Basic Information | |
---|---|
Family ID | F024834 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 204 |
Average Sequence Length | 43 residues |
Representative Sequence | YPYTPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGSSK |
Number of Associated Samples | 169 |
Number of Associated Scaffolds | 204 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 68.14 % |
% of genes from short scaffolds (< 2000 bps) | 64.71 % |
Associated GOLD sequencing projects | 161 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.647 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.725 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.078 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.392 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.08% β-sheet: 0.00% Coil/Unstructured: 85.92% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 204 Family Scaffolds |
---|---|---|
PF00324 | AA_permease | 64.71 |
PF05016 | ParE_toxin | 4.41 |
PF00069 | Pkinase | 1.96 |
PF01402 | RHH_1 | 1.47 |
PF13624 | SurA_N_3 | 1.47 |
PF13520 | AA_permease_2 | 1.47 |
PF13376 | OmdA | 0.98 |
PF02780 | Transketolase_C | 0.98 |
PF00873 | ACR_tran | 0.49 |
PF02446 | Glyco_hydro_77 | 0.49 |
PF02744 | GalP_UDP_tr_C | 0.49 |
PF02621 | VitK2_biosynth | 0.49 |
PF13826 | DUF4188 | 0.49 |
PF02954 | HTH_8 | 0.49 |
PF03301 | Trp_dioxygenase | 0.49 |
PF00877 | NLPC_P60 | 0.49 |
PF12681 | Glyoxalase_2 | 0.49 |
PF01592 | NifU_N | 0.49 |
PF13185 | GAF_2 | 0.49 |
COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
---|---|---|---|
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 64.71 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 64.71 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 64.71 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 64.71 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.84 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.49 |
COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.49 |
COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.65 % |
Unclassified | root | N/A | 32.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10574000 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300004080|Ga0062385_10095818 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
3300005184|Ga0066671_10463576 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300005329|Ga0070683_101424118 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300005347|Ga0070668_101836133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300005434|Ga0070709_10223878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1343 | Open in IMG/M |
3300005445|Ga0070708_102024195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 533 | Open in IMG/M |
3300005466|Ga0070685_10794235 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005467|Ga0070706_101966587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300005534|Ga0070735_10878592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300005538|Ga0070731_10061216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2501 | Open in IMG/M |
3300005538|Ga0070731_10641193 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300005555|Ga0066692_10438118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
3300005568|Ga0066703_10043892 | All Organisms → cellular organisms → Bacteria | 2477 | Open in IMG/M |
3300005610|Ga0070763_10751636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300005610|Ga0070763_10906386 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300005841|Ga0068863_100075511 | All Organisms → cellular organisms → Bacteria | 3189 | Open in IMG/M |
3300006041|Ga0075023_100523256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 538 | Open in IMG/M |
3300006050|Ga0075028_100333338 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300006059|Ga0075017_100023004 | All Organisms → cellular organisms → Bacteria | 4060 | Open in IMG/M |
3300006059|Ga0075017_100613122 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300006086|Ga0075019_10074262 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
3300006086|Ga0075019_10274280 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300006162|Ga0075030_100242238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1447 | Open in IMG/M |
3300006162|Ga0075030_101074609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300006176|Ga0070765_100927304 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300006354|Ga0075021_10954390 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 558 | Open in IMG/M |
3300006794|Ga0066658_10377462 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300007982|Ga0102924_1130515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
