Basic Information | |
---|---|
Family ID | F024751 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 204 |
Average Sequence Length | 37 residues |
Representative Sequence | MKRAIVLALMLVAVLVPLMGVAHADLKSDEAIEQAP |
Number of Associated Samples | 135 |
Number of Associated Scaffolds | 204 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 76.47 % |
% of genes near scaffold ends (potentially truncated) | 19.12 % |
% of genes from short scaffolds (< 2000 bps) | 75.98 % |
Associated GOLD sequencing projects | 126 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.137 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.412 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.059 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.392 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 204 Family Scaffolds |
---|---|---|
PF02322 | Cyt_bd_oxida_II | 4.41 |
PF00080 | Sod_Cu | 3.43 |
PF01258 | zf-dskA_traR | 2.94 |
PF04216 | FdhE | 1.96 |
PF01654 | Cyt_bd_oxida_I | 1.96 |
PF13432 | TPR_16 | 1.47 |
PF00583 | Acetyltransf_1 | 1.47 |
PF04879 | Molybdop_Fe4S4 | 1.47 |
PF00174 | Oxidored_molyb | 1.47 |
PF00873 | ACR_tran | 0.98 |
PF00199 | Catalase | 0.98 |
PF06983 | 3-dmu-9_3-mt | 0.98 |
PF00486 | Trans_reg_C | 0.98 |
PF13302 | Acetyltransf_3 | 0.98 |
PF03814 | KdpA | 0.98 |
PF00210 | Ferritin | 0.98 |
PF02416 | TatA_B_E | 0.98 |
PF00072 | Response_reg | 0.49 |
PF13493 | DUF4118 | 0.49 |
PF06628 | Catalase-rel | 0.49 |
PF00848 | Ring_hydroxyl_A | 0.49 |
PF14559 | TPR_19 | 0.49 |
PF01717 | Meth_synt_2 | 0.49 |
PF01566 | Nramp | 0.49 |
PF03404 | Mo-co_dimer | 0.49 |
PF08327 | AHSA1 | 0.49 |
PF00005 | ABC_tran | 0.49 |
PF14346 | DUF4398 | 0.49 |
PF01169 | UPF0016 | 0.49 |
PF00528 | BPD_transp_1 | 0.49 |
PF01638 | HxlR | 0.49 |
PF14595 | Thioredoxin_9 | 0.49 |
PF00004 | AAA | 0.49 |
PF01965 | DJ-1_PfpI | 0.49 |
PF13751 | DDE_Tnp_1_6 | 0.49 |
PF02321 | OEP | 0.49 |
PF12681 | Glyoxalase_2 | 0.49 |
PF09604 | Potass_KdpF | 0.49 |
PF02518 | HATPase_c | 0.49 |
PF00384 | Molybdopterin | 0.49 |
PF01568 | Molydop_binding | 0.49 |
PF10518 | TAT_signal | 0.49 |
PF00089 | Trypsin | 0.49 |
PF13365 | Trypsin_2 | 0.49 |
PF00300 | His_Phos_1 | 0.49 |
PF00561 | Abhydrolase_1 | 0.49 |
COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
---|---|---|---|
COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 4.41 |
COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 3.43 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 2.94 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 1.96 |
COG3058 | Formate dehydrogenase maturation protein FdhE | Posttranslational modification, protein turnover, chaperones [O] | 1.96 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 1.47 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.47 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.47 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.98 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.98 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.98 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 0.98 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.49 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.49 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.49 |
COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.14 % |
Unclassified | root | N/A | 6.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_105234713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10176836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300000789|JGI1027J11758_12437530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
3300000956|JGI10216J12902_102949900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1275 | Open in IMG/M |
3300005176|Ga0066679_10150415 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
3300005540|Ga0066697_10040121 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
3300005540|Ga0066697_10047977 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
3300005552|Ga0066701_10151050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1398 | Open in IMG/M |
3300005552|Ga0066701_10786193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
3300005552|Ga0066701_10800264 | Not Available | 562 | Open in IMG/M |
3300005553|Ga0066695_10491068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 755 | Open in IMG/M |
3300005555|Ga0066692_10372193 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 906 | Open in IMG/M |
