Basic Information | |
---|---|
Family ID | F025029 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 203 |
Average Sequence Length | 41 residues |
Representative Sequence | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 203 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 26.24 % |
% of genes near scaffold ends (potentially truncated) | 81.77 % |
% of genes from short scaffolds (< 2000 bps) | 78.33 % |
Associated GOLD sequencing projects | 114 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (89.163 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.557 % of family members) |
Environment Ontology (ENVO) | Unclassified (73.892 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.158 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 203 Family Scaffolds |
---|---|---|
PF04860 | Phage_portal | 0.99 |
PF12850 | Metallophos_2 | 0.49 |
PF05065 | Phage_capsid | 0.49 |
PF05869 | Dam | 0.49 |
PF09636 | XkdW | 0.49 |
PF06199 | Phage_tail_2 | 0.49 |
COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.55 % |
Unclassified | root | N/A | 3.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001282|B570J14230_10048905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1411 | Open in IMG/M |
3300002835|B570J40625_100142968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2758 | Open in IMG/M |
3300002835|B570J40625_101002038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300003277|JGI25908J49247_10014450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2418 | Open in IMG/M |
3300003393|JGI25909J50240_1092928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300003429|JGI25914J50564_10162632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300004096|Ga0066177_10013008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2558 | Open in IMG/M |
3300004096|Ga0066177_10128103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
3300004112|Ga0065166_10021779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1900 | Open in IMG/M |
3300004124|Ga0066178_10118819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300004126|Ga0066179_10111394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300004481|Ga0069718_10028656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300004836|Ga0007759_11027925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300005527|Ga0068876_10344726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
3300005527|Ga0068876_10662049 | Not Available | 561 | Open in IMG/M |
3300005528|Ga0068872_10243932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
3300005581|Ga0049081_10189505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300005582|Ga0049080_10037263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1690 | Open in IMG/M |
3300005662|Ga0078894_10023428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5024 | Open in IMG/M |
3300005662|Ga0078894_11206675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300006018|Ga0068875_1004211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium LSUCC0112 | 1328 | Open in IMG/M |
3300006484|Ga0070744_10018022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2095 | Open in IMG/M |
3300006805|Ga0075464_10018578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3566 | Open in IMG/M |
3300006805|Ga0075464_10710275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300007363|Ga0075458_10091500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
3300008119|Ga0114354_1009483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7054 | Open in IMG/M |
3300008120|Ga0114355_1089335 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
3300008266|Ga0114363_1063322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1429 | Open in IMG/M |
3300008266|Ga0114363_1127640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300008339|Ga0114878_1009062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5085 | Open in IMG/M |
3300008448|Ga0114876_1198575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300008450|Ga0114880_1081770 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
3300008450|Ga0114880_1202365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300008450|Ga0114880_1278029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300009037|Ga0105093_10728247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300009077|Ga0115552_1453343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300009081|Ga0105098_10401098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300009082|Ga0105099_10029885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2804 | Open in IMG/M |
3300009082|Ga0105099_10301503 | Not Available | 939 | Open in IMG/M |
3300009131|Ga0115027_11444760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300009164|Ga0114975_10637895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300009168|Ga0105104_10595166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300009169|Ga0105097_10578648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300009170|Ga0105096_10434159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300009181|Ga0114969_10467059 | Not Available | 711 | Open in IMG/M |
3300009183|Ga0114974_10222950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