3300009177|Ga0105248_10307235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1786 | Open in IMG/M |
3300009633|Ga0116129_1153154 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300009644|Ga0116121_1130450 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300009824|Ga0116219_10170884 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300010343|Ga0074044_10251880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
3300010375|Ga0105239_13442826 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300010376|Ga0126381_101006081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1203 | Open in IMG/M |
3300010376|Ga0126381_103757282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300010376|Ga0126381_104220659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300010397|Ga0134124_10475955 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300010399|Ga0134127_12744358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300011269|Ga0137392_10578595 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300011411|Ga0153933_1083542 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300012200|Ga0137382_10465080 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 896 | Open in IMG/M |
3300012203|Ga0137399_10992732 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300012683|Ga0137398_11146568 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012918|Ga0137396_10481349 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 920 | Open in IMG/M |
3300012989|Ga0164305_10364325 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
3300013100|Ga0157373_11051133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300014164|Ga0181532_10511997 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300014501|Ga0182024_12383896 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300015054|Ga0137420_1486734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2409 | Open in IMG/M |
3300015242|Ga0137412_11171239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300015374|Ga0132255_100009593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11267 | Open in IMG/M |
3300017970|Ga0187783_10751609 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300017970|Ga0187783_11274683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300017975|Ga0187782_10633157 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 823 | Open in IMG/M |
3300017988|Ga0181520_10486686 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300018007|Ga0187805_10171466 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300018013|Ga0187873_1311244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300018044|Ga0187890_10697288 | Not Available | 573 | Open in IMG/M |
3300018062|Ga0187784_10007247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8957 | Open in IMG/M |
3300018086|Ga0187769_10027136 | All Organisms → cellular organisms → Bacteria | 3857 | Open in IMG/M |
3300018088|Ga0187771_10664478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis | 884 | Open in IMG/M |
3300018088|Ga0187771_10720735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
3300018088|Ga0187771_11407153 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300018090|Ga0187770_11374373 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300019786|Ga0182025_1281276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1726 | Open in IMG/M |
3300020001|Ga0193731_1023723 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300020580|Ga0210403_10660658 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300020580|Ga0210403_11439758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300020583|Ga0210401_11399788 | Not Available | 557 | Open in IMG/M |
3300021170|Ga0210400_10289947 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300021171|Ga0210405_11242892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300021178|Ga0210408_11407596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300021181|Ga0210388_10300856 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300021181|Ga0210388_11538893 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300021401|Ga0210393_10146805 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
3300021404|Ga0210389_10180525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1643 | Open in IMG/M |
3300021404|Ga0210389_10958442 | Not Available | 665 | Open in IMG/M |
3300021405|Ga0210387_11080545 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300021407|Ga0210383_10892602 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300021474|Ga0210390_11053822 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300021474|Ga0210390_11440615 | Not Available | 547 | Open in IMG/M |
