NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025979

Metagenome / Metatranscriptome Family F025979

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025979
Family Type Metagenome / Metatranscriptome
Number of Sequences 199
Average Sequence Length 41 residues
Representative Sequence FTFTKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA
Number of Associated Samples 148
Number of Associated Scaffolds 199

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.97 %
% of genes from short scaffolds (< 2000 bps) 78.89 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (68.844 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton
(12.563 % of family members)
Environment Ontology (ENVO) Unclassified
(40.201 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(58.291 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.47%    β-sheet: 0.00%    Coil/Unstructured: 73.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 199 Family Scaffolds
PF10145PhageMin_Tail 2.01
PF05065Phage_capsid 0.50

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 199 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.88 %
UnclassifiedrootN/A24.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10182045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300001843|RCM34_1106500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300001850|RCM37_1350613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300001851|RCM31_10221038Not Available515Open in IMG/M
3300002040|GOScombined01_106374718Not Available1063Open in IMG/M
3300003616|JGI25928J51866_1133854All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300004770|Ga0007804_1020756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1826Open in IMG/M
3300005527|Ga0068876_10039670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2907Open in IMG/M
3300005527|Ga0068876_10054519All Organisms → Viruses → Predicted Viral2432Open in IMG/M
3300005528|Ga0068872_10039894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2995Open in IMG/M
3300005528|Ga0068872_10150665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1355Open in IMG/M
3300005662|Ga0078894_10047597Not Available3620Open in IMG/M
3300005662|Ga0078894_10218777Not Available1725Open in IMG/M
3300006108|Ga0007862_1006447All Organisms → Viruses → Predicted Viral2854Open in IMG/M
3300006639|Ga0079301_1201713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300006875|Ga0075473_10236751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300007165|Ga0079302_1026338All Organisms → Viruses → Predicted Viral1438Open in IMG/M
3300007171|Ga0102977_1064536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1499Open in IMG/M
3300007177|Ga0102978_1152884Not Available1038Open in IMG/M
3300007545|Ga0102873_1026219Not Available1788Open in IMG/M
3300007559|Ga0102828_1178867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300007597|Ga0102919_1033390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1593Open in IMG/M
3300007624|Ga0102878_1093216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300007625|Ga0102870_1094919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage871Open in IMG/M
3300007632|Ga0102894_1216336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300007642|Ga0102876_1060628All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1047Open in IMG/M
3300007708|Ga0102859_1208758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300007972|Ga0105745_1185422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300008055|Ga0108970_11061750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3549Open in IMG/M
3300008107|Ga0114340_1059229All Organisms → Viruses → Predicted Viral1649Open in IMG/M
3300008107|Ga0114340_1061844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1604Open in IMG/M
3300008107|Ga0114340_1070986All Organisms → Viruses → Predicted Viral1465Open in IMG/M
3300008107|Ga0114340_1081074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1340Open in IMG/M
3300008107|Ga0114340_1104799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1124Open in IMG/M
3300008108|Ga0114341_10044662All Organisms → Viruses → Predicted Viral2923Open in IMG/M
3300008110|Ga0114343_1004085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11952Open in IMG/M
3300008110|Ga0114343_1019752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3006Open in IMG/M
3300008110|Ga0114343_1058376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1460Open in IMG/M
3300008110|Ga0114343_1058934All Organisms → Viruses → Predicted Viral1451Open in IMG/M
3300008110|Ga0114343_1120029All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300008113|Ga0114346_1028624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2930Open in IMG/M
3300008113|Ga0114346_1028627All Organisms → Viruses → Predicted Viral4123Open in IMG/M
3300008113|Ga0114346_1103054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1303Open in IMG/M
3300008113|Ga0114346_1127517All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1402Open in IMG/M