3300009183|Ga0114974_10360359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300009194|Ga0114983_1082502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300010354|Ga0129333_10220651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1719 | Open in IMG/M |
3300010885|Ga0133913_13566552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300012707|Ga0157623_1143161 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
3300012717|Ga0157609_1216095 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
3300012728|Ga0157552_1121752 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
3300012730|Ga0157602_1109601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300012763|Ga0138289_1075169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300013079|Ga0157536_1338489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300013372|Ga0177922_10869313 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300017701|Ga0181364_1063504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300017722|Ga0181347_1054928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1197 | Open in IMG/M |
3300017736|Ga0181365_1072036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300017736|Ga0181365_1123792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300017761|Ga0181356_1027440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2055 | Open in IMG/M |
3300017761|Ga0181356_1178064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300017761|Ga0181356_1178076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300017774|Ga0181358_1005261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5541 | Open in IMG/M |
3300017774|Ga0181358_1007164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4716 | Open in IMG/M |
3300017774|Ga0181358_1186101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300017774|Ga0181358_1187373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300017777|Ga0181357_1004215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5783 | Open in IMG/M |
3300017777|Ga0181357_1031213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2101 | Open in IMG/M |
3300017778|Ga0181349_1036364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1966 | Open in IMG/M |
3300017778|Ga0181349_1076941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
3300017778|Ga0181349_1194445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300017778|Ga0181349_1290265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300017780|Ga0181346_1007751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4629 | Open in IMG/M |
3300017780|Ga0181346_1014914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3297 | Open in IMG/M |
3300017780|Ga0181346_1052219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1652 | Open in IMG/M |
3300017780|Ga0181346_1072938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1363 | Open in IMG/M |
3300017780|Ga0181346_1108677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
3300017784|Ga0181348_1153560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300017784|Ga0181348_1261271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300017785|Ga0181355_1273611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300017785|Ga0181355_1286293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300020048|Ga0207193_1585055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300020159|Ga0211734_10057626 | All Organisms → Viruses → Predicted Viral | 2459 | Open in IMG/M |
3300020180|Ga0163155_10091411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1818 | Open in IMG/M |
3300020535|Ga0208228_1053622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300020536|Ga0207939_1002684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3755 | Open in IMG/M |
3300020549|Ga0207942_1001262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4996 | Open in IMG/M |
3300020554|Ga0208599_1000959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5942 | Open in IMG/M |
3300020554|Ga0208599_1063744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300020557|Ga0208231_1050447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300020571|Ga0208723_1029472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300020596|Ga0163149_10618722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300021438|Ga0213920_1037806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1057 | Open in IMG/M |
3300022190|Ga0181354_1046149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
3300022407|Ga0181351_1123559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
3300022407|Ga0181351_1276682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300023184|Ga0214919_10014074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9602 | Open in IMG/M |
3300023184|Ga0214919_10311989 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
3300024346|Ga0244775_10786535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300024346|Ga0244775_11054622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300025896|Ga0208916_10281109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300026993|Ga0209975_1001863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2107 | Open in IMG/M |