3300005555|Ga0066692_10655304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
3300005557|Ga0066704_10214192 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300005557|Ga0066704_10345755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 998 | Open in IMG/M |
3300005557|Ga0066704_10518172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 783 | Open in IMG/M |
3300005558|Ga0066698_10000561 | All Organisms → cellular organisms → Bacteria | 14306 | Open in IMG/M |
3300005558|Ga0066698_10385047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 966 | Open in IMG/M |
3300005558|Ga0066698_10988126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
3300005558|Ga0066698_11010919 | Not Available | 528 | Open in IMG/M |
3300005559|Ga0066700_11150068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300005568|Ga0066703_10768165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
3300005569|Ga0066705_10181905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1308 | Open in IMG/M |
3300005574|Ga0066694_10024498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2675 | Open in IMG/M |
3300005713|Ga0066905_101084830 | Not Available | 710 | Open in IMG/M |
3300005764|Ga0066903_100562182 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
3300005764|Ga0066903_101624755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1227 | Open in IMG/M |
3300006031|Ga0066651_10005480 | All Organisms → cellular organisms → Bacteria | 4871 | Open in IMG/M |
3300006032|Ga0066696_10122030 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
3300006034|Ga0066656_11029229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
3300006796|Ga0066665_10591392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_14 | 894 | Open in IMG/M |
3300006797|Ga0066659_10618965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 880 | Open in IMG/M |
3300006800|Ga0066660_10283554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1313 | Open in IMG/M |
3300006854|Ga0075425_100028175 | All Organisms → cellular organisms → Bacteria | 6216 | Open in IMG/M |
3300006904|Ga0075424_102297419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
3300007255|Ga0099791_10004003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 6016 | Open in IMG/M |
3300007255|Ga0099791_10086759 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1431 | Open in IMG/M |
3300007255|Ga0099791_10129026 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1174 | Open in IMG/M |
3300007258|Ga0099793_10051969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1809 | Open in IMG/M |
3300007258|Ga0099793_10242869 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 868 | Open in IMG/M |
3300007258|Ga0099793_10360426 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300007265|Ga0099794_10000463 | All Organisms → cellular organisms → Bacteria | 13586 | Open in IMG/M |
3300007265|Ga0099794_10005665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5032 | Open in IMG/M |
3300007265|Ga0099794_10387723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 729 | Open in IMG/M |
3300007265|Ga0099794_10589679 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300009012|Ga0066710_100000998 | All Organisms → cellular organisms → Bacteria | 19717 | Open in IMG/M |
3300009012|Ga0066710_100016712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7878 | Open in IMG/M |
3300009012|Ga0066710_100305845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2331 | Open in IMG/M |
3300009012|Ga0066710_100525928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1786 | Open in IMG/M |
3300009012|Ga0066710_100950413 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300009012|Ga0066710_100951671 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
3300009012|Ga0066710_101615684 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 992 | Open in IMG/M |
3300009038|Ga0099829_10366229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1188 | Open in IMG/M |
3300009038|Ga0099829_10593711 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 920 | Open in IMG/M |
3300009088|Ga0099830_10012076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5326 | Open in IMG/M |
3300009088|Ga0099830_10367823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1159 | Open in IMG/M |