3300021477|Ga0210398_10192482 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
3300021478|Ga0210402_12000212 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300021479|Ga0210410_10248229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1596 | Open in IMG/M |
3300021559|Ga0210409_11052005 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300023056|Ga0233357_1045478 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300023255|Ga0224547_1043458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300023259|Ga0224551_1008125 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
3300025915|Ga0207693_11400059 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300025934|Ga0207686_10876329 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300025936|Ga0207670_11033323 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300026217|Ga0209871_1022391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
3300026281|Ga0209863_10037022 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300026301|Ga0209238_1080804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
3300026308|Ga0209265_1154434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300026557|Ga0179587_10306478 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1024 | Open in IMG/M |
3300027168|Ga0208239_1023792 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300027548|Ga0209523_1030812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
3300027570|Ga0208043_1149606 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300027629|Ga0209422_1028738 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300027652|Ga0209007_1185676 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300027674|Ga0209118_1052858 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1198 | Open in IMG/M |
3300027737|Ga0209038_10271859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300027824|Ga0209040_10374644 | Not Available | 669 | Open in IMG/M |
3300027846|Ga0209180_10711751 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300027855|Ga0209693_10139681 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300027879|Ga0209169_10127855 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300027898|Ga0209067_10055139 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300027905|Ga0209415_10455298 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300027911|Ga0209698_10091792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2555 | Open in IMG/M |
3300027911|Ga0209698_11404596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300028536|Ga0137415_10794747 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300028762|Ga0302202_10423266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300028863|Ga0302218_10090432 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300028906|Ga0308309_10324420 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300030002|Ga0311350_10912905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300030057|Ga0302176_10057826 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300030057|Ga0302176_10263924 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300030506|Ga0302194_10306328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300030659|Ga0316363_10355419 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300030862|Ga0265753_1025034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300031231|Ga0170824_118308592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
3300031231|Ga0170824_124330740 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 585 | Open in IMG/M |
3300031236|Ga0302324_101138683 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300031446|Ga0170820_11293498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300031708|Ga0310686_108546461 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300031716|Ga0310813_10221616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
3300031740|Ga0307468_101970578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300031753|Ga0307477_10655219 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300031823|Ga0307478_11033451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 686 | Open in IMG/M |
3300031890|Ga0306925_10344513 | Not Available | 1601 | Open in IMG/M |
3300032515|Ga0348332_11811551 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300032955|Ga0335076_10230533 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
3300033004|Ga0335084_10139646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2521 | Open in IMG/M |