3300027365|Ga0209300_1058558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300027365|Ga0209300_1060809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027601|Ga0255079_1014307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1895 | Open in IMG/M |
3300027631|Ga0208133_1043689 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
3300027631|Ga0208133_1163375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300027644|Ga0209356_1071729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
3300027644|Ga0209356_1128092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300027734|Ga0209087_1013181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4178 | Open in IMG/M |
3300027734|Ga0209087_1100599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1226 | Open in IMG/M |
3300027734|Ga0209087_1171444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300027734|Ga0209087_1171768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300027754|Ga0209596_1157918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1003 | Open in IMG/M |
3300027759|Ga0209296_1050898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2162 | Open in IMG/M |
3300027759|Ga0209296_1061894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1909 | Open in IMG/M |
3300027759|Ga0209296_1217756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300027764|Ga0209134_10075971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
3300027764|Ga0209134_10315328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300027782|Ga0209500_10457926 | Not Available | 500 | Open in IMG/M |
3300027785|Ga0209246_10003842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5608 | Open in IMG/M |
3300027785|Ga0209246_10148057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300027785|Ga0209246_10187318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300027785|Ga0209246_10272780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300027797|Ga0209107_10301311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300027798|Ga0209353_10051194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1900 | Open in IMG/M |
3300027798|Ga0209353_10222307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300027798|Ga0209353_10241000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300027798|Ga0209353_10297905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300027808|Ga0209354_10132264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
3300027808|Ga0209354_10195767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300027969|Ga0209191_1295876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300027969|Ga0209191_1321592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1153076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
3300027971|Ga0209401_1023856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3057 | Open in IMG/M |
3300027972|Ga0209079_10239223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300028394|Ga0304730_1248022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300031758|Ga0315907_10437424 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
3300031784|Ga0315899_10064748 | All Organisms → Viruses → Predicted Viral | 3798 | Open in IMG/M |
3300031784|Ga0315899_10924694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300031784|Ga0315899_11258214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300031784|Ga0315899_11554339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300031787|Ga0315900_10071222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3533 | Open in IMG/M |
3300031787|Ga0315900_10106956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2704 | Open in IMG/M |
3300031787|Ga0315900_10165084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2021 | Open in IMG/M |
3300031857|Ga0315909_10015447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7838 | Open in IMG/M |
3300031951|Ga0315904_10457064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
3300031963|Ga0315901_10863743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300032050|Ga0315906_10194633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1915 | Open in IMG/M |
3300032093|Ga0315902_10046112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5068 | Open in IMG/M |
3300032093|Ga0315902_10254072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1707 | Open in IMG/M |
3300032093|Ga0315902_10791575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300032093|Ga0315902_10917140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300032116|Ga0315903_10035648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5250 | Open in IMG/M |
3300032116|Ga0315903_11146859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300033981|Ga0334982_0397150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300033993|Ga0334994_0293234 | Not Available | 830 | Open in IMG/M |
3300033993|Ga0334994_0299443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300033993|Ga0334994_0301677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300033994|Ga0334996_0227121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300033994|Ga0334996_0547063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300033995|Ga0335003_0200675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
