NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025029

Metagenome / Metatranscriptome Family F025029

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025029
Family Type Metagenome / Metatranscriptome
Number of Sequences 203
Average Sequence Length 41 residues
Representative Sequence LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR
Number of Associated Samples 125
Number of Associated Scaffolds 203

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 26.24 %
% of genes near scaffold ends (potentially truncated) 81.77 %
% of genes from short scaffolds (< 2000 bps) 78.33 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (89.163 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(29.557 % of family members)
Environment Ontology (ENVO) Unclassified
(73.892 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.158 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.47%    β-sheet: 0.00%    Coil/Unstructured: 48.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 203 Family Scaffolds
PF04860Phage_portal 0.99
PF12850Metallophos_2 0.49
PF05065Phage_capsid 0.49
PF05869Dam 0.49
PF09636XkdW 0.49
PF06199Phage_tail_2 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 203 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.55 %
UnclassifiedrootN/A3.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10048905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1411Open in IMG/M
3300002835|B570J40625_100142968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2758Open in IMG/M
3300002835|B570J40625_101002038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M
3300003277|JGI25908J49247_10014450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2418Open in IMG/M
3300003393|JGI25909J50240_1092928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300003429|JGI25914J50564_10162632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300004096|Ga0066177_10013008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2558Open in IMG/M
3300004096|Ga0066177_10128103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage996Open in IMG/M
3300004112|Ga0065166_10021779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1900Open in IMG/M
3300004124|Ga0066178_10118819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300004126|Ga0066179_10111394All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300004481|Ga0069718_10028656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300004836|Ga0007759_11027925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300005527|Ga0068876_10344726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300005527|Ga0068876_10662049Not Available561Open in IMG/M
3300005528|Ga0068872_10243932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1010Open in IMG/M
3300005581|Ga0049081_10189505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300005582|Ga0049080_10037263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1690Open in IMG/M
3300005662|Ga0078894_10023428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5024Open in IMG/M
3300005662|Ga0078894_11206675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage641Open in IMG/M
3300006018|Ga0068875_1004211All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium LSUCC01121328Open in IMG/M
3300006484|Ga0070744_10018022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2095Open in IMG/M
3300006805|Ga0075464_10018578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3566Open in IMG/M
3300006805|Ga0075464_10710275All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300007363|Ga0075458_10091500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage948Open in IMG/M
3300008119|Ga0114354_1009483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7054Open in IMG/M
3300008120|Ga0114355_1089335All Organisms → Viruses → Predicted Viral1244Open in IMG/M
3300008266|Ga0114363_1063322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1429Open in IMG/M
3300008266|Ga0114363_1127640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage874Open in IMG/M
3300008339|Ga0114878_1009062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5085Open in IMG/M
3300008448|Ga0114876_1198575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300008450|Ga0114880_1081770All Organisms → Viruses → Predicted Viral1287Open in IMG/M
3300008450|Ga0114880_1202365All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300008450|Ga0114880_1278029All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300009037|Ga0105093_10728247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300009077|Ga0115552_1453343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300009081|Ga0105098_10401098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300009082|Ga0105099_10029885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2804Open in IMG/M
3300009082|Ga0105099_10301503Not Available939Open in IMG/M
3300009131|Ga0115027_11444760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300009164|Ga0114975_10637895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300009168|Ga0105104_10595166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300009169|Ga0105097_10578648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300009170|Ga0105096_10434159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300009181|Ga0114969_10467059Not Available711Open in IMG/M