3300008113|Ga0114346_1280628All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300008116|Ga0114350_1017981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2984Open in IMG/M
3300008116|Ga0114350_1067407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2601Open in IMG/M
3300008117|Ga0114351_1116386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1530Open in IMG/M
3300008120|Ga0114355_1101136All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1133Open in IMG/M
3300008258|Ga0114840_1059131Not Available595Open in IMG/M
3300008259|Ga0114841_1043416All Organisms → Viruses → Predicted Viral2639Open in IMG/M
3300008261|Ga0114336_1023130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3561Open in IMG/M
3300008261|Ga0114336_1026670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3263Open in IMG/M
3300008262|Ga0114337_1062544All Organisms → Viruses → Predicted Viral2699Open in IMG/M
3300008448|Ga0114876_1093124All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1219Open in IMG/M
3300008448|Ga0114876_1264487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300008996|Ga0102831_1054261All Organisms → Viruses → Predicted Viral1343Open in IMG/M
3300009026|Ga0102829_1181211Not Available681Open in IMG/M
3300009050|Ga0102909_1006891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3115Open in IMG/M
3300009058|Ga0102854_1089681All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage880Open in IMG/M
3300009059|Ga0102830_1019302Not Available2149Open in IMG/M
3300009159|Ga0114978_10650438Not Available605Open in IMG/M
3300009164|Ga0114975_10280231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage927Open in IMG/M
3300009181|Ga0114969_10015051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5565Open in IMG/M
3300009181|Ga0114969_10162257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1396Open in IMG/M
3300009181|Ga0114969_10162261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1396Open in IMG/M
3300009181|Ga0114969_10203106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1215Open in IMG/M
3300009221|Ga0103849_1052918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300009257|Ga0103869_10064876All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage853Open in IMG/M
3300010354|Ga0129333_10235973Not Available1653Open in IMG/M
3300010354|Ga0129333_10676938Not Available889Open in IMG/M
3300010354|Ga0129333_11234455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage620Open in IMG/M
3300010354|Ga0129333_11483378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300010370|Ga0129336_10356115Not Available805Open in IMG/M
3300010885|Ga0133913_11006508Not Available2154Open in IMG/M
3300012970|Ga0129338_1389521Not Available599Open in IMG/M
3300013087|Ga0163212_1058828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1276Open in IMG/M
(restricted) 3300013126|Ga0172367_10195391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1280Open in IMG/M
(restricted) 3300013132|Ga0172372_10282081Not Available1194Open in IMG/M
3300013295|Ga0170791_13186786All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1255Open in IMG/M
3300020074|Ga0194113_10210292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1547Open in IMG/M
3300020109|Ga0194112_10100303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2600Open in IMG/M
3300020151|Ga0211736_10185073Not Available2923Open in IMG/M
3300020172|Ga0211729_10619546Not Available2885Open in IMG/M
3300020196|Ga0194124_10290035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage795Open in IMG/M
3300020200|Ga0194121_10214740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1031Open in IMG/M
3300020214|Ga0194132_10488441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300020221|Ga0194127_10598211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage702Open in IMG/M
3300020486|Ga0208698_112255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300020498|Ga0208050_1015483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage817Open in IMG/M
3300020543|Ga0208089_1014850Not Available1182Open in IMG/M
3300020549|Ga0207942_1002387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3173Open in IMG/M
3300020561|Ga0207934_1022086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1074Open in IMG/M
3300020578|Ga0194129_10061088All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2776Open in IMG/M
3300021376|Ga0194130_10602362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300021438|Ga0213920_1096758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300021961|Ga0222714_10076302Not Available2201Open in IMG/M
3300021961|Ga0222714_10216217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1096Open in IMG/M
3300021963|Ga0222712_10187954All Organisms → Viruses → Predicted Viral1363Open in IMG/M
3300021963|Ga0222712_10755213Not Available541Open in IMG/M
3300023174|Ga0214921_10018033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay7772Open in IMG/M