3300009088|Ga0099830_10459841 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1034 | Open in IMG/M |
3300009090|Ga0099827_10000189 | All Organisms → cellular organisms → Bacteria | 24302 | Open in IMG/M |
3300009090|Ga0099827_11967912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
3300009137|Ga0066709_100080167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3890 | Open in IMG/M |
3300009137|Ga0066709_100291622 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
3300009137|Ga0066709_100982898 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1235 | Open in IMG/M |
3300009137|Ga0066709_101492834 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 976 | Open in IMG/M |
3300009137|Ga0066709_104178020 | Not Available | 526 | Open in IMG/M |
3300009143|Ga0099792_10093526 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1564 | Open in IMG/M |
3300009803|Ga0105065_1005424 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300009822|Ga0105066_1108018 | Not Available | 618 | Open in IMG/M |
3300009837|Ga0105058_1198116 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
3300010081|Ga0127457_1012696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 753 | Open in IMG/M |
3300010081|Ga0127457_1081690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
3300010102|Ga0127453_1092889 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
3300010103|Ga0127500_1119195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
3300010107|Ga0127494_1002287 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 831 | Open in IMG/M |
3300010109|Ga0127497_1065994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1190 | Open in IMG/M |
3300010111|Ga0127491_1101452 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 866 | Open in IMG/M |
3300010119|Ga0127452_1085656 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
3300010124|Ga0127498_1016553 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 828 | Open in IMG/M |
3300010124|Ga0127498_1043571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
3300010128|Ga0127486_1088489 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 788 | Open in IMG/M |
3300010132|Ga0127455_1126591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
3300010133|Ga0127459_1056430 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 647 | Open in IMG/M |
3300010140|Ga0127456_1096613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
3300010304|Ga0134088_10125839 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1214 | Open in IMG/M |
3300010304|Ga0134088_10290070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 790 | Open in IMG/M |
3300010359|Ga0126376_10022107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4176 | Open in IMG/M |
3300010360|Ga0126372_12464765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300010362|Ga0126377_11530288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
3300010398|Ga0126383_10143182 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
3300011269|Ga0137392_10230844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1520 | Open in IMG/M |
3300012096|Ga0137389_10138838 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
3300012096|Ga0137389_10198544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1669 | Open in IMG/M |
3300012198|Ga0137364_10008687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5684 | Open in IMG/M |
3300012198|Ga0137364_11279673 | Not Available | 547 | Open in IMG/M |
3300012199|Ga0137383_10577075 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 823 | Open in IMG/M |
3300012200|Ga0137382_10341693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1049 | Open in IMG/M |
3300012202|Ga0137363_10105756 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300012203|Ga0137399_10014830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 4879 | Open in IMG/M |
3300012203|Ga0137399_10032010 | All Organisms → cellular organisms → Bacteria | 3633 | Open in IMG/M |
3300012203|Ga0137399_10584066 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 939 | Open in IMG/M |
3300012203|Ga0137399_11647965 | Not Available | 530 | Open in IMG/M |
3300012204|Ga0137374_10207733 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
3300012205|Ga0137362_10018970 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 5262 | Open in IMG/M |
3300012207|Ga0137381_10159073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1947 | Open in IMG/M |