3300033996|Ga0334979_0745267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300034012|Ga0334986_0228028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
3300034022|Ga0335005_0737429 | Not Available | 516 | Open in IMG/M |
3300034060|Ga0334983_0076188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2176 | Open in IMG/M |
3300034060|Ga0334983_0112945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1742 | Open in IMG/M |
3300034061|Ga0334987_0068871 | All Organisms → Viruses → Predicted Viral | 2839 | Open in IMG/M |
3300034061|Ga0334987_0069806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2814 | Open in IMG/M |
3300034061|Ga0334987_0323222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
3300034061|Ga0334987_0803091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300034062|Ga0334995_0011858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8129 | Open in IMG/M |
3300034062|Ga0334995_0095189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2274 | Open in IMG/M |
3300034062|Ga0334995_0734176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300034092|Ga0335010_0030677 | All Organisms → Viruses → Predicted Viral | 4079 | Open in IMG/M |
3300034092|Ga0335010_0164162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1394 | Open in IMG/M |
3300034092|Ga0335010_0321490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300034093|Ga0335012_0462194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300034101|Ga0335027_0002909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15033 | Open in IMG/M |
3300034101|Ga0335027_0004318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12477 | Open in IMG/M |
3300034101|Ga0335027_0164841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1611 | Open in IMG/M |
3300034101|Ga0335027_0296953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300034104|Ga0335031_0700303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300034106|Ga0335036_0308033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300034106|Ga0335036_0695357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300034106|Ga0335036_0781150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300034109|Ga0335051_0057925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2060 | Open in IMG/M |
3300034111|Ga0335063_0122253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1546 | Open in IMG/M |
3300034111|Ga0335063_0394699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300034116|Ga0335068_0288694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300034116|Ga0335068_0387643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300034120|Ga0335056_0413468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300034120|Ga0335056_0489310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300034200|Ga0335065_0417174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300034272|Ga0335049_0175594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
3300034272|Ga0335049_0348784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
3300034272|Ga0335049_0859407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300034283|Ga0335007_0076175 | All Organisms → Viruses → Predicted Viral | 2530 | Open in IMG/M |
3300034284|Ga0335013_0253341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
3300034357|Ga0335064_0139305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1496 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 29.56% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 26.11% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.36% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.87% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.94% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.46% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.46% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.97% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.97% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.48% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.99% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.99% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.99% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.99% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.49% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.49% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.49% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.49% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.49% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.49% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.49% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006018 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013079 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES022 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020180 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1 | Environmental | Open in IMG/M |
3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026993 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J14230_100489051 | 3300001282 | Freshwater | LGLAPQQLLELDPIMLQALLQGLKDEAKEIQDASKRKGRY* |
B570J40625_1001429681 | 3300002835 | Freshwater | LIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR* |