3300023184|Ga0214919_10256728All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1246Open in IMG/M
3300024289|Ga0255147_1001825All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay5207Open in IMG/M
3300024346|Ga0244775_10121882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2209Open in IMG/M
3300024346|Ga0244775_10200879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1673Open in IMG/M
3300024346|Ga0244775_10919682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage694Open in IMG/M
3300024346|Ga0244775_11008964All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300024348|Ga0244776_10283265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1139Open in IMG/M
3300024351|Ga0255141_1045820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage646Open in IMG/M
3300024352|Ga0255142_1007321Not Available1848Open in IMG/M
3300024484|Ga0256332_1041407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage989Open in IMG/M
3300024500|Ga0255143_1003505Not Available2764Open in IMG/M
3300024500|Ga0255143_1079277Not Available527Open in IMG/M
3300024509|Ga0255175_1024635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1199Open in IMG/M
3300024536|Ga0256338_1125722Not Available574Open in IMG/M
3300024555|Ga0255280_1102550All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300024559|Ga0255284_1127301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300024866|Ga0255272_1116483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage666Open in IMG/M
3300025382|Ga0208256_1028192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage816Open in IMG/M
3300025399|Ga0208107_1090839All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300025413|Ga0208614_1067629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300025423|Ga0208746_1011240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1767Open in IMG/M
3300025838|Ga0208872_1275456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300026566|Ga0256334_1041110Not Available1061Open in IMG/M
3300026569|Ga0255277_1066735Not Available922Open in IMG/M
3300026571|Ga0255289_1157170Not Available511Open in IMG/M
3300027121|Ga0255074_1037951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300027156|Ga0255078_1029479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1176Open in IMG/M
3300027231|Ga0208172_1080380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300027260|Ga0208027_1023652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1274Open in IMG/M
3300027294|Ga0208441_1084064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300027339|Ga0255210_1095281Not Available546Open in IMG/M
3300027467|Ga0255154_1081118All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300027499|Ga0208788_1111036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300027508|Ga0255072_1027504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1192Open in IMG/M
3300027529|Ga0255077_1036094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
3300027578|Ga0255075_1013920Not Available1606Open in IMG/M
3300027581|Ga0209651_1132615Not Available684Open in IMG/M
3300027621|Ga0208951_1109776Not Available746Open in IMG/M
3300027621|Ga0208951_1197571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300027631|Ga0208133_1078497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300027720|Ga0209617_10071094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1434Open in IMG/M
3300027734|Ga0209087_1020014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3294Open in IMG/M
3300027746|Ga0209597_1343516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300027753|Ga0208305_10042675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1778Open in IMG/M
3300027754|Ga0209596_1002944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13715Open in IMG/M
3300027756|Ga0209444_10060966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1663Open in IMG/M
3300027763|Ga0209088_10156873All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1001Open in IMG/M
3300027793|Ga0209972_10036990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2768Open in IMG/M
3300027793|Ga0209972_10189380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage960Open in IMG/M
3300027793|Ga0209972_10225541All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300027816|Ga0209990_10262764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage782Open in IMG/M
3300027892|Ga0209550_10128932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1838Open in IMG/M
3300027892|Ga0209550_10328219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage973Open in IMG/M
3300027969|Ga0209191_1163480Not Available900Open in IMG/M
3300028025|Ga0247723_1112293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
(restricted) 3300028114|Ga0247835_1174242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage756Open in IMG/M
3300028258|Ga0255214_1045392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage657Open in IMG/M
3300028394|Ga0304730_1267474Not Available607Open in IMG/M
3300031758|Ga0315907_10147146All Organisms → Viruses → Predicted Viral1997Open in IMG/M