3300012353|Ga0137367_10191767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1482 | Open in IMG/M |
3300012360|Ga0137375_10955836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
3300012361|Ga0137360_10756957 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 835 | Open in IMG/M |
3300012379|Ga0134058_1127362 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 996 | Open in IMG/M |
3300012379|Ga0134058_1231486 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 659 | Open in IMG/M |
3300012386|Ga0134046_1156252 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 789 | Open in IMG/M |
3300012390|Ga0134054_1208988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1387 | Open in IMG/M |
3300012393|Ga0134052_1012561 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
3300012393|Ga0134052_1126694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 994 | Open in IMG/M |
3300012393|Ga0134052_1197698 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 742 | Open in IMG/M |
3300012396|Ga0134057_1014996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1331 | Open in IMG/M |
3300012398|Ga0134051_1059636 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 786 | Open in IMG/M |
3300012401|Ga0134055_1084055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
3300012402|Ga0134059_1030465 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300012402|Ga0134059_1256265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
3300012406|Ga0134053_1304779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 838 | Open in IMG/M |
3300012409|Ga0134045_1052492 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 791 | Open in IMG/M |
3300012582|Ga0137358_10168984 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1491 | Open in IMG/M |
3300012582|Ga0137358_11053268 | Not Available | 522 | Open in IMG/M |
3300012685|Ga0137397_10060640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2729 | Open in IMG/M |
3300012918|Ga0137396_10333938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1122 | Open in IMG/M |
3300012922|Ga0137394_10140313 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2053 | Open in IMG/M |
3300012922|Ga0137394_10828888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 774 | Open in IMG/M |
3300012922|Ga0137394_11035200 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300012929|Ga0137404_11140848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 716 | Open in IMG/M |
3300012930|Ga0137407_10250316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1606 | Open in IMG/M |
3300012977|Ga0134087_10595024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
3300015245|Ga0137409_10353711 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1280 | Open in IMG/M |
3300015245|Ga0137409_10481340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1063 | Open in IMG/M |
3300015264|Ga0137403_11521343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
3300015358|Ga0134089_10213655 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 779 | Open in IMG/M |
3300017656|Ga0134112_10496694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300017659|Ga0134083_10136503 | Not Available | 986 | Open in IMG/M |
3300017659|Ga0134083_10221355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 786 | Open in IMG/M |
3300017939|Ga0187775_10004221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3430 | Open in IMG/M |
3300017997|Ga0184610_1006971 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2727 | Open in IMG/M |
3300018027|Ga0184605_10192098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 926 | Open in IMG/M |
3300018031|Ga0184634_10054056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1669 | Open in IMG/M |
3300018075|Ga0184632_10103671 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1248 | Open in IMG/M |
3300018076|Ga0184609_10277130 | Not Available | 785 | Open in IMG/M |
3300018078|Ga0184612_10016649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3752 | Open in IMG/M |
3300018084|Ga0184629_10587217 | Not Available | 570 | Open in IMG/M |
3300018431|Ga0066655_10260140 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300018431|Ga0066655_11415914 | Not Available | 505 | Open in IMG/M |
3300018433|Ga0066667_10013757 | All Organisms → cellular organisms → Bacteria | 4032 | Open in IMG/M |