3300009183|Ga0114974_10222950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1141Open in IMG/M
3300009183|Ga0114974_10360359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage841Open in IMG/M
3300009194|Ga0114983_1082502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300010354|Ga0129333_10220651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1719Open in IMG/M
3300010885|Ga0133913_13566552All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1012Open in IMG/M
3300012707|Ga0157623_1143161All Organisms → Viruses → Predicted Viral1092Open in IMG/M
3300012717|Ga0157609_1216095All Organisms → Viruses → Predicted Viral1104Open in IMG/M
3300012728|Ga0157552_1121752All Organisms → Viruses → Predicted Viral1043Open in IMG/M
3300012730|Ga0157602_1109601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300012763|Ga0138289_1075169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300013079|Ga0157536_1338489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300013372|Ga0177922_10869313All Organisms → Viruses → Predicted Viral1240Open in IMG/M
3300017701|Ga0181364_1063504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300017722|Ga0181347_1054928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1197Open in IMG/M
3300017736|Ga0181365_1072036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage851Open in IMG/M
3300017736|Ga0181365_1123792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300017761|Ga0181356_1027440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2055Open in IMG/M
3300017761|Ga0181356_1178064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300017761|Ga0181356_1178076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300017774|Ga0181358_1005261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5541Open in IMG/M
3300017774|Ga0181358_1007164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4716Open in IMG/M
3300017774|Ga0181358_1186101All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300017774|Ga0181358_1187373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300017777|Ga0181357_1004215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5783Open in IMG/M
3300017777|Ga0181357_1031213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2101Open in IMG/M
3300017778|Ga0181349_1036364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1966Open in IMG/M
3300017778|Ga0181349_1076941All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1274Open in IMG/M
3300017778|Ga0181349_1194445All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300017778|Ga0181349_1290265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300017780|Ga0181346_1007751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4629Open in IMG/M
3300017780|Ga0181346_1014914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3297Open in IMG/M
3300017780|Ga0181346_1052219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1652Open in IMG/M
3300017780|Ga0181346_1072938All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1363Open in IMG/M
3300017780|Ga0181346_1108677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1071Open in IMG/M
3300017784|Ga0181348_1153560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage860Open in IMG/M
3300017784|Ga0181348_1261271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300017785|Ga0181355_1273611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300017785|Ga0181355_1286293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300020048|Ga0207193_1585055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300020159|Ga0211734_10057626All Organisms → Viruses → Predicted Viral2459Open in IMG/M
3300020180|Ga0163155_10091411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1818Open in IMG/M
3300020535|Ga0208228_1053622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300020536|Ga0207939_1002684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3755Open in IMG/M
3300020549|Ga0207942_1001262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4996Open in IMG/M
3300020554|Ga0208599_1000959All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5942Open in IMG/M
3300020554|Ga0208599_1063744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300020557|Ga0208231_1050447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300020571|Ga0208723_1029472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage814Open in IMG/M
3300020596|Ga0163149_10618722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300021438|Ga0213920_1037806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1057Open in IMG/M
3300022190|Ga0181354_1046149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1448Open in IMG/M
3300022407|Ga0181351_1123559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage967Open in IMG/M
3300022407|Ga0181351_1276682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300023184|Ga0214919_10014074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9602Open in IMG/M