3300031758|Ga0315907_10504771Not Available956Open in IMG/M
3300031758|Ga0315907_10541652Not Available913Open in IMG/M
3300031787|Ga0315900_10094528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2933Open in IMG/M
3300031787|Ga0315900_10260327All Organisms → Viruses → Predicted Viral1473Open in IMG/M
3300031787|Ga0315900_10424771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1038Open in IMG/M
3300031787|Ga0315900_10882185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300031857|Ga0315909_10363005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1053Open in IMG/M
3300031857|Ga0315909_10765577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage616Open in IMG/M
3300031951|Ga0315904_10406818All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1231Open in IMG/M
3300031951|Ga0315904_10467238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1122Open in IMG/M
3300031951|Ga0315904_10653675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage893Open in IMG/M
3300031963|Ga0315901_10757800Not Available710Open in IMG/M
3300032050|Ga0315906_10055972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4084Open in IMG/M
3300032050|Ga0315906_10267522Not Available1560Open in IMG/M
3300032050|Ga0315906_10355331Not Available1295Open in IMG/M
3300032050|Ga0315906_10811823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300032050|Ga0315906_11240000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300032093|Ga0315902_10458511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1126Open in IMG/M
3300032093|Ga0315902_10483024All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1085Open in IMG/M
3300032093|Ga0315902_11036942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300032116|Ga0315903_10511400Not Available945Open in IMG/M
3300032116|Ga0315903_10511525Not Available945Open in IMG/M
3300032677|Ga0316227_1126405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage961Open in IMG/M
3300033996|Ga0334979_0134337All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1510Open in IMG/M
3300034061|Ga0334987_0046772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3626Open in IMG/M
3300034061|Ga0334987_0379104Not Available904Open in IMG/M
3300034066|Ga0335019_0375441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage874Open in IMG/M
3300034106|Ga0335036_0776928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300034108|Ga0335050_0174562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1143Open in IMG/M
3300034109|Ga0335051_0163045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1130Open in IMG/M
3300034120|Ga0335056_0118230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1609Open in IMG/M
3300034168|Ga0335061_0131199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1334Open in IMG/M
3300034200|Ga0335065_0182815Not Available1379Open in IMG/M
3300034356|Ga0335048_0166686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1246Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton12.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater11.56%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater11.06%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine10.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater8.54%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.04%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.53%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.53%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.02%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.02%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.51%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.51%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.01%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.51%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.51%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.51%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.00%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.00%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.50%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.50%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.50%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.50%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.50%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.50%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001843Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2bEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300003616Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DNEnvironmentalOpen in IMG/M
3300004770Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006118Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007165Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16EnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009221Microbial communities of water from Amazon river, Brazil - RCM2EnvironmentalOpen in IMG/M