3300018433|Ga0066667_12089384 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300018468|Ga0066662_10134965 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300018468|Ga0066662_10642812 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1001 | Open in IMG/M |
3300018482|Ga0066669_12128978 | Not Available | 530 | Open in IMG/M |
3300019233|Ga0184645_1337485 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 698 | Open in IMG/M |
3300019259|Ga0184646_1047921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
3300019789|Ga0137408_1101746 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1120 | Open in IMG/M |
3300019789|Ga0137408_1112940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 5061 | Open in IMG/M |
3300019789|Ga0137408_1162652 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1186 | Open in IMG/M |
3300019789|Ga0137408_1297570 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
3300021073|Ga0210378_10087977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1213 | Open in IMG/M |
3300021073|Ga0210378_10152586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 891 | Open in IMG/M |
3300021086|Ga0179596_10446960 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300025910|Ga0207684_10588066 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 951 | Open in IMG/M |
3300025922|Ga0207646_10115296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2413 | Open in IMG/M |
3300025922|Ga0207646_10117337 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
3300026277|Ga0209350_1006789 | All Organisms → cellular organisms → Bacteria | 3889 | Open in IMG/M |
3300026277|Ga0209350_1008856 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
3300026296|Ga0209235_1055858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1872 | Open in IMG/M |
3300026296|Ga0209235_1069686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1608 | Open in IMG/M |
3300026296|Ga0209235_1101339 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1240 | Open in IMG/M |
3300026296|Ga0209235_1163886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 856 | Open in IMG/M |
3300026297|Ga0209237_1039612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2479 | Open in IMG/M |
3300026298|Ga0209236_1058720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1879 | Open in IMG/M |
3300026298|Ga0209236_1211394 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 702 | Open in IMG/M |
3300026313|Ga0209761_1073697 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
3300026313|Ga0209761_1197593 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 888 | Open in IMG/M |
3300026315|Ga0209686_1037789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1821 | Open in IMG/M |
3300026318|Ga0209471_1014302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4093 | Open in IMG/M |
3300026318|Ga0209471_1048775 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
3300026342|Ga0209057_1048463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2026 | Open in IMG/M |
3300026536|Ga0209058_1014590 | All Organisms → cellular organisms → Bacteria | 5397 | Open in IMG/M |
3300026551|Ga0209648_10000124 | All Organisms → cellular organisms → Bacteria | 51595 | Open in IMG/M |
3300027169|Ga0209897_1002260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2323 | Open in IMG/M |
3300027490|Ga0209899_1007006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2593 | Open in IMG/M |
3300027527|Ga0209684_1040705 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300027643|Ga0209076_1140641 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300027681|Ga0208991_1209222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
3300027846|Ga0209180_10185101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1202 | Open in IMG/M |
3300027846|Ga0209180_10199743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1153 | Open in IMG/M |
3300027862|Ga0209701_10063278 | All Organisms → cellular organisms → Bacteria | 2353 | Open in IMG/M |
3300028536|Ga0137415_10013959 | All Organisms → cellular organisms → Bacteria | 7972 | Open in IMG/M |
3300028536|Ga0137415_10019342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 6754 | Open in IMG/M |
3300028536|Ga0137415_10061685 | All Organisms → cellular organisms → Bacteria | 3614 | Open in IMG/M |
3300028673|Ga0257175_1045521 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 795 | Open in IMG/M |