3300033004|Ga0335084_10922958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300033134|Ga0335073_10908763 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300033158|Ga0335077_10912529 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300033475|Ga0310811_10677176 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1006 | Open in IMG/M |
3300033808|Ga0314867_004340 | All Organisms → cellular organisms → Bacteria | 3287 | Open in IMG/M |
3300033977|Ga0314861_0224467 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300034124|Ga0370483_0063708 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300034163|Ga0370515_0295720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 685 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.73% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 8.33% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.37% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.41% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.41% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.41% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.43% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.43% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.45% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.45% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.47% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.47% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.47% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.98% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.98% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.98% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.98% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.49% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.49% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.49% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.49% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.49% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.49% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.49% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.49% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.49% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.49% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.49% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_104425881 | 3300001593 | Forest Soil | NKSFPFDDAHVNYLLEYNTRHMSGSEQRGYWFDYGK* |
JGI12635J15846_105740001 | 3300001593 | Forest Soil | GYPYPADQPFPLDDAHVKYLLEYNTRHMSGNEQRGYSFDYSK* |
Ga0062385_100958181 | 3300004080 | Bog Forest Soil | MGEYPYTPKKTFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGEQK* |
Ga0066671_104635762 | 3300005184 | Soil | GMGTYPYSENRMFPLDDAHLDYLLKYNTRHLSGNEPRGYQFNYRPAN* |
Ga0070683_1014241182 | 3300005329 | Corn Rhizosphere | FHGMGTYPYPGKSFPLDDAHLKYLLEFNTRHMSGHEPTGYAFQYPGAK* |
Ga0070668_1018361331 | 3300005347 | Switchgrass Rhizosphere | GMGTYPYPGKSFPLDDAHLKYLLKFNTRHMSGHEPTGYAFQYPGAK* |
Ga0070709_102238782 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FLSMGEYPYSRKKTFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGSQH* |
Ga0070708_1020241952 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SMGTYPYPKGKSFPLDDAHVDYFLNYNTRHLSGNEAKGYRFDYPH* |
Ga0070685_107942351 | 3300005466 | Switchgrass Rhizosphere | PYPEGKSFPLDESHLNYLLDYNTRHVSGEEPRGYRFDYPQHK* |
Ga0070706_1019665872 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PYPKGKSFPLDDAHLNYLLNYNTRHVSGNEPRGYWYDFGPPE* |
Ga0070735_108785921 | 3300005534 | Surface Soil | TFPLDDAHVNYLLEYNTRHMSGNEPRGYWFDYGAAQQPASSSR* |
Ga0070731_100612161 | 3300005538 | Surface Soil | PFLSMGEYPYSPKKGFPLDDAHLKYLLEYNTRHMSGNEQRGYWFDYGSK* |
Ga0070731_106411931 | 3300005538 | Surface Soil | MGNYPYPGKSFPLDEEHLKYLLEYNTRYMSGNEPRGYAFDYEAK* |
Ga0070733_100325341 | 3300005541 | Surface Soil | SFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYEAK* |
Ga0070733_100534524 | 3300005541 | Surface Soil | PLDDAHVNYLLEYNTRHMSGNEHRGYWFDYGSSK* |
Ga0066661_104276961 | 3300005554 | Soil | KSFPLDDAHVNYLLEYNTRHLSGNEQRGYWFDYRDPR* |
Ga0066692_104381181 | 3300005555 | Soil | YPYPQGKSFPLDDAHLNYLLNCNTRHVSGNEPRAYWYDFSPSK* |
Ga0066703_100438921 | 3300005568 | Soil | FLSMGEYPYAPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGQQR* |
Ga0070761_110079232 | 3300005591 | Soil | FPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGSK* |
Ga0070740_102528382 | 3300005607 | Surface Soil | TFPLDDTHVDYLLEYNTRHMSGNEQRGYWFDYGEQR* |
Ga0070763_107516361 | 3300005610 | Soil | GDYPYPPGKSFPLDDAHVNYLLEYNTRHMSGNEQRGYSFDYSPK* |
Ga0070763_109063862 | 3300005610 | Soil | YPYTPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGSSK* |