3300009257Microbial communities of water from Amazon river, Brazil - RCM22EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020214Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020486Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020543Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020561Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024351Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024484Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024500Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300024509Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8dEnvironmentalOpen in IMG/M
3300024536Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024555Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024559Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024866Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025382Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025399Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025413Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025423Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025838Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300026566Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026569Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026571Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027231Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027260Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027294Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027339Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027499Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027508Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027529Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8hEnvironmentalOpen in IMG/M
3300027531Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027578Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028258Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8dEnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032677Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1018204523300001282FreshwaterYDIQGHTFTKEHPFVAMDPKTAQEIFDKEEGFRLATPKEVQEYYN*
RCM34_110650023300001843Marine PlanktonTKDHPFVAMSEEDAQKIFDSEEGFRLATPKEVQDFYN*
RCM37_135061333300001850Marine PlanktonVQGYTFTTEHPFVAMPESDAQSVFDSQTGFRLATPRE
RCM31_1022103823300001851Marine PlanktonIQGFTFTKEHPFVAMSSNKAQLICNKEEGFRLATPAEVQEFYS*
GOScombined01_10637471833300002040MarineMGYVFTKEHPFIAMSESEAQSIFDTEIGFRPATPKEAQNFIVNRG*
JGI25928J51866_113385423300003616Freshwater LakeHRYDALGFTFTKEHPFVAMSSEAAQEIFDKEEGFRLATPREVQDFYS*
Ga0007804_102075613300004770FreshwaterGYIFTQEHPFMAMSETDAQKIFDTQAGFRLATPREAQEYYA*
Ga0068876_1003967013300005527Freshwater LakeEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN*
Ga0068876_1005451913300005527Freshwater LakeDHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYN*
Ga0068872_1003989453300005528Freshwater LakeMGHTFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN*
Ga0068872_1015066533300005528Freshwater LakeTKEHPFVAMHKADAQKIFDKEEGFRLATPKEVQEYYN*
Ga0078894_1004759763300005662Freshwater LakeDILGFTFTKEHPFVAMTEDNAQEIFDKEEGFRLATPKEVQEYYA*
Ga0078894_1021877743300005662Freshwater LakeHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN*
Ga0007862_100644763300006108FreshwaterYTFTREHPFVAMSESEAQAIFDHQDGFRLATPREAQEFYA*
Ga0007859_110070723300006118FreshwaterQHPFVAMPEEHAQQIFDTQIGFRLATPREAQEFYS*
Ga0079301_120171313300006639Deep SubsurfaceTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN*
Ga0075473_1023675113300006875AqueousALGFTFTREHPFVAMMPDVAQEIFDKEEGFRLATPREVQEYYN*
Ga0079302_102633813300007165Deep SubsurfaceRYDIMGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN*
Ga0102977_106453613300007171Freshwater LakeTRANFRYDIMGHTFTKEHPFVAMAQDKAQAIFDKEEGFRLATPKEVQEFYN*
Ga0102978_115288423300007177Freshwater LakeGHTFTKEHPFVAMDKDTAQAIFDKEEGFVMATPKEVQEFYN*
Ga0102873_102621943300007545EstuarineGFTFTKEHPFVAIPSVKAEEIFEKEEGFRLATATEVQDFYA*
Ga0102828_117886723300007559EstuarineHTFTKEHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYH*
Ga0102913_121846723300007560EstuarineTFGYSFSQEHPFVAMPMETAMEIFDTQEGFRLATPREVNEYYS*
Ga0102919_103339013300007597EstuarineTFTKEHPFIAMTEEDAQKIFDKEEGFRIATPKEVQEYYA*
Ga0102878_109321623300007624EstuarineTFTKEHPFVAMTSEDAQEIFDKEEGFRLATPKEVQEYYA*
Ga0102870_109491923300007625EstuarineYDIVGFTFTKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA*
Ga0102894_121633613300007632EstuarineTKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA*
Ga0102876_106062823300007642EstuarineGFTFTKEHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN*
Ga0102902_114637813300007644EstuarineEHPFVAMRMEDALEILDTEEGFRLASPREVNEYYS*
Ga0102859_120875813300007708EstuarineKDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN*
Ga0105745_118542213300007972Estuary WaterKEHPFIAMSNEEAQAIFDKEEGFRLATPREVQEYYN*
Ga0108970_1106175013300008055EstuaryEHPFVAMKPDVAQEIFDKEEGFRLATPREVQEYYN*
Ga0114340_105922913300008107Freshwater, PlanktonDHPFVAMKDKEAQSIFDKEEGFRLATPKEVQEFYN*
Ga0114340_106184413300008107Freshwater, PlanktonKEHPFVAMNKDDAQKIFDKEEGFRLATPKEVQEYYN*