B570J40625_1010020382 | 3300002835 | Freshwater | LGIAPQQLLDLDPIMLQALLQGLKDEAKESQDASKRKGRY* |
JGI25908J49247_100144503 | 3300003277 | Freshwater Lake | LGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR* |
JGI25909J50240_10929283 | 3300003393 | Freshwater Lake | LGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR* |
JGI25914J50564_101626322 | 3300003429 | Freshwater Lake | LSIRLGIAPQQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP* |
Ga0066177_100130081 | 3300004096 | Freshwater Lake | RLGIAPQQLLELDKTMLDALVQGLKDEAKEVKDASRSKGRHSTSQGS* |
Ga0066177_101281033 | 3300004096 | Freshwater Lake | LQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRT |
Ga0065166_100217791 | 3300004112 | Freshwater Lake | APQHLLELDKTMLDALVQGLKDEAKETSDASKRKGRR*TP* |
Ga0066178_101188191 | 3300004124 | Freshwater Lake | RLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR* |
Ga0066179_101113941 | 3300004126 | Freshwater Lake | IRLGIAPQQLLELDKTMLDALVQGLKDEAKEVKDASRSKGRHSTSQGS* |
Ga0069718_100286562 | 3300004481 | Sediment | IPPQALLDLDKTMLDALVQGLKDEAKEVSDASKRKGRYRS* |
Ga0007759_110279251 | 3300004836 | Freshwater Lake | GIAPQHLLELDKVMLDALLKGLKDEAKEIKDASNAKRRH* |
Ga0068876_103447263 | 3300005527 | Freshwater Lake | APQHLLELDKVMLDALLQGLTDEAKEIKDASNTKRRR* |
Ga0068876_106620492 | 3300005527 | Freshwater Lake | ARLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIRNANKGGRR* |
Ga0068872_102439323 | 3300005528 | Freshwater Lake | IARLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDANATKRRR* |
Ga0049081_101895053 | 3300005581 | Freshwater Lentic | LQIPPQALLELDNTMLDALVQGLKDEAKEVSDANRTKRKR* |
Ga0049080_100372633 | 3300005582 | Freshwater Lentic | QLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR* |
Ga0078894_100234287 | 3300005662 | Freshwater Lake | IARLSIRLGIAPQHLLELDKTMLDALVQGLKDEAKESDDASKSRRR* |
Ga0078894_112066751 | 3300005662 | Freshwater Lake | ARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS* |
Ga0068875_10042113 | 3300006018 | Freshwater Lake | SIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIRNANKGGRR* |
Ga0070744_100180223 | 3300006484 | Estuarine | ARLSIRLGIAPQQLLDLDKNMLDALVQGLKDEAKEVSDANGSKRRGRA* |
Ga0075464_100185781 | 3300006805 | Aqueous | RLSIETGIAPQHLIELDSAMFRAMLDGLKDRAKEISDASKRKGRY* |
Ga0075464_107102751 | 3300006805 | Aqueous | SIRLGIAPQQLLELDKDMLDALVQGLKDEAKEIKDASNSKRRR* |
Ga0075458_100915003 | 3300007363 | Aqueous | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRG* |
Ga0114354_10094834 | 3300008119 | Freshwater, Plankton | LGIAPQQLLDLDKTMLDALLQGLKDEAKEVSDASKRKGRS* |
Ga0114355_10893351 | 3300008120 | Freshwater, Plankton | LGIAPQQLLDLDKIMLDALVQGLKDEAKEVSDASKRQGRGRS* |
Ga0114363_10633225 | 3300008266 | Freshwater, Plankton | LGIAPQQLLELDPIMLQALLQGLRDDAKEMNDANRNKGRN |
Ga0114363_11276401 | 3300008266 | Freshwater, Plankton | LSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDANNIKRRR* |
Ga0114878_10090621 | 3300008339 | Freshwater Lake | IARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR* |
Ga0114876_11985752 | 3300008448 | Freshwater Lake | GIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR* |
Ga0114880_10817703 | 3300008450 | Freshwater Lake | IRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKRRH* |
Ga0114880_12023651 | 3300008450 | Freshwater Lake | IARLSIRLGISPQQLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRR* |
Ga0114880_12780291 | 3300008450 | Freshwater Lake | QHLLELDKVMLDALLQGLTDEAKEIKDASNRQGRR* |
Ga0105093_107282471 | 3300009037 | Freshwater Sediment | LGIAPQQLLDLDKIMLDALVQGLKDEAKESQDASKRKGRG* |
Ga0115552_14533432 | 3300009077 | Pelagic Marine | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRNRS* |
Ga0105098_104010982 | 3300009081 | Freshwater Sediment | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKGRGRA* |
Ga0105099_100298851 | 3300009082 | Freshwater Sediment | IRLQIPPQYLLDLDKNMLDALVQGLKDEAKEVSDASKGRNKRR* |
Ga0105099_103015033 | 3300009082 | Freshwater Sediment | LGIPPQALLDLDKTMLDALVQGLKDEAKEVSDANRGQRRGRA* |
Ga0115027_114447602 | 3300009131 | Wetland | LGISPQALLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS* |
Ga0114975_106378951 | 3300009164 | Freshwater Lake | LGIAPQQLLELDKTMLDALVQGLKDEAKEVSDASKRKGRGRS* |
Ga0105104_105951663 | 3300009168 | Freshwater Sediment | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANTRNRRGRAYK |
Ga0105097_105786482 | 3300009169 | Freshwater Sediment | QQLLDLDKTMLDALVQGLKDEAKEVSDASNRKGRR* |
Ga0105096_104341591 | 3300009170 | Freshwater Sediment | LGIAPQQLLDLDKIMLDALVQGLKDEAKESQDASKRKG |
Ga0114969_104670592 | 3300009181 | Freshwater Lake | IETGIAPQHLIELDSAMFKAMLDGLKDRAKEISDASKRKGRG* |
Ga0114974_102229504 | 3300009183 | Freshwater Lake | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVRDANRVTRKR* |
Ga0114974_103603591 | 3300009183 | Freshwater Lake | QQLLDLDKTMLDALVQGLKDEAKEVRDANRVTRKR* |
Ga0114983_10825021 | 3300009194 | Deep Subsurface | LSIRLGISPQQLLDLDKTMLDALVQGLKDEAKEVSD |
Ga0129333_102206513 | 3300010354 | Freshwater To Marine Saline Gradient | RLGIAPQQLLELDKDMLDALVQGLKDEAKEVSDASKRKGRYRS* |
Ga0133913_135665521 | 3300010885 | Freshwater Lake | IETGIAPQHLIELDSAMFKAMLDGLKDRAKEISDASKRKGRN* |
Ga0157623_11431611 | 3300012707 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRG |
