027756 | Freshwater Lake | YRYDIFGYTFTKEHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN |
Ga0209088_101568732 | 3300027763 | Freshwater Lake | FTKDHPFIAMSEDDAQKIFDTEEGFRLATPKEVQDFYN |
Ga0209972_100369905 | 3300027793 | Freshwater Lake | FRYDILGHTFTKEHPFVAMDKSQAQAIFDKEEGFRLATPNEVQEFYN |
Ga0209972_101893802 | 3300027793 | Freshwater Lake | KEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0209972_102255411 | 3300027793 | Freshwater Lake | FRYDIMGFTFTKEHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN |
Ga0209990_102627641 | 3300027816 | Freshwater Lake | IMGFTFTKEHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN |
Ga0209550_101036374 | 3300027892 | Freshwater Lake | VFGYSFSQEHPFVAMPMEAAMELFDTQEGFRLATPREVNEYYS |
Ga0209550_101289321 | 3300027892 | Freshwater Lake | DHPFIAMSEDDAQKIFDTEEGFRLATPKEVQDFYN |
Ga0209550_103282192 | 3300027892 | Freshwater Lake | GFTFTLEHPFVAMKPDVAQEIFDKEEGFRLATPREVQEYYN |
Ga0209191_11634802 | 3300027969 | Freshwater Lake | FTQDHPFVAMHKDAAQEIFDKEEGFRLATPKEVQDYYG |
Ga0247723_11122932 | 3300028025 | Deep Subsurface Sediment | ANFRYDIMGHTFTSEHPFVAMDDKDAQAIFDKEEGFRLATPKEVQEFYN |
(restricted) Ga0247835_11742422 | 3300028114 | Freshwater | TKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0255214_10453921 | 3300028258 | Freshwater | RANYRYDIAGHTFTKEHPFVAMKPEKAQQIFDKEEGFRLATPKEVQEYYN |
Ga0304730_12674741 | 3300028394 | Freshwater Lake | KEHPFVPMPEDHAQRIFDGVQGFVLATPREVQEFYR |
Ga0315907_101471464 | 3300031758 | Freshwater | FTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN |
Ga0315907_105047711 | 3300031758 | Freshwater | FTREHPFVAMPADSAQAIFDKEEGFRLATPKEVQDFYH |
Ga0315907_105416521 | 3300031758 | Freshwater | DHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYS |
Ga0315900_100945281 | 3300031787 | Freshwater | FTFTKEHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN |
Ga0315900_102603273 | 3300031787 | Freshwater | EHPYIAMSQEDADFIFDTQIGFRMATPREVQEYYN |
Ga0315900_104247712 | 3300031787 | Freshwater | MGYTFTKEHPFVAMHKADAQKIFDKEEGFRLATPKEVQEYYN |
Ga0315900_108821852 | 3300031787 | Freshwater | GFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0315909_103630051 | 3300031857 | Freshwater | DIIGYTFTKEHPFIAMKEEDAQKIFDVEEGFRLATPREAQEFYS |
Ga0315909_107655772 | 3300031857 | Freshwater | GHTFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN |
Ga0315904_104068183 | 3300031951 | Freshwater | FTKEHPFIAMKEEDAQKIFDVEEGFRLATPREAQEFYS |
Ga0315904_104672382 | 3300031951 | Freshwater | FTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0315904_106536751 | 3300031951 | Freshwater | QHPYVAMSSEKAQAIFDKEDGFRLATPKEVQDFYS |
Ga0315901_107578001 | 3300031963 | Freshwater | DILGFTFTKEHPFVAMTKDQAQSIFDKEEGFRLANPTEVQSFYS |
Ga0315906_100559721 | 3300032050 | Freshwater | IQGFTFTKEHPYIAMNKEQAQAIFDKEAGFRLATPKEVQEFYH |
Ga0315906_102675221 | 3300032050 | Freshwater | TKDHPFVAMTSDKAQAIFDKEEGFRLATPTEVQEYYN |
Ga0315906_103553313 | 3300032050 | Freshwater | NFRYDILGFTFTKEHPFVAMKKDQAQAIFDKEEGFRLANPKEVQEFYS |
Ga0315906_108118232 | 3300032050 | Freshwater | TKEHPFVAMGKDDAQEIFDKEEGFRLATPKEVQEYYN |
Ga0315906_112400002 | 3300032050 | Freshwater | TFTKEHPFVAMKPEKAQQIFDKEEGFRLATPREVQEYYN |
Ga0315902_104585112 | 3300032093 | Freshwater | GYTFTKEHPFVAMHKADAQKIFDKEEGFRLATPKEVQEYYN |
Ga0315902_104830242 | 3300032093 | Freshwater | ILGFTFTKEHPFVAMTSEDAQEIFDKEEGFRLATPKEVQEYYG |
Ga0315902_110369421 | 3300032093 | Freshwater | DIMGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0315903_105114001 | 3300032116 | Freshwater | ILGHTFTREHPFVAMPADSAQAIFDKEEGFRLATPKEVQDFYH |
Ga0315903_105115251 | 3300032116 | Freshwater | TKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN |
Ga0316227_11264052 | 3300032677 | Freshwater | AAGYTFTSQHPFVAMPEEIAQNIFDTQVGFRLATPREAQEFYN |
Ga0334979_0134337_10_138 | 3300033996 | Freshwater | MGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0334987_0046772_3478_3624 | 3300034061 | Freshwater | NARYDALGFTFTRDHPFVAMKPDVAQEIFDKEEGFRLATPREVQEYYN |
Ga0334987_0379104_797_904 | 3300034061 | Freshwater | IHPFVAMHKDSAQQIFDKEEGFRLATPKEVQEYYG |
Ga0335019_0375441_2_121 | 3300034066 | Freshwater | TFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0335036_0776928_1_126 | 3300034106 | Freshwater | GFTFTKEHPFVAMNKEKAQAIFDKEEGFRLANPKEVQEFYS |
Ga0335050_0174562_1010_1141 | 3300034108 | Freshwater | IHGHTFTKEHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYH |
Ga0335051_0163045_1007_1129 | 3300034109 | Freshwater | HTFTKEHPFVAMKEEDAQAIFDKEEGFRLATPKEAQDFYH |
Ga0335056_0118230_1_123 | 3300034120 | Freshwater | FTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN |
Ga0335061_0131199_1204_1332 | 3300034168 | Freshwater | HGYTFTKDHPFIAMSEDDAQKIFDTEEGFRLATPKEVQDFYN |
Ga0335065_0182815_15_143 | 3300034200 | Freshwater | MGFTFTKDHPFVAMDKEKAQEIFDKEEGFRLANPKEVQEFYS |
Ga0335048_0166686_3_134 | 3300034356 | Freshwater | ALGFTFTKEHPFVAMSAEAAQEIFDKEEGFRLATPREVQDFYS |
⦗Top⦘ |