3300023184|Ga0214919_10311989All Organisms → Viruses → Predicted Viral1076Open in IMG/M
3300024346|Ga0244775_10786535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300024346|Ga0244775_11054622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300025896|Ga0208916_10281109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage724Open in IMG/M
3300026993|Ga0209975_1001863All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2107Open in IMG/M
3300027365|Ga0209300_1058558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage624Open in IMG/M
3300027365|Ga0209300_1060809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300027601|Ga0255079_1014307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1895Open in IMG/M
3300027631|Ga0208133_1043689All Organisms → Viruses → Predicted Viral1094Open in IMG/M
3300027631|Ga0208133_1163375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300027644|Ga0209356_1071729All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1043Open in IMG/M
3300027644|Ga0209356_1128092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300027734|Ga0209087_1013181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4178Open in IMG/M
3300027734|Ga0209087_1100599All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1226Open in IMG/M
3300027734|Ga0209087_1171444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage855Open in IMG/M
3300027734|Ga0209087_1171768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage854Open in IMG/M
3300027754|Ga0209596_1157918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1003Open in IMG/M
3300027759|Ga0209296_1050898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2162Open in IMG/M
3300027759|Ga0209296_1061894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1909Open in IMG/M
3300027759|Ga0209296_1217756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300027764|Ga0209134_10075971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1135Open in IMG/M
3300027764|Ga0209134_10315328All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300027782|Ga0209500_10457926Not Available500Open in IMG/M
3300027785|Ga0209246_10003842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5608Open in IMG/M
3300027785|Ga0209246_10148057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage923Open in IMG/M
3300027785|Ga0209246_10187318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage810Open in IMG/M
3300027785|Ga0209246_10272780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300027797|Ga0209107_10301311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage754Open in IMG/M
3300027798|Ga0209353_10051194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1900Open in IMG/M
3300027798|Ga0209353_10222307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300027798|Ga0209353_10241000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300027798|Ga0209353_10297905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300027808|Ga0209354_10132264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1018Open in IMG/M
3300027808|Ga0209354_10195767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300027969|Ga0209191_1295876All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300027969|Ga0209191_1321592All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
(restricted) 3300027970|Ga0247837_1153076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1020Open in IMG/M
3300027971|Ga0209401_1023856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3057Open in IMG/M
3300027972|Ga0209079_10239223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300028394|Ga0304730_1248022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300031758|Ga0315907_10437424All Organisms → Viruses → Predicted Viral1047Open in IMG/M
3300031784|Ga0315899_10064748All Organisms → Viruses → Predicted Viral3798Open in IMG/M
3300031784|Ga0315899_10924694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300031784|Ga0315899_11258214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M
3300031784|Ga0315899_11554339All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300031787|Ga0315900_10071222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3533Open in IMG/M
3300031787|Ga0315900_10106956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2704Open in IMG/M
3300031787|Ga0315900_10165084All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2021Open in IMG/M
3300031857|Ga0315909_10015447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7838Open in IMG/M
3300031951|Ga0315904_10457064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1139Open in IMG/M
3300031963|Ga0315901_10863743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300032050|Ga0315906_10194633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1915Open in IMG/M
3300032093|Ga0315902_10046112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5068Open in IMG/M
3300032093|Ga0315902_10254072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1707Open in IMG/M
3300032093|Ga0315902_10791575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage751Open in IMG/M
3300032093|Ga0315902_10917140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage671Open in IMG/M