Ga0157609_12160951 | 3300012717 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASNRKGRR* |
Ga0157552_11217524 | 3300012728 | Freshwater | LGIAPQHLLELDKIMLDALVKGLKDEAKESADASKR |
Ga0157602_11096011 | 3300012730 | Freshwater | LGIAPQHLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS* |
Ga0138289_10751693 | 3300012763 | Freshwater Lake | LGIAPQQLLELDPIMLQALLQGLRDEAKESSDASRGKGRNR |
Ga0157536_13384891 | 3300013079 | Freshwater | LGIAPQQLLELDKTMLDALLQGLKDEAKEVDDASKRKGRR |
Ga0177922_108693134 | 3300013372 | Freshwater | LGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGR |
Ga0181364_10635043 | 3300017701 | Freshwater Lake | LGVAPQQLLELDPIMLQALLKGLKDEQKEISDANR |
Ga0181347_10549283 | 3300017722 | Freshwater Lake | LLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP |
Ga0181365_10720361 | 3300017736 | Freshwater Lake | QHLLELDKTMLDALVQGLKDEAKESSDASKRKGRR |
Ga0181365_11237922 | 3300017736 | Freshwater Lake | LSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVSDASRSKGRHRTS |
Ga0181356_10274403 | 3300017761 | Freshwater Lake | IARLSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR |
Ga0181356_11780641 | 3300017761 | Freshwater Lake | QIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP |
Ga0181356_11780761 | 3300017761 | Freshwater Lake | QIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTS |
Ga0181358_10052611 | 3300017774 | Freshwater Lake | PQQLLELDRTMLNALFEGLAEGAKESADASKRKGRR |
Ga0181358_10071647 | 3300017774 | Freshwater Lake | ARLSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR |
Ga0181358_11861011 | 3300017774 | Freshwater Lake | PQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGGGRS |
Ga0181358_11873731 | 3300017774 | Freshwater Lake | QQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP |
Ga0181357_10042151 | 3300017777 | Freshwater Lake | APQHLLELDKTMLDALVQGLKDEAKEINDASKRKGRR |
Ga0181357_10312133 | 3300017777 | Freshwater Lake | RLGIAPQHLLELDKTMLDALVQGLKDEAKETSDASKRKGRGRS |
Ga0181349_10363643 | 3300017778 | Freshwater Lake | PQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR |
Ga0181349_10769413 | 3300017778 | Freshwater Lake | LIARLSIRLGIAPQHLLELDKTMLDALVQGLKDEAKETSDASKRKGRGRS |
Ga0181349_11944451 | 3300017778 | Freshwater Lake | RLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRATRKR |
Ga0181349_12902651 | 3300017778 | Freshwater Lake | QQLLELDKTMLDALLQGLRDEAKEVDDASKRKGRR |
Ga0181346_10077511 | 3300017780 | Freshwater Lake | QQLLDLDPIMLQALLQGLKDEQKEISDASKRKGRS |
Ga0181346_10149144 | 3300017780 | Freshwater Lake | SIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVKDASRSKGRHSTSQGS |
Ga0181346_10522191 | 3300017780 | Freshwater Lake | RLQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRNRTP |
Ga0181346_10729383 | 3300017780 | Freshwater Lake | LSIRLGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR |
Ga0181346_10764183 | 3300017780 | Freshwater Lake | IRLGLAPQVLLDLDRTMLNALLQGLTDEAKEVKDASRGKRRP |
Ga0181346_11086773 | 3300017780 | Freshwater Lake | RLQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTS |
Ga0181348_11535601 | 3300017784 | Freshwater Lake | SIRLGIAPQQLLELDPIMLQALLKGLKDEQKEISDANRSKGRTRTP |
Ga0181348_12612712 | 3300017784 | Freshwater Lake | LLELDPIMLQALLQGLRDEAKESSDASRGKGRNRTP |
Ga0181355_12736111 | 3300017785 | Freshwater Lake | IPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTS |
Ga0181355_12862931 | 3300017785 | Freshwater Lake | LELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP |
Ga0207193_15850551 | 3300020048 | Freshwater Lake Sediment | LGISPQALLDLDKTMLDALVQGLKDEAKETSDANRS |
Ga0211734_100576261 | 3300020159 | Freshwater | IAPQHLLELDKVMLDALLQGLSDEAKEIKNASTTKRRR |
Ga0163155_100914111 | 3300020180 | Freshwater Microbial Mat | IRLGIAPQHLLSLDKVMLDALVQGLKDEAKESKDASNRQGRR |
Ga0208228_10536221 | 3300020535 | Freshwater | LSIRLGISPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKRRG |
Ga0207939_10026844 | 3300020536 | Freshwater | RLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR |
Ga0207942_10012621 | 3300020549 | Freshwater | LAIAPQQLLELDKTMLDALLQGLRDEAKEVDDASKRKG |
Ga0208599_10009598 | 3300020554 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKRRH |
Ga0208599_10637441 | 3300020554 | Freshwater | IARLSIRLAIAPQQLLELDKTMLDALLQGLRDEAKEVDDASKRKGRR |
Ga0208231_10504471 | 3300020557 | Freshwater | RLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKSRRR |
Ga0208723_10294721 | 3300020571 | Freshwater | SIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKRRH |
Ga0163149_106187221 | 3300020596 | Freshwater Microbial Mat | APQHLLSLDKVMLDALVQGLKDEAKESKDASNRQGRR |
Ga0213920_10378064 | 3300021438 | Freshwater | LGIAPQQLLDLDKAMLEALVQGLKDEAKEAKDANRGRRR |
Ga0181354_10461491 | 3300022190 | Freshwater Lake | IRLGIAPQQLLELDKTMLDALVQGLKDEAKEVDDASKRKGRR |
Ga0181351_11235593 | 3300022407 | Freshwater Lake | RLGIAPQHLLELDKTMLDALVQGLKDEAKEVSDANRGKRRGRP |
Ga0181351_12766821 | 3300022407 | Freshwater Lake | ARLSIRLGIAPQQLLELDKTMLDALVQGLKDEAKEVSDASRSKGRYRTS |
Ga0214919_1001407419 | 3300023184 | Freshwater | ARLSIRLGIAPQQIIDLDPVMLEALLQGLKDEAKEIQDASKRKGRY |
Ga0214919_103119891 | 3300023184 | Freshwater | LSIRLGIAPQQIIDLDPVMLEALLQGLKDEAKEIQDASKR |