3300028819|Ga0307296_10773502 | Not Available | 524 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1099435 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1006264 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
3300031543|Ga0318516_10016933 | All Organisms → cellular organisms → Bacteria | 3649 | Open in IMG/M |
3300031720|Ga0307469_10189657 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1592 | Open in IMG/M |
3300031720|Ga0307469_11436763 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
3300031740|Ga0307468_100019131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2970 | Open in IMG/M |
3300031740|Ga0307468_102025407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
3300032174|Ga0307470_11920340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
3300032180|Ga0307471_100742204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1147 | Open in IMG/M |
3300032180|Ga0307471_103236553 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.41% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 17.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.20% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.43% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.43% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.45% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.49% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.49% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.49% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1052347132 | 3300000364 | Soil | MKRAIFFALMLISILAPLASVAHADLKSDEAIVQAP* |
AF_2010_repII_A1DRAFT_101768362 | 3300000597 | Forest Soil | MKRFIVLALMLFAVTVPLMGVAHADLKSDEAIEQAP* |
JGI1027J11758_124375302 | 3300000789 | Soil | MKXAIFFALMLISILAPLASVAHADLKSDEAIVQAP* |
JGI10216J12902_1029499002 | 3300000956 | Soil | MKQAIFFALMLISILAPLASVAHADLKSDEAIVQAP* |
Ga0066679_101504153 | 3300005176 | Soil | MERRKEGYQMKRAIVLALMLAAVLVPLMGVAQADLRSDETITQAP* |
Ga0066697_100401217 | 3300005540 | Soil | MKRVMILALMLFAVLVPLTGIAHADLKSDEAIEQAP* |
Ga0066697_100479772 | 3300005540 | Soil | MKRAIVLALMLVTVLVPLMGVAHADLKSDEAIEQAP* |
Ga0066701_101510502 | 3300005552 | Soil | MKRIMILTLMLFAVLVPLTGIAHADLKSDEAIEQAP* |
Ga0066701_107861932 | 3300005552 | Soil | MKRAIFFALMLVAILAPLASTANADLKSDEAIEQAP* |
Ga0066701_108002642 | 3300005552 | Soil | MKRAIVLLLMLVTVLMPLMGVAHADLKSDEAIPQSP* |
Ga0066695_104910681 | 3300005553 | Soil | MKRAIVLALMLVTVLVPLVGVAHADVRSDEAAPQAP* |
Ga0066692_103721932 | 3300005555 | Soil | MKRAIVLARMLVTVLVPLMGSAHADLHGDEAIPQAP* |
Ga0066692_106553042 | 3300005555 | Soil | MKRAIVLALMLATVLVPLMGLAHADLKSDEAIEQAP* |
Ga0066704_102141922 | 3300005557 | Soil | MKRAIVLALMLAAVLVPLAGVANADLRSDEAITQAP* |
Ga0066704_103457552 | 3300005557 | Soil | MKRAIFLALLFVAILAPLAGAGAAYADLKSDEAIEQAP* |
Ga0066704_105181722 | 3300005557 | Soil | MKRAIFLALMLLTVLVPLTGVAHADVKSDEAIVQAP* |
Ga0066698_100005617 | 3300005558 | Soil | MKRAILFALMLVTVLAPLAGVAHADLRSDQTIPQAP* |
Ga0066698_103850472 | 3300005558 | Soil | MKRAIVLALMLATVLVPLMGVAHADLKSDEAIEQAP* |
Ga0066698_109881261 | 3300005558 | Soil | MKRAISLALMLLTVLVPLTGVAHADVKSDEAIVQAP* |
Ga0066698_110109192 | 3300005558 | Soil | MKRALLFALMLVAVLAPLAGVARADVKSDQAIPQAP* |
Ga0066700_111500682 | 3300005559 | Soil | RAIVLALMLVTVLVPLMGVAHADLKSDEAIEQAP* |
Ga0066703_107681652 | 3300005568 | Soil | MKRAIVLALMLATVLVPLMGVAHADLKSDEAIVQAP* |
Ga0066705_101819054 | 3300005569 | Soil | MKRAIVLALMLAAVLVPLMGVAQADLKTDETITQAP* |
Ga0066694_100244983 | 3300005574 | Soil | MKRAIFFALMLMAVLAPLAGNAYADVKSDEAIVQAP* |
Ga0066905_1010848301 | 3300005713 | Tropical Forest Soil | MSERGEEVMKRFMMLTLILSAVMVPLMGVAHADLKSDEAIVQAP* |
Ga0066903_1005621825 | 3300005764 | Tropical Forest Soil | MMKRLMILALMLFAVTVPLMGVAHADLKSDEAIEQAP* |
Ga0066903_1016247552 | 3300005764 | Tropical Forest Soil | MKQFIVLALMLFAVTVPLMGVAHADLKSDEAIVQAP* |
Ga0066651_1000548011 | 3300006031 | Soil | MKRAIVLALILAAVLVPLMGVAQADLRSDETITQAP* |
Ga0066696_101220302 | 3300006032 | Soil | MKRAIVLALMLAAVLVPLIGVAQADLKTDETITQAP* |
Ga0066656_110292292 | 3300006034 | Soil | TEGREIKMKRALLFALMLVAVLAPLAGVARADVKSDQAIPQAP* |
Ga0066665_105913922 | 3300006796 | Soil | MKRAIVLALMLAAFLAPLAGVANADLRTDEAITQAP* |
Ga0066659_106189653 | 3300006797 | Soil | MKRAIVLALMLAAVLVPLMGVAQADLRTDETITQAP* |
Ga0066660_102835542 | 3300006800 | Soil | MKRAIVLALMLAAVLVPLMGVAQADLRSDETITQAP* |
Ga0075425_1000281753 | 3300006854 | Populus Rhizosphere | MKRFMILALMLFAVLVPLTGIAHADLKSDEAIEQAP* |