3300032116|Ga0315903_10035648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5250Open in IMG/M
3300032116|Ga0315903_11146859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300033981|Ga0334982_0397150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300033993|Ga0334994_0293234Not Available830Open in IMG/M
3300033993|Ga0334994_0299443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage817Open in IMG/M
3300033993|Ga0334994_0301677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage813Open in IMG/M
3300033994|Ga0334996_0227121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage976Open in IMG/M
3300033994|Ga0334996_0547063All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300033995|Ga0335003_0200675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M
3300033996|Ga0334979_0745267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300034012|Ga0334986_0228028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300034022|Ga0335005_0737429Not Available516Open in IMG/M
3300034060|Ga0334983_0076188All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2176Open in IMG/M
3300034060|Ga0334983_0112945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1742Open in IMG/M
3300034061|Ga0334987_0068871All Organisms → Viruses → Predicted Viral2839Open in IMG/M
3300034061|Ga0334987_0069806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2814Open in IMG/M
3300034061|Ga0334987_0323222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1011Open in IMG/M
3300034061|Ga0334987_0803091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300034062|Ga0334995_0011858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8129Open in IMG/M
3300034062|Ga0334995_0095189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2274Open in IMG/M
3300034062|Ga0334995_0734176All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300034092|Ga0335010_0030677All Organisms → Viruses → Predicted Viral4079Open in IMG/M
3300034092|Ga0335010_0164162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1394Open in IMG/M
3300034092|Ga0335010_0321490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage878Open in IMG/M
3300034093|Ga0335012_0462194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300034101|Ga0335027_0002909All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15033Open in IMG/M
3300034101|Ga0335027_0004318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12477Open in IMG/M
3300034101|Ga0335027_0164841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1611Open in IMG/M
3300034101|Ga0335027_0296953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1093Open in IMG/M
3300034104|Ga0335031_0700303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300034106|Ga0335036_0308033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1049Open in IMG/M
3300034106|Ga0335036_0695357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300034106|Ga0335036_0781150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300034109|Ga0335051_0057925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2060Open in IMG/M
3300034111|Ga0335063_0122253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1546Open in IMG/M
3300034111|Ga0335063_0394699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300034116|Ga0335068_0288694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage822Open in IMG/M
3300034116|Ga0335068_0387643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage671Open in IMG/M
3300034120|Ga0335056_0413468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage724Open in IMG/M
3300034120|Ga0335056_0489310All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300034200|Ga0335065_0417174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300034272|Ga0335049_0175594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1519Open in IMG/M
3300034272|Ga0335049_0348784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage986Open in IMG/M
3300034272|Ga0335049_0859407All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300034283|Ga0335007_0076175All Organisms → Viruses → Predicted Viral2530Open in IMG/M
3300034284|Ga0335013_0253341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1141Open in IMG/M
3300034357|Ga0335064_0139305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1496Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake29.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater26.11%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake9.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater8.