Ga0244775_107865351 | 3300024346 | Estuarine | LIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS |
Ga0244775_110546221 | 3300024346 | Estuarine | RLGIAPQQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP |
Ga0208916_102811092 | 3300025896 | Aqueous | LIARLSIRLGISPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGSRRSRS |
Ga0209975_10018633 | 3300026993 | Freshwater Lake | SIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIRNANKGGRR |
Ga0209300_10585581 | 3300027365 | Deep Subsurface | LGIAPQHLLELDKVMLDALLIGLQDEAKEIKDANATKRRR |
Ga0209300_10608091 | 3300027365 | Deep Subsurface | SIRLGIAPQHLLELDKVMLDALLIGLQDEAKEIKDASNSKRRR |
Ga0255079_10143071 | 3300027601 | Freshwater | LSIRLGVAPQQLLELEPTMLQALLQGLKDEAKEMNDANRSSRRGRP |
Ga0208133_10436893 | 3300027631 | Estuarine | ARLSIRLGIAPQQLLDLDKNMLDALVQGLKDEAKEVSDANGSKRRGRA |
Ga0208133_11633752 | 3300027631 | Estuarine | LGIAPQQLLELDKTMLDALVQGLKDEAKEVSDASKRKGRG |
Ga0209356_10717291 | 3300027644 | Freshwater Lake | PPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP |
Ga0209356_11280921 | 3300027644 | Freshwater Lake | LGIAPQQLLELDKTMLDALLQGLKDEAKEVDDASKR |
Ga0209087_10131811 | 3300027734 | Freshwater Lake | IARLSIRLGIAPQHLLDLDKTMLDALVQGLKDEAKETADAHRNTRKR |
Ga0209087_11005991 | 3300027734 | Freshwater Lake | PQQLLELDPIMLQALLQGLKDEAKEIQDASKRKGRY |
Ga0209087_11714441 | 3300027734 | Freshwater Lake | LSIRLGIAPQQIIELDPIMLQALLQGLKDEAKEIQDASQRK |
Ga0209087_11717681 | 3300027734 | Freshwater Lake | RLGIAPQHLLELDKTMLDALVQGLKDEAKEIKDAHRSKRRN |
Ga0209596_11579183 | 3300027754 | Freshwater Lake | LGIAPQQLLELDKTMLDALVQGLKDEAQEVSDASK |
Ga0209296_10508983 | 3300027759 | Freshwater Lake | SIRLQIPPQQLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP |
Ga0209296_10618943 | 3300027759 | Freshwater Lake | PQHLIELDSAMFKAMLDGLTDRAKEIKDASKRKGRH |
Ga0209296_12177563 | 3300027759 | Freshwater Lake | QHLLELDKTMLDALVQGLKDEAKELKDASRSKGRHRTP |
Ga0209134_100759711 | 3300027764 | Freshwater Lake | IAPQHLLELDKVMLDALLQGLKDEAKEIKDASSRTSRQRRSP |
Ga0209134_103153281 | 3300027764 | Freshwater Lake | LGIAPQQLLELDPIMLEALLKGLKDEQKEISDANR |
Ga0209500_104579261 | 3300027782 | Freshwater Lake | LSIRLQIPPQQLLELDPIMLQALLQGLKDEAKEIENASR |
Ga0209246_100038428 | 3300027785 | Freshwater Lake | ARLSIRLGIAPQQLLNLDKTMLDALVQGLKDEAKETSDASKRKGRR |
Ga0209246_101480571 | 3300027785 | Freshwater Lake | QLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP |
Ga0209246_101873183 | 3300027785 | Freshwater Lake | LIARLSIRLGISPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR |
Ga0209246_102727801 | 3300027785 | Freshwater Lake | LELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP |
Ga0209107_103013111 | 3300027797 | Freshwater And Sediment | SIRLGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR |
Ga0209353_100511943 | 3300027798 | Freshwater Lake | IRLGVAPQQLLELDQTMLRALLDGLKDEARESENASRSKGRHRTP |
Ga0209353_102223072 | 3300027798 | Freshwater Lake | IARLSIRLGIAPQQLLELDPIMLQALLQGLRDEAKESSDASRSKGRNRTP |
Ga0209353_102410003 | 3300027798 | Freshwater Lake | QLLELDKTMLDALVQGLKDEAKEVSDASRSKGRYRTS |
Ga0209353_102979051 | 3300027798 | Freshwater Lake | GIAPQHLLELDKTMLDALVQGLKDEAKETSDASKRKGRGRS |
Ga0209354_101322641 | 3300027808 | Freshwater Lake | PPQALLELDNTMLDALVQGLKDEAKEVSDANRTKRKR |
Ga0209354_101957673 | 3300027808 | Freshwater Lake | GIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR |
Ga0209191_12958761 | 3300027969 | Freshwater Lake | QLLELDPIMLQALLQGLKDEAKEISDGSRSKGRTRTP |
Ga0209191_13215922 | 3300027969 | Freshwater Lake | RLQIPPQQLLELDPIMLQALLQGLKDEAKEIQDASKRKGRY |
(restricted) Ga0247837_11530763 | 3300027970 | Freshwater | PQQLLELDKTMLDALVQGLKDEAKESSDAGKRKGRR |
Ga0209401_10238561 | 3300027971 | Freshwater Lake | ARLSIRLGIAPQHLLELDKTMLDALVQGLKDEAKEISDASKRKGRR |
Ga0209079_102392232 | 3300027972 | Freshwater Sediment | LIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKRRGRA |
Ga0304730_12480222 | 3300028394 | Freshwater Lake | QQLLELDKIMLDALVQGLKDEAQEVSDASKRKGRR |
Ga0315907_104374244 | 3300031758 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR |
Ga0315899_100647485 | 3300031784 | Freshwater | SIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRGRS |
Ga0315899_109246942 | 3300031784 | Freshwater | PQHLLELDKVMLDALLQGLTDEAKEIRDASTTKRRR |
Ga0315899_112582141 | 3300031784 | Freshwater | PQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRG |
Ga0315899_115543391 | 3300031784 | Freshwater | APQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR |
Ga0315900_100712224 | 3300031787 | Freshwater | SIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRNRS |
Ga0315900_101069561 | 3300031787 | Freshwater | QQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR |
Ga0315900_101650841 | 3300031787 | Freshwater | SIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRYRS |
Ga0315909_100154471 | 3300031857 | Freshwater | YLIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKSRRR |
Ga0315904_104570643 | 3300031951 | Freshwater | ARLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDANNIKRRR |
Ga0315901_108637431 | 3300031963 | Freshwater | SLETGIAPQHLIELDPRMFRALLDGLKDRNKEMRDASKRKGRY |
Ga0315906_101946333 | 3300032050 | Freshwater | LSIRLGIAPQQLLELDKTMLDALLQGLKDEAKEVSDASKRKGRS |