Ga0075424_1022974191 | 3300006904 | Populus Rhizosphere | MKRAIFFALMLISILAPLASVAHADLKSDEAIEQAP* |
Ga0099791_100040034 | 3300007255 | Vadose Zone Soil | MKRAIVLVLMLVAVLVPLAGANADLKSDQAIPQAP* |
Ga0099791_100867594 | 3300007255 | Vadose Zone Soil | MKRAVFLALMLVTVLVPLMGVAHADLKSDEAIEQAP* |
Ga0099791_101290261 | 3300007255 | Vadose Zone Soil | MMKRLMILALMLFAVTVPLLGVAHADLKSDEAIEQAP* |
Ga0099793_100519693 | 3300007258 | Vadose Zone Soil | MKRVIILALMLFAVLIPLTGIAQADLKSDEAIQQAP* |
Ga0099793_102428692 | 3300007258 | Vadose Zone Soil | MKRAIVLALMLVTVLVPLMGVAHADLKSDEAIPRAP* |
Ga0099793_103604262 | 3300007258 | Vadose Zone Soil | MKRAIVLALMLVTVLVPLMGVAHADLKSDEAIPQAP* |
Ga0099794_100004636 | 3300007265 | Vadose Zone Soil | MKRAILFALMLVAVLAPLAGVARADLKSDQTIPQAP* |
Ga0099794_100056654 | 3300007265 | Vadose Zone Soil | MKRAIFLALMLLTVLVPLMGVANADLKSDEAIEQAP* |
Ga0099794_103877232 | 3300007265 | Vadose Zone Soil | MEGEQMKRAVFFALMLITILAPLASVAHADLKSDEAIEQAP* |
Ga0099794_105896791 | 3300007265 | Vadose Zone Soil | MAIVLALMLVTVLVPLMGVAHADLKSDEAIPQAP* |
Ga0066710_1000009989 | 3300009012 | Grasslands Soil | MKRAIFFALMLVAILAPLASTANADLKSDEAIEQAP |
Ga0066710_1000167123 | 3300009012 | Grasslands Soil | MKRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP |
Ga0066710_1003058451 | 3300009012 | Grasslands Soil | MKRAIVLALMLVTVLVPLVGVAHADVRSDEAAPQAP |
Ga0066710_1005259283 | 3300009012 | Grasslands Soil | MKRAIVLALMLVTVLVPLMGVAHANLKSDEAIEQAP |
Ga0066710_1009504131 | 3300009012 | Grasslands Soil | MKRAIVLALMLAAFLAPLAGVANADLRTDEAITQAP |
Ga0066710_1009516713 | 3300009012 | Grasslands Soil | MKRAIVLALMLAAVLVPLAGVANADLRSDEAITQAP |
Ga0066710_1016156843 | 3300009012 | Grasslands Soil | MKRAIFLALMLLTVLVPLTGVAHADLKSDEAIEQAP |
Ga0099829_103662291 | 3300009038 | Vadose Zone Soil | MKRAIVLALMFVALLVPLMGVAQADLKSDEAIEQAP* |
Ga0099829_105937111 | 3300009038 | Vadose Zone Soil | MKRAVFLAPMLIAVLAPLAGVAHADLRSDEAIGQAP* |
Ga0099830_100120762 | 3300009088 | Vadose Zone Soil | MKRAIVLALMLVAVLVPLMGVAHADLKSDDAITQAP* |
Ga0099830_103678232 | 3300009088 | Vadose Zone Soil | MKRAIVLALMLVAVLVPLVGVAHADLKSDEAITQAP* |
Ga0099830_104598413 | 3300009088 | Vadose Zone Soil | MKRAIVLALMLVTVLVPLMSVAHADLKSDEAIPQAP* |
Ga0099827_100001897 | 3300009090 | Vadose Zone Soil | MKRAIFLALMLLTVLVPLIGVANADLKSDEAIEQAP* |
Ga0099827_119679121 | 3300009090 | Vadose Zone Soil | MKRAIVLALMLATVLVPLMGVAHADLKSDEAIPQAP* |
Ga0066709_1000801673 | 3300009137 | Grasslands Soil | MKRAIVLALMLVTVLVPLMGVAHANLKSDEAIEQAP* |
Ga0066709_1002916225 | 3300009137 | Grasslands Soil | MKRAIVLALMLAAVLAPLAGVANADLRTDEAITQAP* |
Ga0066709_1009828983 | 3300009137 | Grasslands Soil | MKRAIVLALMLAAVLAPLAGVASADLRTDEAITQAP* |
Ga0066709_1014928341 | 3300009137 | Grasslands Soil | MKRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0066709_1041780202 | 3300009137 | Grasslands Soil | MKRAIFLGLLFVAILAPLAGAGAAYADLKSDEAIEQAP* |
Ga0099792_100935261 | 3300009143 | Vadose Zone Soil | MKRAVFLALMLIAVLAPLAGVAHADLRSDEAIGQAP* |
Ga0105065_10054242 | 3300009803 | Groundwater Sand | MKRAILFALMLVTVLAPLAGVAHADLKSDQAIPQAP* |
Ga0105066_11080182 | 3300009822 | Groundwater Sand | MKRAILVALMLLAVLTPLAEVAHADLKSDQTIPQAP* |
Ga0105058_11981161 | 3300009837 | Groundwater Sand | MKRAILLAPMLVTVLVPLMGVAHADLKSDEAIVQAP* |
Ga0127457_10126961 | 3300010081 | Grasslands Soil | EIKMKRAILFALMLVTVLAPLAGVAHADLRSDQTIPQAP* |
Ga0127457_10816901 | 3300010081 | Grasslands Soil | QMKRAIVLALMLVTVLVPLMGVAHANLKSDEAIEQAP* |
Ga0127453_10928891 | 3300010102 | Grasslands Soil | KRAIFLALMLLTVLVPLTGVAHADVKSDEAIVQAP* |
Ga0127500_11191952 | 3300010103 | Grasslands Soil | MRRAIVLALMLATVLVPLMGVAHADLKSDEAIEQAP* |
Ga0127494_10022871 | 3300010107 | Grasslands Soil | EQMKRAIFFALMLVAILAPLASTANADLKSDEAIEQAP* |
Ga0127497_10659943 | 3300010109 | Grasslands Soil | KRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0127491_11014521 | 3300010111 | Grasslands Soil | QMKRAIFFALMLMAVLAPLAGNAYADVKSDEAIVQAP* |
Ga0127452_10856561 | 3300010119 | Grasslands Soil | MKRAIYLALMLLTVLVPLTGVAHADVKSDEAIVQAP* |
Ga0127498_10165531 | 3300010124 | Grasslands Soil | KRAIVLALMLVTVLVPLVGVAHADVRSDEAAPQAP* |
Ga0127498_10435712 | 3300010124 | Grasslands Soil | EIKMKRALLFALMLVAVLAPLAGVARAAVKSDQAIPQAP* |
Ga0127486_10884892 | 3300010128 | Grasslands Soil | NMKRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0127455_11265912 | 3300010132 | Grasslands Soil | KRVLLFALMLVAVLAPLAGVAHADLKSDQAIPQAP* |