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.46%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.46%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.97%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.97%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.99%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.99%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.99%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.49%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.49%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.49%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.49%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.49%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.49%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.49%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.49%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003429Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300004126Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2)EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006018Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaGEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012707Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012728Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012730Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012763Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013079Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES022 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020180Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1EnvironmentalOpen in IMG/M
3300020535Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020554Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020557Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020596Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1EnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026993Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027365Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)EnvironmentalOpen in IMG/M
3300027601Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1004890513300001282FreshwaterLGLAPQQLLELDPIMLQALLQGLKDEAKEIQDASKRKGRY*
B570J40625_10014296813300002835FreshwaterLIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR*
B570J40625_10100203823300002835FreshwaterLGIAPQQLLDLDPIMLQALLQGLKDEAKESQDASKRKGRY*
JGI25908J49247_1001445033300003277Freshwater LakeLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR*
JGI25909J50240_109292833300003393Freshwater LakeLGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR*
JGI25914J50564_1016263223300003429Freshwater LakeLSIRLGIAPQQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP*
Ga0066177_1001300813300004096Freshwater LakeRLGIAPQQLLELDKTMLDALVQGLKDEAKEVKDASRSKGRHSTSQGS*
Ga0066177_1012810333300004096Freshwater LakeLQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRT
Ga0065166_1002177913300004112Freshwater LakeAPQHLLELDKTMLDALVQGLKDEAKETSDASKRKGRR*TP*
Ga0066178_1011881913300004124Freshwater LakeRLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR*
Ga0066179_1011139413300004126Freshwater LakeIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVKDASRSKGRHSTSQGS*
Ga0069718_1002865623300004481SedimentIPPQALLDLDKTMLDALVQGLKDEAKEVSDASKRKGRYRS*
Ga0007759_1102792513300004836Freshwater LakeGIAPQHLLELDKVMLDALLKGLKDEAKEIKDASNAKRRH*
Ga0068876_1034472633300005527Freshwater LakeAPQHLLELDKVMLDALLQGLTDEAKEIKDASNTKRRR*
Ga0068876_1066204923300005527Freshwater LakeARLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIRNANKGGRR*
Ga0068872_1024393233300005528Freshwater LakeIARLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDANATKRRR*
Ga0049081_1018950533300005581Freshwater LenticLQIPPQALLELDNTMLDALVQGLKDEAKEVSDANRTKRKR*
Ga0049080_1003726333300005582Freshwater LenticQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR*
Ga0078894_1002342873300005662Freshwater LakeIARLSIRLGIAPQHLLELDKTMLDALVQGLKDEAKESDDASKSRRR*
Ga0078894_1120667513300005662Freshwater LakeARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS*
Ga0068875_100421133300006018Freshwater LakeSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIRNANKGGRR*
Ga0070744_1001802233300006484EstuarineARLSIRLGIAPQQLLDLDKNMLDALVQGLKDEAKEVSDANGSKRRGRA*
Ga0075464_1001857813300006805AqueousRLSIETGIAPQHLIELDSAMFRAMLDGLKDRAKEISDASKRKGRY*
Ga0075464_1071027513300006805AqueousSIRLGIAPQQLLELDKDMLDALVQGLKDEAKEIKDASNSKRRR*
Ga0075458_1009150033300007363AqueousLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRG*
Ga0114354_100948343300008119Freshwater, PlanktonLGIAPQQLLDLDKTMLDALLQGLKDEAKEVSDASKRKGRS*
Ga0114355_108933513300008120Freshwater, PlanktonLGIAPQQLLDLDKIMLDALVQGLKDEAKEVSDASKRQGRGRS*
Ga0114363_106332253300008266Freshwater, PlanktonLGIAPQQLLELDPIMLQALLQGLRDDAKEMNDANRNKGRN
Ga0114363_112764013300008266Freshwater, PlanktonLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDANNIKRRR*
Ga0114878_100906213300008339Freshwater LakeIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR*
Ga0114876_119857523300008448Freshwater LakeGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR*
Ga0114880_108177033300008450Freshwater LakeIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKRRH*
Ga0114880_120236513300008450Freshwater LakeIARLSIRLGISPQQLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRR*
Ga0114880_127802913300008450Freshwater LakeQHLLELDKVMLDALLQGLTDEAKEIKDASNRQGRR*
Ga0105093_1072824713300009037Freshwater SedimentLGIAPQQLLDLDKIMLDALVQGLKDEAKESQDASKRKGRG*
Ga0115552_145334323300009077Pelagic MarineLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRNRS*
Ga0105098_1040109823300009081Freshwater SedimentLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKGRGRA*
Ga0105099_1002988513300009082Freshwater SedimentIRLQIPPQYLLDLDKNMLDALVQGLKDEAKEVSDASKGRNKRR*