Ga0315902_100461127 | 3300032093 | Freshwater | RLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR |
Ga0315902_102540721 | 3300032093 | Freshwater | IARLSIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDASNTKRRR |
Ga0315902_107915751 | 3300032093 | Freshwater | PQQLLELDKTMFDALLQGLKDEAKEVSDASKRKGRH |
Ga0315902_109171401 | 3300032093 | Freshwater | SIRLGIAPQHLLELDKVMLDALLQGLTDEAKEIKDANNIKRRR |
Ga0315903_100356487 | 3300032116 | Freshwater | SLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR |
Ga0315903_111468591 | 3300032116 | Freshwater | YLIARLSIRLGIAPQHLLELDKVMLDALVQGLNDEAKEIRDASNNRRKR |
Ga0334982_0397150_2_118 | 3300033981 | Freshwater | QQLLDLDKTMLDALVQGLKDEAKEVSDANRGKRRNRTS |
Ga0334994_0293234_2_139 | 3300033993 | Freshwater | SIRLGIAPQQLLDLDKTMLDALVQGLRDEAKEVSDGNRSSRRTRS |
Ga0334994_0299443_666_788 | 3300033993 | Freshwater | LGIAPQALLDLDKTMLDALVQGLKDEAKEVSNASNRKGRR |
Ga0334994_0301677_688_810 | 3300033993 | Freshwater | LGIAPQALLDLDKTMLDALVQGLKDEAKEVSDASNRKGRR |
Ga0334996_0227121_258_380 | 3300033994 | Freshwater | LGIAPQQLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRR |
Ga0334996_0547063_1_141 | 3300033994 | Freshwater | ARLSIRLGIAPQQLLELDKTMFDALLQGLKDEAKEVDDASKRKGRR |
Ga0335003_0200675_657_785 | 3300033995 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRQGRSRS |
Ga0334979_0745267_2_133 | 3300033996 | Freshwater | LGISPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKGRNRTS |
Ga0334986_0228028_679_801 | 3300034012 | Freshwater | LGIAPQHLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRS |
Ga0335005_0737429_376_516 | 3300034022 | Freshwater | LSIRLGVAPQQLLELEPTMLQALLQGLKDETKEMNDANRSSRRGRP |
Ga0334983_0076188_1828_1950 | 3300034060 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRN |
Ga0334983_0112945_1631_1741 | 3300034060 | Freshwater | PQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKRRH |
Ga0334987_0068871_752_874 | 3300034061 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASNRKGRR |
Ga0334987_0069806_3_128 | 3300034061 | Freshwater | GIAPQALLDLDKNMLDALVQGLKDEAKEVENASRGKRRGRS |
Ga0334987_0323222_883_1011 | 3300034061 | Freshwater | LGIAPQALLDLDKNMLDALVQGLKDEAKEVENASRGKRRGRS |
Ga0334987_0803091_1_126 | 3300034061 | Freshwater | RLGIAPQHLLELDKNMLDALVQGLKDEAKESQDASNSKRRR |
Ga0334995_0011858_534_656 | 3300034062 | Freshwater | LGIAPQQLLDLDKNMLDALVQGLKDEAKEVRDASKRKRRP |
Ga0334995_0095189_81_203 | 3300034062 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR |
Ga0334995_0734176_423_551 | 3300034062 | Freshwater | SIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKNRRR |
Ga0335010_0030677_3956_4078 | 3300034092 | Freshwater | LGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR |
Ga0335010_0164162_3_128 | 3300034092 | Freshwater | RLGIAPQQLLELDKTMLDALMQGLKDEAKEVDDASKRKGRR |
Ga0335010_0321490_1_108 | 3300034092 | Freshwater | MGIAPQQLLELDKTMLDALLQGLRDEAKEVDDASKR |
Ga0335012_0462194_2_115 | 3300034093 | Freshwater | QLLELDPTMLQALLEGLKDEAKEISDANRSKGRNRTP |
Ga0335027_0002909_5512_5640 | 3300034101 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEVKEVSDASKRKGRYRS |
Ga0335027_0004318_2822_2944 | 3300034101 | Freshwater | LGIAPQQLLELDKTMLDALLQGLQDEAKEISDASKRKGRR |
Ga0335027_0164841_1496_1609 | 3300034101 | Freshwater | QALLDLDKNMLDALVQGLKDEAKEVENASRGKRRGRS |
Ga0335027_0296953_226_348 | 3300034101 | Freshwater | LGIAPQQLLELDKTMLEALLQGLKDEAKEISDASKRKGRS |
Ga0335031_0700303_468_581 | 3300034104 | Freshwater | APQHLLELDQPMLKALLQGLHDEAKEISDASKRKGRG |
Ga0335036_0308033_222_350 | 3300034106 | Freshwater | LGIAPQQLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRGRS |
Ga0335036_0695357_459_602 | 3300034106 | Freshwater | IARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRR |
Ga0335036_0781150_3_143 | 3300034106 | Freshwater | ARLSIRLGVAPQQLLELDRDMLNALFQGLTDEAKESADASRARRRK |
Ga0335051_0057925_3_143 | 3300034109 | Freshwater | ARLSIRLGIAPQQLLELDRDMLNALFQGLTDEAKESIDASKRKGRR |
Ga0335063_0122253_306_428 | 3300034111 | Freshwater | LGIAPQQLLELDKTMLEALLQGLKDEAKEISDASKRKGRH |
Ga0335063_0394699_1_108 | 3300034111 | Freshwater | QQLLELDKTMLDALLLGLKDEAKEISDASKRKGRH |
Ga0335068_0288694_17_139 | 3300034116 | Freshwater | LQIPPQALLELDNTMLDALVQGLKDEAKEVSDANRTKRKR |
Ga0335068_0387643_212_340 | 3300034116 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRKGRYRS |
Ga0335056_0413468_234_362 | 3300034120 | Freshwater | LGIAPQQLLDLDKAMLDALVQGLKDEAKEVSDANGSKRRGRA |
Ga0335056_0489310_188_310 | 3300034120 | Freshwater | LGIAPQQLLDLDKVMLDALVQGLKDEAKEVSNASNRKGRR |
Ga0335065_0417174_2_112 | 3300034200 | Freshwater | QLLDLDKNMLDALVQGLKDEAKEVSDASKRKGRGRS |
Ga0335049_0175594_1365_1517 | 3300034272 | Freshwater | LIARLSIRLGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRGKRRGRP |
Ga0335049_0348784_73_195 | 3300034272 | Freshwater | LGIAPQQLLDLDKIMLDALVQGLKDEAKEVSDASKRKGRR |
Ga0335049_0859407_2_112 | 3300034272 | Freshwater | APQALLELDKTMLDALVQGLKDEAKETSDANRVKRR |
Ga0335007_0076175_3_125 | 3300034283 | Freshwater | IAPQQLLDLDKTMLDALVQGLKDEAKEVSDASKRQGRGRS |
Ga0335013_0253341_1_144 | 3300034284 | Freshwater | LIARLSIRLGIAPQQLLELDKTMLDALLQGLRDEAKEVSDASKNRRR |
Ga0335064_0139305_1075_1197 | 3300034357 | Freshwater | LGIAPQQLLDLDKTMLDALVQGLKDEAKEVSDANRTARKR |
⦗Top⦘ |