Ga0114340_107098633300008107Freshwater, PlanktonHTFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN*
Ga0114340_108107413300008107Freshwater, PlanktonYTFTKEHPFIAMKEEDAQKIFDVEEGFRLATPREAQEFYS*
Ga0114340_110479913300008107Freshwater, PlanktonHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN*
Ga0114341_1004466213300008108Freshwater, PlanktonTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN*
Ga0114343_100408513300008110Freshwater, PlanktonYDIQGFTFTKEHPYIAMNKEQAQAIFDKEAGFRLATPKEVQEFYH*
Ga0114343_101975263300008110Freshwater, PlanktonHPFIAMSKEYAQEIFDKEDGFRLATPKEVQEYYN*
Ga0114343_105837633300008110Freshwater, PlanktonEHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN*
Ga0114343_105893413300008110Freshwater, PlanktonDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN*
Ga0114343_112002923300008110Freshwater, PlanktonFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN*
Ga0114346_102862453300008113Freshwater, PlanktonYDIMGFTFTKEHPFIAMNNETAQAIFDKEEGFRLATPREVQEYYN*
Ga0114346_102862753300008113Freshwater, PlanktonMGFTFTKEHPFIAMNNETAQAIFDKEEGFRLATPREVQEYYN*
Ga0114346_110305413300008113Freshwater, PlanktonRDNFRYDIMGFTFTKEHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN*
Ga0114346_112751713300008113Freshwater, PlanktonHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN*
Ga0114346_128062823300008113Freshwater, PlanktonIMGVTFTKEHPFVAMSRDDAQEIFDKEEGFRLATPKEVQEYYN*
Ga0114350_101798153300008116Freshwater, PlanktonRFTKDHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYN*
Ga0114350_106740713300008116Freshwater, PlanktonYDIMGFTFTKEHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN*
Ga0114351_111638633300008117Freshwater, PlanktonKEHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN*
Ga0114355_110113613300008120Freshwater, PlanktonTMGYTFTQEHPFVAMSEDEAQAIFDKEEGFRLATPKEAQDFYN*
Ga0114840_105913113300008258Freshwater, PlanktonFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN*
Ga0114841_104341673300008259Freshwater, PlanktonTKEHPFVAMHKDDAQKIFDKEEGFRLATPKEVQEYYN*
Ga0114336_102313013300008261Freshwater, PlanktonEHPFVAMTEEDAQKIFDKEEGFRIATPKEVQDYYA*
Ga0114336_102667013300008261Freshwater, PlanktonTRDNFRYDIQGHTFTKEHPFVALTEAEAQKIFDVEEGFRVATPKEVQEFYN*
Ga0114337_106254413300008262Freshwater, PlanktonDIMGFTFTKEHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN*
Ga0114876_109312413300008448Freshwater LakeHPFVAMHKADAQKIFDKEEGFRLATPKEVQEYYN*
Ga0114876_126448713300008448Freshwater LakeFTFTKEHPFVAMQEEQAQEIFDKEEGFRLATPKEVQEYYG*
Ga0102831_105426133300008996EstuarineTFTKDHPFVAMSEEDAQKIFDSEEGFRLATPKEVQDFYN*
Ga0102829_118121113300009026EstuarineEHPFVAVSEDVAQEIFDKEEGFRLASPREVQEYYS*
Ga0102909_100689163300009050EstuarineFTKEHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYH*
Ga0102854_108968113300009058EstuarineKMDRSNSRYDALGFTFTREHPFVAMKPEVAQEIFDKEEGFRLATPREVQEYYN*
Ga0102830_101930243300009059EstuarineGFTFTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN*
Ga0114978_1065043823300009159Freshwater LakeRYDIMGFTFTKEHPFVALVSDKAQEIFDKEEGFRLANPKEVQDYYN*
Ga0114975_1028023113300009164Freshwater LakeNEHPFVAMNEEDAQSIFDKEDGFRLATPKEVQEFYN*
Ga0114969_1001505193300009181Freshwater LakeTFTQAHPFVAMKPDAAQEIFDKEDGFRLATPREVQEYYN*
Ga0114969_1016225713300009181Freshwater LakeGYTFTKDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYS*
Ga0114969_1016226113300009181Freshwater LakeGYTFTKDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN*
Ga0114969_1020310633300009181Freshwater LakeLGFTFTKEHPFVAMTEDDAQEIFDKEEGFRLATPKEVQEYYA*
Ga0103849_105291813300009221River WaterYTFTREHPFVAMSESDAQKIFDTQYGFRLATPREAQEYYS*
Ga0103869_1006487623300009257River WaterMGYTFTQQHPFVAMSEDDAQRIFDTQTGFRLATPREAQEFYS*
Ga0129333_1023597343300010354Freshwater To Marine Saline GradientHPFVAMDKDTAQAIFDKEEGFVVATPNEVQEFYN*
Ga0129333_1067693823300010354Freshwater To Marine Saline GradientHPFVAMKPEKAQQIFDKEEGFRLATPREVQEYYN*
Ga0129333_1123445513300010354Freshwater To Marine Saline GradientNFRYDIQGFTFTKEHPYVAMHKDYAQKIFDKEEGFRLATPKEVQDFYN*
Ga0129333_1148337823300010354Freshwater To Marine Saline GradientRANFRYDIMGFTFTREHPFVAMSNENAQAIFDKEEGFRLATPKEVQEFYN*
Ga0129336_1035611523300010370Freshwater To Marine Saline GradientEHPFVAMTKDQAQSIFDKEEGFRLANPTEVQSFYS*
Ga0133913_1100650813300010885Freshwater LakeTFTKEHPFVAMSSDKAQAIFDKEEGFRPATPKEAQDFYS*
Ga0129338_138952113300012970AqueousKEHPFVAMDKDTAQAIFDKEEGFVLATPKEVQEFYS*
Ga0163212_105882813300013087FreshwaterFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN*
(restricted) Ga0172367_1019539113300013126FreshwaterRYDIAGHTFTKEHPFVAMNPDVAQEIFDKEEGFRLATPREVQEYYN*
(restricted) Ga0172372_1028208113300013132FreshwaterFTKEHPFVAMNPDVAQEIFDKEEGFRLATPREVQEYYN*
Ga0170791_1318678613300013295FreshwaterIGFTFTKEHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN*
Ga0194113_1021029213300020074Freshwater LakeFRYDTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN
Ga0194112_1010030313300020109Freshwater LakeYDIAGHTFTKDHPFVAMNPNVAQEIFDKEEGFRLATPREVQEYYN