Ga0105099_1030150333300009082Freshwater SedimentLGIPPQALLDLDKTMLDALVQGLKDEAKEVSDANRGQRRGRA*
Ga0115027_1144476023300009131WetlandLGISPQALLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS*
Ga0114975_1063789513300009164Freshwater LakeLGIAPQQLLELDKTMLDALVQGLKDEAKEVSDASKRKGRGRS*
Ga0105104_1059516633300009168Freshwater SedimentLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANTRNRRGRAYK
Ga0105097_1057864823300009169Freshwater SedimentQQLLDLDKTMLDALVQGLKDEAKEVSDASNRKGRR*
Ga0105096_1043415913300009170Freshwater SedimentLGIAPQQLLDLDKIMLDALVQGLKDEAKESQDASKRKG
Ga0114969_1046705923300009181Freshwater LakeIETGIAPQHLIELDSAMFKAMLDGLKDRAKEISDASKRKGRG*
Ga0114974_1022295043300009183Freshwater LakeLGIAPQQLLDLDKTMLDALVQGLKDEAKEVRDANRVTRKR*
Ga0114974_1036035913300009183Freshwater LakeQQLLDLDKTMLDALVQGLKDEAKEVRDANRVTRKR*
Ga0114983_108250213300009194Deep SubsurfaceLSIRLGISPQQLLDLDKTMLDALVQGLKDEAKEVSD
Ga0129333_1022065133300010354Freshwater To Marine Saline GradientRLGIAPQQLLELDKDMLDALVQGLKDEAKEVSDASKRKGRYRS*
Ga0133913_1356655213300010885Freshwater LakeIETGIAPQHLIELDSAMFKAMLDGLKDRAKEISDASKRKGRN*
Ga0157623_114316113300012707FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRG
Ga0157609_121609513300012717FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASNRKGRR*
Ga0157552_112175243300012728FreshwaterLGIAPQHLLELDKIMLDALVKGLKDEAKESADASKR
Ga0157602_110960113300012730FreshwaterLGIAPQHLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS*
Ga0138289_107516933300012763Freshwater LakeLGIAPQQLLELDPIMLQALLQGLRDEAKESSDASRGKGRNR
Ga0157536_133848913300013079FreshwaterLGIAPQQLLELDKTMLDALLQGLKDEAKEVDDASKRKGRR
Ga0177922_1086931343300013372FreshwaterLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGR
Ga0181364_106350433300017701Freshwater LakeLGVAPQQLLELDPIMLQALLKGLKDEQKEISDANR
Ga0181347_105492833300017722Freshwater LakeLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP
Ga0181365_107203613300017736Freshwater LakeQHLLELDKTMLDALVQGLKDEAKESSDASKRKGRR
Ga0181365_112379223300017736Freshwater LakeLSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVSDASRSKGRHRTS
Ga0181356_102744033300017761Freshwater LakeIARLSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR
Ga0181356_117806413300017761Freshwater LakeQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP
Ga0181356_117807613300017761Freshwater LakeQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTS
Ga0181358_100526113300017774Freshwater LakePQQLLELDRTMLNALFEGLAEGAKESADASKRKGRR
Ga0181358_100716473300017774Freshwater LakeARLSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR
Ga0181358_118610113300017774Freshwater LakePQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGGGRS
Ga0181358_118737313300017774Freshwater LakeQQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP
Ga0181357_100421513300017777Freshwater LakeAPQHLLELDKTMLDALVQGLKDEAKEINDASKRKGRR
Ga0181357_103121333300017777Freshwater LakeRLGIAPQHLLELDKTMLDALVQGLKDEAKETSDASKRKGRGRS
Ga0181349_103636433300017778Freshwater LakePQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR
Ga0181349_107694133300017778Freshwater LakeLIARLSIRLGIAPQHLLELDKTMLDALVQGLKDEAKETSDASKRKGRGRS
Ga0181349_119444513300017778Freshwater LakeRLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRATRKR
Ga0181349_129026513300017778Freshwater LakeQQLLELDKTMLDALLQGLRDEAKEVDDASKRKGRR
Ga0181346_100775113300017780Freshwater LakeQQLLDLDPIMLQALLQGLKDEQKEISDASKRKGRS
Ga0181346_101491443300017780Freshwater LakeSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVKDASRSKGRHSTSQGS
Ga0181346_105221913300017780Freshwater LakeRLQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRNRTP
Ga0181346_107293833300017780Freshwater LakeLSIRLGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR
Ga0181346_107641833300017780Freshwater LakeIRLGLAPQVLLDLDRTMLNALLQGLTDEAKEVKDASRGKRRP
Ga0181346_110867733300017780Freshwater LakeRLQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTS
Ga0181348_115356013300017784Freshwater LakeSIRLGIAPQQLLELDPIMLQALLKGLKDEQKEISDANRSKGRTRTP
Ga0181348_126127123300017784Freshwater LakeLLELDPIMLQALLQGLRDEAKESSDASRGKGRNRTP
Ga0181355_127361113300017785Freshwater LakeIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTS
Ga0181355_128629313300017785Freshwater LakeLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP
Ga0207193_158505513300020048Freshwater Lake SedimentLGISPQALLDLDKTMLDALVQGLKDEAKETSDANRS
Ga0211734_1005762613300020159FreshwaterIAPQHLLELDKVMLDALLQGLSDEAKEIKNASTTKRRR
Ga0163155_1009141113300020180Freshwater Microbial MatIRLGIAPQHLLSLDKVMLDALVQGLKDEAKESKDASNRQGRR
Ga0208228_105362213300020535FreshwaterLSIRLGISPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKRRG
Ga0207939_100268443300020536FreshwaterRLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR
Ga0207942_100126213300020549FreshwaterLAIAPQQLLELDKTMLDALLQGLRDEAKEVDDASKRKG
Ga0208599_100095983300020554FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKRRH
Ga0208599_106374413300020554FreshwaterIARLSIRLAIAPQQLLELDKTMLDALLQGLRDEAKEVDDASKRKGRR
Ga0208231_105044713300020557FreshwaterRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKSRRR
Ga0208723_102947213300020571FreshwaterSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKRRH
Ga0163149_1061872213300020596Freshwater Microbial MatAPQHLLSLDKVMLDALVQGLKDEAKESKDASNRQGRR
Ga0213920_103780643300021438FreshwaterLGIAPQQLLDLDKAMLEALVQGLKDEAKEAKDANRGRRR
Ga0181354_104614913300022190Freshwater LakeIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR
Ga0181351_112355933300022407Freshwater LakeRLGIAPQHLLELDKTMLDALVQGLKDEAKEVSDANRGKRRGRP
Ga0181351_127668213300022407Freshwater LakeARLSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVSDASRSKGRYRTS
Ga0214919_10014074193300023184FreshwaterARLSIRLGIAPQQIIDLDPVMLEALLQGLKDEAKEIQDASKRKGRY
Ga0214919_1031198913300023184FreshwaterLSIRLGIAPQQIIDLDPVMLEALLQGLKDEAKEIQDASKR
Ga0244775_1078653513300024346EstuarineLIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS
Ga0244775_1105462213300024346EstuarineRLGIAPQQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP
Ga0208916_1028110923300025896AqueousLIARLSIRLGISPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGSRRSRS
Ga0209975_100186333300026993Freshwater LakeSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIRNANKGGRR
Ga0209300_105855813300027365Deep SubsurfaceLGIAPQHLLELDKVMLDALLIGLQDEAKEIKDANATKRRR
Ga0209300_106080913300027365Deep SubsurfaceSIRLGIAPQHLLELDKVMLDALLIGLQDEAKEIKDASNSKRRR
Ga0255079_101430713300027601FreshwaterLSIRLGVAPQQLLELEPTMLQALLQGLKDEAKEMNDANRSSRRGRP
Ga0208133_104368933300027631EstuarineARLSIRLGIAPQQLLDLDKNMLDALVQGLKDEAKEVSDANGSKRRGRA
Ga0208133_116337523300027631EstuarineLGIAPQQLLELDKTMLDALVQGLKDEAKEVSDASKRKGRG
Ga0209356_107172913300027644Freshwater LakePPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP
Ga0209356_112809213300027644Freshwater LakeLGIAPQQLLELDKTMLDALLQGLKDEAKEVDDASKR
Ga0209087_101318113300027734Freshwater LakeIARLSIRLGIAPQHLLDLDKTMLDALVQGLKDEAKETADAHRNTRKR
Ga0209087_110059913300027734Freshwater LakePQQLLELDPIMLQALLQGLKDEAKEIQDASKRKGRY
Ga0209087_117144413300027734Freshwater LakeLSIRLGIAPQQIIELDPIMLQALLQGLKDEAKEIQDASQRK
Ga0209087_117176813300027734Freshwater LakeRLGIAPQHLLELDKTMLDALVQGLKDEAKEIKDAHRSKRRN
Ga0209596_115791833300027754Freshwater LakeLGIAPQQLLELDKTMLDALVQGLKDEAQEVSDASK
Ga0209296_105089833300027759Freshwater LakeSIRLQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP
Ga0209296_106189433300027759Freshwater LakePQHLIELDSAMFKAMLDGLTDRAKEIKDASKRKGRH
Ga0209296_121775633300027759Freshwater LakeQHLLELDKTMLDALVQGLKDEAKELKDASRSKGRHRTP
Ga0209134_1007597113300027764Freshwater LakeIAPQHLLELDKVMLDALLQGLKDEAKEIKDASSRTSRQRRSP
Ga0209134_1031532813300027764Freshwater LakeLGIAPQQLLELDPIMLEALLKGLKDEQKEISDANR
Ga0209500_1045792613300027782Freshwater LakeLSIRLQIPPQQLLELDPIMLQALLQGLKDEAKEIENASR
Ga0209246_1000384283300027785Freshwater LakeARLSIRLGIAPQQLLNLDKTMLDALVQGLKDEAKETSDASKRKGRR
Ga0209246_1014805713300027785Freshwater LakeQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP
Ga0209246_1018731833300027785Freshwater LakeLIARLSIRLGISPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR
Ga0209246_1027278013300027785Freshwater LakeLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP
Ga0209107_1030131113300027797Freshwater And SedimentSIRLGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR
Ga0209353_1005119433300027798Freshwater LakeIRLGVAPQQLLELDQTMLRALLDGLKDEARESENASRSKGRHRTP
Ga0209353_1022230723300027798Freshwater LakeIARLSIRLGIAPQQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP
Ga0209353_1024100033300027798Freshwater LakeQLLELDKTMLDALVQGLKDEAKEVSDASRSKGRYRTS
Ga0209353_1029790513300027798Freshwater LakeGIAPQHLLELDKTMLDALVQGLKDEAKETSDASKRKGRGRS
Ga0209354_1013226413300027808Freshwater LakePPQALLELDNTMLDALVQGLKDEAKEVSDANRTKRKR
Ga0209354_1019576733300027808Freshwater LakeGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR
Ga0209191_129587613300027969Freshwater LakeQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP
Ga0209191_132159223300027969Freshwater LakeRLQIPPQQLLELDPIMLQALLQGLKDEAKEIQDASKRKGRY
(restricted) Ga0247837_115307633300027970FreshwaterPQQLLELDKTMLDALVQGLKDEAKESSDAGKRKGRR
Ga0209401_102385613300027971Freshwater LakeARLSIRLGIAPQHLLELDKTMLDALVQGLKDEAKEISDASKRKGRR
Ga0209079_1023922323300027972Freshwater SedimentLIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKRRGRA
Ga0304730_124802223300028394Freshwater LakeQQLLELDKIMLDALVQGLKDEAQEVSDASKRKGRR
Ga0315907_1043742443300031758FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR
Ga0315899_1006474853300031784FreshwaterSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS
Ga0315899_1092469423300031784FreshwaterPQHLLELDKVMLDALLQGLTDEAKEIRDASTTKRRR
Ga0315899_1125821413300031784FreshwaterPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRG
Ga0315899_1155433913300031784FreshwaterAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR
Ga0315900_1007122243300031787FreshwaterSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRNRS
Ga0315900_1010695613300031787FreshwaterQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR
Ga0315900_1016508413300031787FreshwaterSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRYRS
Ga0315909_1001544713300031857FreshwaterYLIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKSRRR
Ga0315904_1045706433300031951FreshwaterARLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDANNIKRRR
Ga0315901_1086374313300031963FreshwaterSLETGIAPQHLIELDPRMFRALLDGLKDRNKEMRDASKRKGRY
Ga0315906_1019463333300032050FreshwaterLSIRLGIAPQQLLELDKTMLDALLQGLKDEAKEVSDASKRKGRS
Ga0315902_1004611273300032093FreshwaterRLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR
Ga0315902_1025407213300032093FreshwaterIARLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDASNTKRRR
Ga0315902_1079157513300032093FreshwaterPQQLLELDKTMFDALLQGLKDEAKEVSDASKRKGRH
Ga0315902_1091714013300032093FreshwaterSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDANNIKRRR
Ga0315903_1003564873300032116FreshwaterSLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR
Ga0315903_1114685913300032116FreshwaterYLIARLSIRLGIAPQHLLELDKVMLDALVQGLNDEAKEIRDASNNRRKR
Ga0334982_0397150_2_1183300033981FreshwaterQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKRRNRTS
Ga0334994_0293234_2_1393300033993FreshwaterSIRLGIAPQQLLDLDKTMLDALVQGLRDEAKEVSDGNRSSRRTRS
Ga0334994_0299443_666_7883300033993FreshwaterLGIAPQALLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR
Ga0334994_0301677_688_8103300033993FreshwaterLGIAPQALLDLDKTMLDALVQGLKDEAKEVSDASNRKGRR
Ga0334996_0227121_258_3803300033994FreshwaterLGIAPQQLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRR
Ga0334996_0547063_1_1413300033994FreshwaterARLSIRLGIAPQQLLELDKTMFDALLQGLKDEAKEVDDASKRKGRR
Ga0335003_0200675_657_7853300033995FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRQGRSRS
Ga0334979_0745267_2_1333300033996FreshwaterLGISPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKGRNRTS
Ga0334986_0228028_679_8013300034012FreshwaterLGIAPQHLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRS
Ga0335005_0737429_376_5163300034022FreshwaterLSIRLGVAPQQLLELEPTMLQALLQGLKDETKEMNDANRSSRRGRP
Ga0334983_0076188_1828_19503300034060FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRN
Ga0334983_0112945_1631_17413300034060FreshwaterPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKRRH
Ga0334987_0068871_752_8743300034061FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASNRKGRR
Ga0334987_0069806_3_1283300034061FreshwaterGIAPQALLDLDKNMLDALVQGLKDEAKEVENASRGKRRGRS
Ga0334987_0323222_883_10113300034061FreshwaterLGIAPQALLDLDKNMLDALVQGLKDEAKEVENASRGKRRGRS
Ga0334987_0803091_1_1263300034061FreshwaterRLGIAPQHLLELDKNMLDALVQGLKDEAKESQDASNSKRRR
Ga0334995_0011858_534_6563300034062FreshwaterLGIAPQQLLDLDKNMLDALVQGLKDEAKEVRDASKRKRRP
Ga0334995_0095189_81_2033300034062FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR
Ga0334995_0734176_423_5513300034062FreshwaterSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKNRRR
Ga0335010_0030677_3956_40783300034092FreshwaterLGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR
Ga0335010_0164162_3_1283300034092FreshwaterRLGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR
Ga0335010_0321490_1_1083300034092FreshwaterMGIAPQQLLELDKTMLDALLQGLRDEAKEVDDASKR
Ga0335012_0462194_2_1153300034093FreshwaterQLLELDPTMLQALLEGLKDEAKEISDANRSKGRNRTP
Ga0335027_0002909_5512_56403300034101FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEVKEVSDASKRKGRYRS
Ga0335027_0004318_2822_29443300034101FreshwaterLGIAPQQLLELDKTMLDALLQGLQDEAKEISDASKRKGRR
Ga0335027_0164841_1496_16093300034101FreshwaterQALLDLDKNMLDALVQGLKDEAKEVENASRGKRRGRS
Ga0335027_0296953_226_3483300034101FreshwaterLGIAPQQLLELDKTMLEALLQGLKDEAKEISDASKRKGRS
Ga0335031_0700303_468_5813300034104FreshwaterAPQHLLELDQPMLKALLQGLHDEAKEISDASKRKGRG
Ga0335036_0308033_222_3503300034106FreshwaterLGIAPQQLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRGRS
Ga0335036_0695357_459_6023300034106FreshwaterIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR
Ga0335036_0781150_3_1433300034106FreshwaterARLSIRLGVAPQQLLELDRDMLNALFQGLTDEAKESADASRARRRK
Ga0335051_0057925_3_1433300034109FreshwaterARLSIRLGIAPQQLLELDRDMLNALFQGLTDEAKESIDASKRKGRR
Ga0335063_0122253_306_4283300034111FreshwaterLGIAPQQLLELDKTMLEALLQGLKDEAKEISDASKRKGRH
Ga0335063_0394699_1_1083300034111FreshwaterQQLLELDKTMLDALLLGLKDEAKEISDASKRKGRH
Ga0335068_0288694_17_1393300034116FreshwaterLQIPPQALLELDNTMLDALVQGLKDEAKEVSDANRTKRKR
Ga0335068_0387643_212_3403300034116FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRYRS
Ga0335056_0413468_234_3623300034120FreshwaterLGIAPQQLLDLDKAMLDALVQGLKDEAKEVSDANGSKRRGRA
Ga0335056_0489310_188_3103300034120FreshwaterLGIAPQQLLDLDKVMLDALVQGLKDEAKEVSNASNRKGRR
Ga0335065_0417174_2_1123300034200FreshwaterQLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRGRS
Ga0335049_0175594_1365_15173300034272FreshwaterLIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKRRGRP
Ga0335049_0348784_73_1953300034272FreshwaterLGIAPQQLLDLDKIMLDALVQGLKDEAKEVSDASKRKGRR
Ga0335049_0859407_2_1123300034272FreshwaterAPQALLELDKTMLDALVQGLKDEAKETSDANRVKRR
Ga0335007_0076175_3_1253300034283FreshwaterIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRQGRGRS
Ga0335013_0253341_1_1443300034284FreshwaterLIARLSIRLGIAPQQLLELDKTMLDALLQGLRDEAKEVSDASKNRRR
Ga0335064_0139305_1075_11973300034357FreshwaterLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRTARKR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.