Ga0066903_1080889082 | 3300005764 | Tropical Forest Soil | PGKSFPLDDEHLKYLLEYNTRYMSGNEARGYSFNYGSQR* |
Ga0068863_1000755111 | 3300005841 | Switchgrass Rhizosphere | PYPKGRSFPLDDAHVNYFLDYNTRHMSGNEPKGYRFDYPR* |
Ga0075291_10486342 | 3300005884 | Rice Paddy Soil | KKSFPLDAPHVNYLLEYNTRHMSGNEQQGYWFDYGGKR* |
Ga0070766_112426192 | 3300005921 | Soil | KSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYEK* |
Ga0066788_101543411 | 3300005944 | Soil | LDDAHVQYLLEYNTRHMSGNEQRGYWFDYETPSH* |
Ga0075023_1005232561 | 3300006041 | Watersheds | APLPFLSMGEYPYTPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGFRFDYGDAR* |
Ga0075028_1001160791 | 3300006050 | Watersheds | RSFPLDDAHVNYFLDYNTRHLSGNEPKGYRFEYPH* |
Ga0075028_1003333381 | 3300006050 | Watersheds | LRMGDYPYKASKSFPLDEAHVNYLLEYNTRHMSGNEQRGYWFDYGTSK* |
Ga0075029_1001370512 | 3300006052 | Watersheds | FPLDDAHVNYLLEYNTRNISGNEQRGYWFDYGGSK* |
Ga0075017_1000230041 | 3300006059 | Watersheds | MGTYPYPKGKFFPMDDVHVDYFLNYNTRHLSGNEPRAYRFAYPNPN* |
Ga0075017_1006131223 | 3300006059 | Watersheds | MGEYPYSPKRSFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYGPAQR* |
Ga0075019_100742621 | 3300006086 | Watersheds | DYPYAPKKSFPLDDQHVNYLLDYNTRSMSGNEQRGYWFDYGEKK* |
Ga0075019_102742802 | 3300006086 | Watersheds | YTPKKSFPLDDANVNYLLEYNTRHMSGNEQRGYWFDYGDQR* |
Ga0075030_1000226818 | 3300006162 | Watersheds | PKKSFPLDDEHVNYLLEYNTRHMSGNEQRGYWFDYGAVSR* |
Ga0075030_1002422384 | 3300006162 | Watersheds | GEYPYNPKKSLPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGEKR* |
Ga0075030_1010746092 | 3300006162 | Watersheds | SMGEYPYTPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGGSRQVQ* |
Ga0075030_1014905262 | 3300006162 | Watersheds | FPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGERR* |
Ga0070765_1009273041 | 3300006176 | Soil | DYPYPPGKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYKSSK* |
Ga0075021_109543902 | 3300006354 | Watersheds | LPFLSMGEYPYTPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGERR* |
Ga0075527_101402812 | 3300006640 | Arctic Peat Soil | SFPLDDAHLKYLLEYNTRSMSGNEQRGYWFDYGDIR* |
Ga0066658_103774621 | 3300006794 | Soil | TYPYAGKSFPLDDEHLKYLLEFNTRHMSGHETTGYAFQYPVAK* |
Ga0102924_11305152 | 3300007982 | Iron-Sulfur Acid Spring | PYSSEKSFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYGSK* |
Ga0099829_113751151 | 3300009038 | Vadose Zone Soil | KKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYTSPK* |
Ga0105248_103072351 | 3300009177 | Switchgrass Rhizosphere | TMGTYPYPKGRSFPLDDAHVNYFLDYNTRHLSGNEPKGYRFDYPR* |
Ga0116129_11531542 | 3300009633 | Peatland | LGMGDYPYAPGRSFPLDDSHVNYLLEYNTRHMSGNEQRGYWFDYGPK* |
Ga0116122_11166301 | 3300009639 | Peatland | PLDDAHVNYVLEYNTQHMSGNEQRGYWFDYGVSK* |
Ga0116121_11304501 | 3300009644 | Peatland | MGDYPYQPGKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGASK* |
Ga0116219_101708841 | 3300009824 | Peatlands Soil | LSFLSMGEYPYPAKKTFPLDDAHVDYLLEYNTRHMSGNEQRGYWFDYGDQR* |
Ga0126382_101306252 | 3300010047 | Tropical Forest Soil | SFPLDDEHLKYLLEFNTRHMSGHEASGYAFRYAEK* |
Ga0074044_102518801 | 3300010343 | Bog Forest Soil | PFLKMGDYPYAPGESFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYGPSK* |
Ga0126379_108587312 | 3300010366 | Tropical Forest Soil | PFDDSHVNYLLEYNTRHMSGNEQRGYWFDYGEGAKR* |
Ga0105239_134428261 | 3300010375 | Corn Rhizosphere | FRTMETYPYPKGRSFPLDDAHVNYFLDYNTRHMSGNEPKGYRFDYPR* |
Ga0126381_1010060811 | 3300010376 | Tropical Forest Soil | PYSPKKSFPLDDSHVNYLLEYNTRHMSGNEQRGYWFDYGQNQSSATSP* |
Ga0126381_1037572821 | 3300010376 | Tropical Forest Soil | YPYSPKKSFPLDDSHVNYLLEYNTRHMSGNEQRGYWFDYGQNHSSATSP* |
Ga0126381_1042206591 | 3300010376 | Tropical Forest Soil | YPPKKSFPLDDAHVNYLLEYNTRHMSGKEQRGYWFDYGESRQR* |
Ga0126381_1051243002 | 3300010376 | Tropical Forest Soil | SDQAFPLDDAHLNYILEYNTRYMSGNESRSYRFDYPPPK* |
Ga0134124_104759552 | 3300010397 | Terrestrial Soil | TYPYPKGRSFPLDDAHVNYFLDYNTRHMSGNEPKGYRFDYPR* |
Ga0134127_127443581 | 3300010399 | Terrestrial Soil | LPFHGMGTYPYPGKSFPLDDAHLKYLLEFNTRHMSGHEPTGYAFQYPGAK* |
Ga0137392_105785951 | 3300011269 | Vadose Zone Soil | YPADKSFPLDDEHLNYLLNYNTRHMSGNEPRGYRYDFNRPK* |
Ga0153933_10835422 | 3300011411 | Attine Ant Fungus Gardens | VDPLPFSTMNMYPSDKSFPLDDAHLNYLLEYNTRYMSGNESAGFRFDYPPTK* |
Ga0137382_104650802 | 3300012200 | Vadose Zone Soil | GEYPYTPKKSFPLDDVHLNYLLEYNTRHMSGAEQRGYWFDYGDLR* |
Ga0137399_103481921 | 3300012203 | Vadose Zone Soil | KSFPLDDAHVNYLLEYNTRHMSGSEQRGYWFDYPSSK* |
Ga0137399_109927321 | 3300012203 | Vadose Zone Soil | PKGRSFPLDDAHVDYFLNYNTRHLSGNEPTGYRFDYRPSN* |
Ga0150984_1107175351 | 3300012469 | Avena Fatua Rhizosphere | PGKSFPLDDAHLKYLLEFNTRQMSGHEATGYAFQYPVAK* |