Ga0211736_1018507313300020151FreshwaterEHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN
Ga0211729_1061954613300020172FreshwaterFTFTKEHPFIAMTEENAQEIFDKEEGFRLATPNEVQEYYN
Ga0194124_1029003523300020196Freshwater LakeYDTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN
Ga0194121_1021474013300020200Freshwater LakeVGFTFTKEHPFVAMASEDAQKIFDKEEGFRLATPTEVQEYYS
Ga0194132_1048844113300020214Freshwater LakeMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN
Ga0194127_1059821113300020221Freshwater LakeYRYDIAGHTFTKDHPFVAMNPNVAQEIFDKEEGFRLATPREVQEYYN
Ga0208698_11225513300020486FreshwaterFTFTKDHPFVAMDKEKAQEIFDKEEGFRLATPKEVQEYYG
Ga0208050_101548313300020498FreshwaterGHTFTKEHPFVAMNEKNAQEIFDKEEGFRLATPKEVQEYYN
Ga0208089_101485013300020543FreshwaterRDHPFVAMKPDVAQEIFDKEEGFRLATPREVQEYYN
Ga0207942_100238713300020549FreshwaterYTFTNDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN
Ga0207934_102208623300020561FreshwaterKDHPFIAMNEKDAQSIFDKEEGFRLATPKEVQEFYS
Ga0194129_1006108853300020578Freshwater LakeDTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN
Ga0194130_1060236223300021376Freshwater LakeRYDTMGFTFTKEHPFVAMSNDEAQEIFDKEEGFRLATPREVQEYYN
Ga0213920_109675813300021438FreshwaterVMGYTFSQQHPFVAMSEEDAQRIFDTQDGFRLATPREAQEFYA
Ga0222714_1007630213300021961Estuarine WaterFTKEHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN
Ga0222714_1021621723300021961Estuarine WaterIMGFTFTKEHPFIAMSNEQAQAIFDKEEGFRLATPREVQEYYN
Ga0222712_1018795413300021963Estuarine WaterFRYDIMGFTFTKEHPFVAMNKDDAQKIFDKEEGFRLATPKEDQEYYN
Ga0222712_1075521313300021963Estuarine WaterHTFTKDHPFVAMKEKEAQEIFDKEEGFRLATPKELQDFYG
Ga0214921_1001803313300023174FreshwaterKEHPFVAMTEDDAQEIFDKEEGFRLATPKEVQEYYA
Ga0214919_1025672813300023184FreshwaterHTFTREHPFIAMSEKDAQLIFDNEEGFRMATPKEVQDFYS
Ga0255147_100182513300024289FreshwaterMTRPNYSYEIMGHTFTKEHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYN
Ga0244775_1012188213300024346EstuarineTKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA
Ga0244775_1020087913300024346EstuarineMRYDIHGRTFTKDHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYN
Ga0244775_1091968223300024346EstuarineYDILGYTFTKDHPFVAMKEDDAQKIFDVEEGFRLATPKEAQEYYS
Ga0244775_1100896413300024346EstuarineSHTFTKEHPFVAMTEEDAQKIFDTEEGFRLATPKEVQDFYH
Ga0244776_1028326513300024348EstuarineHGHTFTKEHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYH
Ga0255141_104582013300024351FreshwaterYDIAGFTFTKDHPFVAMKRDKAQWIFDKEAGFRLATPKEVQEFYG
Ga0255142_100732143300024352FreshwaterNYSYEIMGHTFTKEHPFVAMDKDTAQAIFDKEEGFVMATPLEVQEFYN
Ga0256332_104140723300024484FreshwaterEHPFVAMDKDTAQDIFDKEEGFRLATPKEVQEFYN
Ga0255143_100350553300024500FreshwaterFTKEHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYN
Ga0255143_107927713300024500FreshwaterTKEHPYIAMNKEQAQAIFDKEAGFRLATPKEVQEFYH
Ga0255175_102463533300024509FreshwaterEFTFTKENPFIVMSEKDAQEIFDTQEGFRLATPKEVQEFYS
Ga0256338_112572213300024536FreshwaterIMGHTFTKEHPFVAMDKDKAQAIFDKEEGFVMATPLEVQEFYN
Ga0255280_110255023300024555FreshwaterVNEFTFTKENPFIVMSEKDAQEIFDTQEGFRLATPKEVQEFYS
Ga0255284_112730113300024559FreshwaterNGYTFTKEHPFVAMPEDDAQKIFDKEEGFRLATPKEVQEYYS
Ga0255272_111648313300024866FreshwaterKDHPFVAMKRDRAQWIFDKEAGFRLATPKEVQEFYG
Ga0208256_102819213300025382FreshwaterGYIFTQEHPFMAMSETDAQKIFDTQAGFRLATPREAQEYYA
Ga0208107_109083913300025399FreshwaterFQFTQEHPSLAMSEADAQKIFDTEQGFRLATPREAQEYYA
Ga0208614_106762923300025413FreshwaterMGFEFSQEHPFVAMSETDAQKIFDTQDGFRIATPREAQEYYA
Ga0208746_101124043300025423FreshwaterTQEHPFMAMSETDAQKIFDTQAGFRLATPREAQEYYA
Ga0208872_127545613300025838FreshwaterTAGFEFTQEHPFVAMSETDAQRIFDTQEGFRIATPREAQEYYA
Ga0256334_104111023300026566FreshwaterYEIMGHTFTKEHPFVAMDKDTAQAIFDKEEGFVMATPLEVQEFYN
Ga0255277_106673513300026569FreshwaterRYDVLGFTFTKDHPFVAMPSEKAQQIFDKEEGFRLASPREVQEYYN
Ga0255289_115717023300026571FreshwaterANFRYDAMGFTFTKEHPFVAMPTEKAEEIFEKEEGFRLATPVEVREFYA
Ga0255074_103795113300027121FreshwaterRYDIMGHTFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN
Ga0255078_102947913300027156FreshwaterTREHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN
Ga0208172_108038013300027231EstuarineDIVGFTFTKEHPFIAMTEEDAQKIFDKEEGFRIATPKEVQEYYA
Ga0208027_102365213300027260EstuarineTFTKEHPFIAMTEEDAQKIFDKEEGFRIATPKEVQEYYA
Ga0208441_108406413300027294EstuarineTFAKEHPFVAMTEEDAQKIFDKEEGFRIATPKEVQDYYA
Ga0255210_109528123300027339FreshwaterIRGYTFTKEHPFVAMDKDTAQAIFDKEEGFVLATPAEVQEFYN
Ga0255154_108111823300027467FreshwaterDNFRYDIQGFTFTKEHPYIAMNKEQAQAIFDKEAGFRLATPKEVQEFYH
Ga0208788_111103623300027499Deep SubsurfaceFRYDIMGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0255072_102750413300027508FreshwaterIDGFTFTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN
Ga0255077_103609413300027529FreshwaterIMGFTFTKEHPFIAMSKEYAQEIFDKEDGFRLATPKEVQEYYN
Ga0208682_114812113300027531EstuarineSFSQEHPFVAMRMEDALEILDTEEGFRLASPREVNEYYS
Ga0255075_101392013300027578FreshwaterFTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN
Ga0209651_113261513300027581Freshwater LakeEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYA
Ga0208951_110977613300027621Freshwater LenticITFTKEHPFVAVSEDVAQEIFDKEEGFRLASPREVQEYYS
Ga0208951_119757123300027621Freshwater LenticGYTFTKDHPFVAMVEDDAQKIFDTEEGFRLATPKEVQDFYN
Ga0208133_107849713300027631EstuarineGFTFTKEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN
Ga0209617_1007109433300027720Freshwater And SedimentEHPFIAMTEDNAQEIFDKEEGFRLATPKEVQEYYN
Ga0209087_102001463300027734Freshwater LakeYDIHGYTFTKDHPFVAMSEEDAQNIFDTEEGFRLATPKEVQDFYN
Ga0209597_134351613300027746Freshwater LakeLNYTFTKEHPFVAMTSEDAQEIFDKEEGFRLATPKEVQEYYA
Ga0208305_1004267543300027753EstuarineFTFTKEHPFVAMTEEDAQEIFDKEEGFRLATPKEVQEYYA
Ga0209596_100294413300027754Freshwater LakeFTKDHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN
Ga0209444_1006096613300027756Freshwater LakeYRYDIFGYTFTKEHPFVAMSEEDAQKIFDTEEGFRLATPKEVQDFYN
Ga0209088_1015687323300027763Freshwater LakeFTKDHPFIAMSEDDAQKIFDTEEGFRLATPKEVQDFYN
Ga0209972_1003699053300027793Freshwater LakeFRYDILGHTFTKEHPFVAMDKSQAQAIFDKEEGFRLATPNEVQEFYN
Ga0209972_1018938023300027793Freshwater LakeKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0209972_1022554113300027793Freshwater LakeFRYDIMGFTFTKEHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN
Ga0209990_1026276413300027816Freshwater LakeIMGFTFTKEHPFVAMNKEDAQEIFDKEEGFRLATPKEVQEYYN
Ga0209550_1010363743300027892Freshwater LakeVFGYSFSQEHPFVAMPMEAAMELFDTQEGFRLATPREVNEYYS
Ga0209550_1012893213300027892Freshwater LakeDHPFIAMSEDDAQKIFDTEEGFRLATPKEVQDFYN
Ga0209550_1032821923300027892Freshwater LakeGFTFTLEHPFVAMKPDVAQEIFDKEEGFRLATPREVQEYYN
Ga0209191_116348023300027969Freshwater LakeFTQDHPFVAMHKDAAQEIFDKEEGFRLATPKEVQDYYG
Ga0247723_111229323300028025Deep Subsurface SedimentANFRYDIMGHTFTSEHPFVAMDDKDAQAIFDKEEGFRLATPKEVQEFYN
(restricted) Ga0247835_117424223300028114FreshwaterTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0255214_104539213300028258FreshwaterRANYRYDIAGHTFTKEHPFVAMKPEKAQQIFDKEEGFRLATPKEVQEYYN
Ga0304730_126747413300028394Freshwater LakeKEHPFVPMPEDHAQRIFDGVQGFVLATPREVQEFYR
Ga0315907_1014714643300031758FreshwaterFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN
Ga0315907_1050477113300031758FreshwaterFTREHPFVAMPADSAQAIFDKEEGFRLATPKEVQDFYH
Ga0315907_1054165213300031758FreshwaterDHPFVAMDKDTAQAIFDKEEGFVMATPAEVQEFYS
Ga0315900_1009452813300031787FreshwaterFTFTKEHPFIAMSNETAQEIFDKEEGFRLATPREVQEYYN
Ga0315900_1026032733300031787FreshwaterEHPYIAMSQEDADFIFDTQIGFRMATPREVQEYYN
Ga0315900_1042477123300031787FreshwaterMGYTFTKEHPFVAMHKADAQKIFDKEEGFRLATPKEVQEYYN
Ga0315900_1088218523300031787FreshwaterGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0315909_1036300513300031857FreshwaterDIIGYTFTKEHPFIAMKEEDAQKIFDVEEGFRLATPREAQEFYS
Ga0315909_1076557723300031857FreshwaterGHTFTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN
Ga0315904_1040681833300031951FreshwaterFTKEHPFIAMKEEDAQKIFDVEEGFRLATPREAQEFYS
Ga0315904_1046723823300031951FreshwaterFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0315904_1065367513300031951FreshwaterQHPYVAMSSEKAQAIFDKEDGFRLATPKEVQDFYS
Ga0315901_1075780013300031963FreshwaterDILGFTFTKEHPFVAMTKDQAQSIFDKEEGFRLANPTEVQSFYS
Ga0315906_1005597213300032050FreshwaterIQGFTFTKEHPYIAMNKEQAQAIFDKEAGFRLATPKEVQEFYH
Ga0315906_1026752213300032050FreshwaterTKDHPFVAMTSDKAQAIFDKEEGFRLATPTEVQEYYN
Ga0315906_1035533133300032050FreshwaterNFRYDILGFTFTKEHPFVAMKKDQAQAIFDKEEGFRLANPKEVQEFYS
Ga0315906_1081182323300032050FreshwaterTKEHPFVAMGKDDAQEIFDKEEGFRLATPKEVQEYYN
Ga0315906_1124000023300032050FreshwaterTFTKEHPFVAMKPEKAQQIFDKEEGFRLATPREVQEYYN
Ga0315902_1045851123300032093FreshwaterGYTFTKEHPFVAMHKADAQKIFDKEEGFRLATPKEVQEYYN
Ga0315902_1048302423300032093FreshwaterILGFTFTKEHPFVAMTSEDAQEIFDKEEGFRLATPKEVQEYYG
Ga0315902_1103694213300032093FreshwaterDIMGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0315903_1051140013300032116FreshwaterILGHTFTREHPFVAMPADSAQAIFDKEEGFRLATPKEVQDFYH
Ga0315903_1051152513300032116FreshwaterTKDHPFVAMNKDKAQEIFDKEEGFRLATPKEVQEYYN
Ga0316227_112640523300032677FreshwaterAAGYTFTSQHPFVAMPEEIAQNIFDTQVGFRLATPREAQEFYN
Ga0334979_0134337_10_1383300033996FreshwaterMGFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0334987_0046772_3478_36243300034061FreshwaterNARYDALGFTFTRDHPFVAMKPDVAQEIFDKEEGFRLATPREVQEYYN
Ga0334987_0379104_797_9043300034061FreshwaterIHPFVAMHKDSAQQIFDKEEGFRLATPKEVQEYYG
Ga0335019_0375441_2_1213300034066FreshwaterTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0335036_0776928_1_1263300034106FreshwaterGFTFTKEHPFVAMNKEKAQAIFDKEEGFRLANPKEVQEFYS
Ga0335050_0174562_1010_11413300034108FreshwaterIHGHTFTKEHPFVAMPEEDAQKIFDTEEGFRLATPKEVQDFYH
Ga0335051_0163045_1007_11293300034109FreshwaterHTFTKEHPFVAMKEEDAQAIFDKEEGFRLATPKEAQDFYH
Ga0335056_0118230_1_1233300034120FreshwaterFTFTKEHPFIAMSNEAAQAIFDKEEGFRLATPREVQEYYN
Ga0335061_0131199_1204_13323300034168FreshwaterHGYTFTKDHPFIAMSEDDAQKIFDTEEGFRLATPKEVQDFYN
Ga0335065_0182815_15_1433300034200FreshwaterMGFTFTKDHPFVAMDKEKAQEIFDKEEGFRLANPKEVQEFYS
Ga0335048_0166686_3_1343300034356FreshwaterALGFTFTKEHPFVAMSAEAAQEIFDKEEGFRLATPREVQDFYS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.