Ga0137398_111465682 | 3300012683 | Vadose Zone Soil | PYAPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGTRR* |
Ga0137396_104813491 | 3300012918 | Vadose Zone Soil | PYPARKSFPLDDAHVNYLLEFNTRHMSGNEQRGYWFDYGSK* |
Ga0164301_115851341 | 3300012960 | Soil | PLDDTHVNYLLEYNTRHMSGNEQRGYWFDYGESK* |
Ga0164305_103643251 | 3300012989 | Soil | MGTYPYPKGRSFPLDDAHVNYFLDYNTRHLSGNEPSGYRFDYPR* |
Ga0157373_110511332 | 3300013100 | Corn Rhizosphere | PFRTMGTYPYPQGRSFPLDDAHVNYFLDYNTRHLSGNEPKGYRFDYPR* |
Ga0181532_105119972 | 3300014164 | Bog | RMGDYPYQPGQSFPLDDAHVNYLLEYNTQHMSGNEQRGYWFDYGVSK* |
Ga0182014_105893381 | 3300014491 | Bog | FPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGASR* |
Ga0182024_123838962 | 3300014501 | Permafrost | YPPGTSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYAAK* |
Ga0137420_14867343 | 3300015054 | Vadose Zone Soil | MGEYPYAPKKSFPLDDAHVNYLLEYNTRHMSGNEQGGYWFDYGPQR* |
Ga0137412_111712391 | 3300015242 | Vadose Zone Soil | YPAKRSFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYGDRR* |
Ga0132255_1000095938 | 3300015374 | Arabidopsis Rhizosphere | PPKKSFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYGENRQH* |
Ga0187820_13350731 | 3300017924 | Freshwater Sediment | FPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYAPVRP |
Ga0187803_104345581 | 3300017934 | Freshwater Sediment | YPLDDQHLDDLLNYNTRHMSGNEARGYWFDYDPSK |
Ga0187853_104506992 | 3300017940 | Peatland | FPLDDAHVNYLLEYNTQHMSGNEQRGYWFDYGVSK |
Ga0187847_103953071 | 3300017948 | Peatland | SFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYDSSK |
Ga0187783_107516093 | 3300017970 | Tropical Peatland | LPFLSMGDYPYGPPKSFPLDDEHVNYLLEYNTRHMSGNEQRGYAFDYGAEK |
Ga0187783_112746831 | 3300017970 | Tropical Peatland | APLPFGSMGEYPYSPQQSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGQN |
Ga0187780_101724632 | 3300017973 | Tropical Peatland | AFPLDREHIHYLLEYNTRHMSGNEQRGYSFDYSDFH |
Ga0187782_106331572 | 3300017975 | Tropical Peatland | GEYPYSRKQSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGPK |
Ga0187782_114619601 | 3300017975 | Tropical Peatland | SSRSLSTTNTNYLLEYNTRHMSGNEQRGYWFDYAERK |
Ga0181520_104866862 | 3300017988 | Bog | PYTPKQSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGESH |
Ga0187805_101714662 | 3300018007 | Freshwater Sediment | YPADKSFPLDDAHLNYLLEYNTRQMSGNEQRGYWFDYGK |
Ga0187873_13112441 | 3300018013 | Peatland | YPYQPGQSFPLDDAHVNYLLEYNTQHMSGNEQRGYWFDYGVSK |
Ga0187864_100507341 | 3300018022 | Peatland | SFPLDDAHLNYILEYNTRYMSGNESRGYRFDYPPPK |
Ga0187890_106972881 | 3300018044 | Peatland | PFLRMGDYPYARDKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGASR |
Ga0187784_100072477 | 3300018062 | Tropical Peatland | YEPRQSFPLDDEHVNYLLEYNTRHMSGNEQRGYWFDYGPRK |
Ga0187784_111460991 | 3300018062 | Tropical Peatland | RQSFPLDDEHVNYLLEYNTRHMSGNEQRGYWFDYGSN |
Ga0187784_112482622 | 3300018062 | Tropical Peatland | FPLDDVHLNYLLEYNTRYMSGNEARGYAFDYGPSH |
Ga0187769_100271364 | 3300018086 | Tropical Peatland | EYPYVAPKAFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGSLPIKPN |
Ga0187771_106644783 | 3300018088 | Tropical Peatland | PFREMGIYPYPGKSFPLDDVHLNYLLEYNTRYMSGNEARGYAFDYGHSR |
Ga0187771_107207352 | 3300018088 | Tropical Peatland | PFLSMGEYPYGPPKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGLK |
Ga0187771_114071532 | 3300018088 | Tropical Peatland | LPFLSMGEYPYGPPKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGNQR |
Ga0187770_113743731 | 3300018090 | Tropical Peatland | LPFLSMGDYPYPPKQSFPLDNAPVNYLLEYNTRHMSGNEQRGYWFDYRDR |
Ga0066662_113806362 | 3300018468 | Grasslands Soil | PKKTFPLDDAHVNYLLEYNTRQMSGNEQRGYWFDYGSNQRP |
Ga0182025_12812761 | 3300019786 | Permafrost | MGQYPYSQSKSFPLDDAHVNYLLEYNTRQMSGNEQRGYWFDYGERK |
Ga0193728_11560341 | 3300019890 | Soil | KSFPVDDAHMNYLLEYNTRHMSGNEQRGFWFDYGSPK |
Ga0193731_10237232 | 3300020001 | Soil | MGTYPYPKGRSFPLDDAHVDYFLNYNTRHLSGNEPKGYRFDYPH |
Ga0210403_106606582 | 3300020580 | Soil | STMPGYPYPSDKSFPLDDQHLNYILEYNTRYLSGNEARGYRFDYPPAK |
Ga0210403_114397581 | 3300020580 | Soil | PFLRMGDYPYAPGKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGK |
Ga0210401_113997881 | 3300020583 | Soil | YPKGRAFPLDDAHVDYFLNYNTRHLSGNEPKAFRFDYSH |
Ga0210400_102899471 | 3300021170 | Soil | FLKMGDYPYPPGNTFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYGAK |
Ga0210405_112428921 | 3300021171 | Soil | PFLRMGDYPYAPGKSFPLDDAHVNYLLEYNTRHVSGNEQRGYWFDYGK |
Ga0210408_114075961 | 3300021178 | Soil | GYPYASDKSFPLDDAHLNYLLEYNTRYLSGNEARGYRFDYSPPK |
Ga0210388_103008561 | 3300021181 | Soil | PLPFLSMGEYPYAPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGNHQ |
Ga0210388_106813102 | 3300021181 | Soil | AKSFPLDDAHVKYLLEYNTRHMSGNEQRGYWFDYGDRR |
Ga0210388_115388932 | 3300021181 | Soil | MGEYPYPPKKSFPFDDAHVNYLLEYNTRQMSGNEQRGYWFDYGERK |
Ga0210393_101468053 | 3300021401 | Soil | PYPPGKSFPLDDAHVNYLLEYNTRHMSGNEQRGYSFDYSPK |
Ga0210397_101039342 | 3300021403 | Soil | PLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGGAPR |
Ga0210397_111916012 | 3300021403 | Soil | KSFPLDDTHLNYLLEYNTRHMSGNEQRGYWFDYGPAQR |
Ga0210389_101805252 | 3300021404 | Soil | FLKMGDYPYPAGKGFPLDDTHVNYLLEYNTRHMSGNEQRGYWFDYGPK |
Ga0210389_103584162 | 3300021404 | Soil | KNSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGENR |
Ga0210389_109584422 | 3300021404 | Soil | PYAPKRSFPLDDEHLKYLLEYNTRSMSGNEQRGYWFDYVENK |
Ga0210387_110805451 | 3300021405 | Soil | MGEYPYPAKKSFPLDDEHVKYLLEYNTRHMSGNEQRGYWFDYGDRQ |
Ga0210383_108926021 | 3300021407 | Soil | GKSFPLDDAHVNYLLEYNTRHVSGNEQRGYWFDYGKRSDTEK |
Ga0210390_110538221 | 3300021474 | Soil | PYEPGKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGK |
Ga0210390_114406152 | 3300021474 | Soil | KGKAFPLDDAHVDYFLNYNTRHLSGNEPKAFRFDYSH |
Ga0210398_101924821 | 3300021477 | Soil | YSPKNSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGENR |
Ga0210402_120002121 | 3300021478 | Soil | TYPYPKGRSFPLDDAHVNYFLDYNTRHLSGNEPKGYRFDYSH |
Ga0210410_102482292 | 3300021479 | Soil | MTDYPYPPGNSFPLDDAHVNYLLEYNTRHVSGHEQRGYWFDYGPK |
Ga0210409_102124661 | 3300021559 | Soil | SFPLDDAHVNYLLEYNTRHMSGNEHRGYWFDYGSSK |
Ga0210409_110520052 | 3300021559 | Soil | PYPSDQIFPLDDAHLNYILEYNTRYMSGNESQRYRFDYASPK |
Ga0242668_11053311 | 3300022529 | Soil | KSFPLDDAHVNYLLEYNTRHMSGSEQRGYWFDYGDNR |
Ga0242655_100931262 | 3300022532 | Soil | LDDTHLNYLLEYNTRHISGNEQRGYWFDYGESLWP |
Ga0233357_10454782 | 3300023056 | Soil | TDYPYAPDKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYPSSK |
Ga0224547_10434581 | 3300023255 | Soil | YASQKSFPLDDAHVNYLLEYNTRHMSGNEQHGYRFDYDVKK |
Ga0224551_10081251 | 3300023259 | Soil | PFLSMGEYPYTPKKSFPLDDAHVNYLLEYNTRQMSGNEQRGYWFDYGERK |
Ga0207693_114000591 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QSMGEYPYSPKKSFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYESK |
Ga0207686_108763292 | 3300025934 | Miscanthus Rhizosphere | PYPQGRSFPLDDAHVNYFLDYNTRHLSGNEPKGYRFDYPR |
Ga0207670_110333231 | 3300025936 | Switchgrass Rhizosphere | PFRTMGTYPYPKGRSFPLDDAHVNYFLDYNTRHLSGNEPKGYRFDYPR |
Ga0209871_10223911 | 3300026217 | Permafrost Soil | PFLSMGEYPYPARKSFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYHQTK |
Ga0209863_100370221 | 3300026281 | Prmafrost Soil | PFKTMGTYPYPKGRSFPLDDAYVDYFLDYNTRHLSGNEPKGYRFDYSH |
Ga0209238_10808042 | 3300026301 | Grasslands Soil | GEYPYSRKKTFPLDDEHVNYLLEYNTRHMSGNEQRGYWFDYGPQR |
Ga0209265_11544342 | 3300026308 | Soil | PYSRKKTFPLDDEHVNYLLEYNTRHMSGNEQRGYWFDYGPQH |
Ga0179587_103064781 | 3300026557 | Vadose Zone Soil | SMGEYPYPPQKSCPLDDAHVNYLLEYNTRHMSGKEQRGYWFDYGAK |
Ga0208239_10237922 | 3300027168 | Forest Soil | PFLKMGDYPYAPSKSFPLDDAHLNYLLGYNTRHMSGNEQRGYWFDYGK |
Ga0209523_10308121 | 3300027548 | Forest Soil | GEYPYPPKKSFPLDDKHVNYLLEYNTRHMSGNEQRGYWFDYGAAPR |
Ga0208043_11496062 | 3300027570 | Peatlands Soil | YPYAPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGPK |
Ga0209422_10287381 | 3300027629 | Forest Soil | MGGYPYPADQPFPLDDAHVKYLLEYNTRHMSGNEQRGYSFDYSK |
Ga0209007_11856762 | 3300027652 | Forest Soil | YPYTPKKLYPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGSTK |
Ga0209118_10528582 | 3300027674 | Forest Soil | GMGEYPYPSKKSFPLDDAHLNYLLDYNTRHMSGHEQRGYWFDYGDRR |
Ga0208991_11571332 | 3300027681 | Forest Soil | KSFPLDDMHVNYLLEYNTRHTSGNEQRGYWFDYGSK |
Ga0209447_101512082 | 3300027701 | Bog Forest Soil | KSFPLDDAHLNYLLEYNTRHMSGNEHRGYWFDYAPSK |
Ga0209178_13869472 | 3300027725 | Agricultural Soil | EPKKSFPLDDAHVNYLLDYNTRHMSGNEQRGYWFDYGTQR |
Ga0209038_102718591 | 3300027737 | Bog Forest Soil | PYSAGKSFPLDDEHLNYLLEYNTRHVSGNEQRGYWFDYGDRK |
Ga0209040_103746442 | 3300027824 | Bog Forest Soil | PYPSDQSFPLDDAHLNYILEYNTRYMSGNEPRGYRFDYPGPR |
Ga0209180_107117512 | 3300027846 | Vadose Zone Soil | YPYPKGKSFPLDDAHVDYFLNYNTRHLSGNEAKGYRFDYPH |
Ga0209693_101396813 | 3300027855 | Soil | SMGEYPYSAKKSFPLDDAHVKYLLEYNTRHMSGNEQRGYWFDYGDRQ |
Ga0209167_107043172 | 3300027867 | Surface Soil | GTSFPLDDAHVNYLLEYNTRHMSGNEQRGYSFQYEK |
Ga0209169_101278552 | 3300027879 | Soil | YPYAPSKAFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGK |
Ga0209275_105157861 | 3300027884 | Soil | SDKSFPLDDQHLNYILEYNTRYLSGNEARGYRFDYPSAK |
Ga0209624_110877382 | 3300027895 | Forest Soil | QPGQAFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYGSSK |
Ga0209067_100551391 | 3300027898 | Watersheds | MGDYPYTPKKSFPLDDEHVNYLLEYNTRHMSGNEQRGYWFDYRATTR |
Ga0209067_109410082 | 3300027898 | Watersheds | PAKKSFPLDDAHLKYLLEYNTRSMSGNEQRGYWFDYGDSK |
Ga0209415_104552981 | 3300027905 | Peatlands Soil | GAYPPGKSFPIDDAHLNYMLEYNTRYMSGHEARGYRFDYPSAK |
Ga0209698_100917921 | 3300027911 | Watersheds | PFLSMGDYPYTPKKSFPLDDEHVNYLLEYNTRHMSGNEQPGYWFDYGDTR |
Ga0209698_114045961 | 3300027911 | Watersheds | LSMGEYPYPPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGERR |
Ga0137415_107947473 | 3300028536 | Vadose Zone Soil | LPFLRMGDYPYSPGKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYPSSK |
Ga0302202_104232663 | 3300028762 | Bog | FFSMGDYPYTPKKSFPLDDEHLNYLLEYNTRGMSGNEQRGYWFDYGASK |
Ga0302221_103206481 | 3300028806 | Palsa | SFPLDDAHVNYLLEYNTRHMSGNEQRGYWFNYGEQP |
Ga0302218_100904321 | 3300028863 | Palsa | YPYTPQRSFPLDDMHVNYLLEYNTRHMSGNEQRGYWFDYGASK |
Ga0308309_103244201 | 3300028906 | Soil | DYPYPARKGFPLDDTHVNYLLEYNTRHMSGNEQRGYWFDYGPK |
Ga0311369_115040921 | 3300029910 | Palsa | KKSFPMDDAHVNYLLEYNTRHMSGNEQRGYWFDYGDQR |
Ga0311340_108191961 | 3300029943 | Palsa | APKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGEK |
Ga0311350_109129051 | 3300030002 | Fen | TYPYPGKTFPLDDAHMNYILNYNTRHVSGNEARGYSFDYK |
Ga0302176_100578262 | 3300030057 | Palsa | YAPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYSFDYGEK |
Ga0302176_102639242 | 3300030057 | Palsa | FLSMGEYPYTSKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGDQR |
Ga0302194_103063282 | 3300030506 | Bog | PFLRMGDYPYKPGESFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGLSK |
Ga0316363_103554192 | 3300030659 | Peatlands Soil | LPFLKMGDYPYPPGKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGDK |
Ga0311335_112850791 | 3300030838 | Fen | EGKYPMNQQQIDDLLNYNTRHISGNESRGYSFNYPK |
Ga0265753_10250342 | 3300030862 | Soil | YPYPADQSFPLDDPHLNYLLEYNTRYMSGNESRGYAFDYLAPK |
Ga0265760_100507731 | 3300031090 | Soil | KAFPLDDAHMNYLLEYNTRHMSGNEQRGYWFDYGKRSDTEK |
Ga0170824_1183085922 | 3300031231 | Forest Soil | YTPKKSFPLDDAHLNYLLEYNTRNMSGNEQRGYWFDYGNSK |
Ga0170824_1243307401 | 3300031231 | Forest Soil | GEYPYPAKKSFPLDDAHLNYLLEYNTRHMSGNEQRGYRFDYGDRK |
Ga0302324_1011386834 | 3300031236 | Palsa | PFLSMGDYPYTPKKSFPLDDEHLNYLLEYNTRGMSGNEQRGYWFDYGASK |
Ga0170820_112934982 | 3300031446 | Forest Soil | YPYTPKKSFPLDDAHLNYLLEYNTRNMSGNEQRGYWFDYGNSK |
Ga0310915_106882452 | 3300031573 | Soil | KAFPLDDPHLKYLLEYNTRYLSGHEATGYRFEYDSSR |
Ga0310686_1085464611 | 3300031708 | Soil | DYPYAPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGVTK |
Ga0310813_102216162 | 3300031716 | Soil | YPYSRKKTFPLDDAHVNYLVEYNTRHMSGNEQRGYWFDYGPQR |
Ga0307468_1019705781 | 3300031740 | Hardwood Forest Soil | FLSMGEYPYPSKKSFPLDDTHVNYLLEYNTRHMSGNEQRGYWFDYKSKPR |
Ga0307477_106552191 | 3300031753 | Hardwood Forest Soil | LGMGEYPYAPKKSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYAGNPR |
Ga0307478_110334511 | 3300031823 | Hardwood Forest Soil | YPYSRRKGFPLDDAHLNYLLEYNTRHMSGNEQRGYRFDYGDFH |
Ga0306925_103445131 | 3300031890 | Soil | DMGIYPYPGKAFPLDDPHLKYLLEYNTRYLSGHEATGYRFEYDSSR |
Ga0306925_107170231 | 3300031890 | Soil | KKSFPLDDAHVNYLLEYNTRHMSGKEQRGYWFDYGEKR |
Ga0307470_100407493 | 3300032174 | Hardwood Forest Soil | KKSFPLDDAHLNYLLEYNTRHMSGNEQRGYWFDYGDRK |
Ga0307471_1000718625 | 3300032180 | Hardwood Forest Soil | DDIHLNYLLEYNTRHMSGNEQRGYWFDYGTASHEK |
Ga0348332_118115511 | 3300032515 | Plant Litter | MGDYPYAPGKSFPLDDAHVNYLLEYNTRYMSGNEQRGYWFDYGPSK |
Ga0335078_109840721 | 3300032805 | Soil | KKSFPLDDQHLNYLLEYNTRHMSGNEQRGYWFDYGPARR |
Ga0335078_125357182 | 3300032805 | Soil | KSFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYTGTHEP |
Ga0335076_102305331 | 3300032955 | Soil | AMGSYPYPGKKFPLDDAHLNYTLQYNTRQVSGDEPRGYAFDYEGVKGSEAHR |
Ga0335084_101396461 | 3300033004 | Soil | GEMGEYPYPGKAFPLDDAHLKYLLEYNTRFMSGHEARGFAFDYRTTP |
Ga0335084_109229581 | 3300033004 | Soil | SMGEYPYSPKKSFPLDDTHMKYLLEYNTRHMSGNEQRGYWFDYRENR |
Ga0335073_109087632 | 3300033134 | Soil | YPYAPRQSFPLDDTHVNYLLEYNTRFMSGNEQRGYSFDYREK |
Ga0335077_109125291 | 3300033158 | Soil | YPYSPKESFPLDDAHVNYLLEYNTRHMSGNEQRGYWFDYGKK |
Ga0310811_106771761 | 3300033475 | Soil | YSRKKTFPLDDAHVNYLVEYNTRHMSGNEQRGYWFDYGPQR |
Ga0314867_004340_4_144 | 3300033808 | Peatland | MGKYPYGAPKEFPLDREHIHYLLEYNTRHMSGNEQRGYSFDYSDFH |
Ga0314861_0224467_18_155 | 3300033977 | Peatland | MGQYPYGPSKAFPLDDAHVNYVLEYNTRHMSGNEQRGYWFDYGTK |
Ga0370483_0063708_1032_1172 | 3300034124 | Untreated Peat Soil | MGDYPYAPGKSFPLDDEHLNYLLEYNTRHMSGSEQRGYWFDYGATK |
Ga0370515_0295720_3_128 | 3300034163 | Untreated Peat Soil | YTPKKSFPLDDDHVNYLLEYNTRHMSGNEQRGYWFDYDEPR |
⦗Top⦘ |