Ga0127459_10564301 | 3300010133 | Grasslands Soil | IKMKRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0127456_10966131 | 3300010140 | Grasslands Soil | IKMKRVLLFALMLVAVLAPLAGVAHADLKSDQAIPQAP* |
Ga0134088_101258392 | 3300010304 | Grasslands Soil | MKRAILFALMLVTVLAPLVGVAHADLKSDQTIPQAP* |
Ga0134088_102900701 | 3300010304 | Grasslands Soil | EIKMKRARLFALMLVAVLAPLAGVARAAVKSDQAIPQAP* |
Ga0126376_100221074 | 3300010359 | Tropical Forest Soil | MMKRLMILALMLLAVTVPLMGVAHADLKSDEAIEQAP* |
Ga0126372_124647652 | 3300010360 | Tropical Forest Soil | MMKQLMILALMLLAVTVPLMGVAHADLKSDEAIEQAP* |
Ga0126377_115302882 | 3300010362 | Tropical Forest Soil | MKRIMILTLMLLAVLVPLSGVAHADLKSDEAIVQAP* |
Ga0126383_101431824 | 3300010398 | Tropical Forest Soil | MKQFIVLALMLFAVTVPLMGVAHADLKSDEAIEQAP* |
Ga0137392_102308441 | 3300011269 | Vadose Zone Soil | MKRAIVLALMLLTVLVPLTSVAHADLKSDEAIPQAP* |
Ga0137389_101388384 | 3300012096 | Vadose Zone Soil | MKRAMILALMLFAVLVPLTGIAHADLKSDEAITQAP* |
Ga0137389_101985442 | 3300012096 | Vadose Zone Soil | MKRVIVLALMLATVLVPLMGVAHADLKSDEAIEQAP* |
Ga0137364_100086876 | 3300012198 | Vadose Zone Soil | MKRAIVLALMLAAFLAPLAGVANADLRSDEAITQAP* |
Ga0137364_112796731 | 3300012198 | Vadose Zone Soil | MKRAIVLALMLAAVLVSLMGVAQADLKTDETITQAP* |
Ga0137383_105770752 | 3300012199 | Vadose Zone Soil | MKRAIVLALMLVTVLVPLMGVAHADLKSDEAIVQAP* |
Ga0137382_103416932 | 3300012200 | Vadose Zone Soil | MKRAIVLALMLVTALVPLMGVAHADLKSDEAIVQAP* |
Ga0137363_101057563 | 3300012202 | Vadose Zone Soil | MKRAIFLALMLLSVLVPLMGVANADLKSDEAIEQAP* |
Ga0137399_100148301 | 3300012203 | Vadose Zone Soil | MKRAIVLALMLAAVLVPLAGVAYADLKGDETITQAP* |
Ga0137399_100320105 | 3300012203 | Vadose Zone Soil | MKRIIVLALMLATVLVPLMGVAHADLKSDEAIEQAP* |
Ga0137399_105840662 | 3300012203 | Vadose Zone Soil | MKRAIVLALMLVTVLVPLMGVAHADLHSDEAIPQAP* |
Ga0137399_116479652 | 3300012203 | Vadose Zone Soil | MKRAIVLALMLVAVLVPLMGVAHASLKSDEAIEQAP* |
Ga0137374_102077332 | 3300012204 | Vadose Zone Soil | MKRAILFVLMLVTVLAPLAGVAHADLKSDQAIPQAP* |
Ga0137362_1001897011 | 3300012205 | Vadose Zone Soil | MKRAIFFALMLITILAPLASVAHADLKSDEAIEQAP* |
Ga0137381_101590732 | 3300012207 | Vadose Zone Soil | MKRAILFGLMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0137367_101917673 | 3300012353 | Vadose Zone Soil | MKRAILFALMLVTVLGPLAGVAHADLKSDQAIPQAP* |
Ga0137375_109558361 | 3300012360 | Vadose Zone Soil | MKRAILFALVLVTVLAPLAGVAHADLKSDQAIPQAP* |
Ga0137360_107569572 | 3300012361 | Vadose Zone Soil | MKRALVLALMLVTVLVPLMGVAHADVKTDEAIEQAP* |
Ga0134058_11273621 | 3300012379 | Grasslands Soil | IKMKRALLFALMLVAVLAPFAGTAHADLKSDQAIPQAP* |
Ga0134058_12314862 | 3300012379 | Grasslands Soil | GEQMKRAIFFALMLVAILAPLASTANADLKSDEAIEQAP* |
Ga0134046_11562521 | 3300012386 | Grasslands Soil | INMKRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0134054_12089881 | 3300012390 | Grasslands Soil | RKRWFIPSCKMKRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0134052_10125612 | 3300012393 | Grasslands Soil | MKRAIVLALMLATVLVPLMGVAHADFKSDEAIEQAP* |
Ga0134052_11266942 | 3300012393 | Grasslands Soil | EIKMKRAILFALMLVTVLAPLVGVAHADLKSDQTIPQAP* |
Ga0134052_11976981 | 3300012393 | Grasslands Soil | KMKRALLFALMLVAVLAPFAGTAHADLKSDQAIPQAP* |
Ga0134057_10149962 | 3300012396 | Grasslands Soil | EIKMKRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0134051_10596361 | 3300012398 | Grasslands Soil | KMKRAILFALMLVTVLAPLVGVAHADLKSDQTIPQAP* |
Ga0134055_10840551 | 3300012401 | Grasslands Soil | EIKMKRALLFALMLVAVLAPLAGVARADVKSDQAITQAP* |
Ga0134059_10304652 | 3300012402 | Grasslands Soil | MKRALLFALMLVAVLAPFAGTAHADLKSDQAIPQAP* |
Ga0134059_12562651 | 3300012402 | Grasslands Soil | KRAIVLALMLVTVLVPLMGVAHADLKSDEAIEQAP* |
Ga0134053_13047792 | 3300012406 | Grasslands Soil | EINMKRAILFALMLVTVLAPLAGVAHADLKSDQTIPQAP* |
Ga0134045_10524921 | 3300012409 | Grasslands Soil | IKMKRAILFALMLVTVLAPLAGVAHADLRSDQTIPQAP* |
Ga0137358_101689845 | 3300012582 | Vadose Zone Soil | MKKAIVLALMLVTVLVPLMGVAHASLKSDEAIEQAP* |
Ga0137358_110532682 | 3300012582 | Vadose Zone Soil | MKRIIVLALMLATVLVPLMGVAHADLKSDEAIVQAP* |
Ga0137397_100606407 | 3300012685 | Vadose Zone Soil | MKRFMILALMLLAVTVPLMGVAQADLKSDEAIEQAP* |
Ga0137396_103339383 | 3300012918 | Vadose Zone Soil | MKRAIVLALMLVAVLVPLMGVAHADLKSDEAIEQAP* |
Ga0137394_101403135 | 3300012922 | Vadose Zone Soil | MKRFMILALMLFAVTVPLMGVAHADLKSDEAIEQAP* |
Ga0137394_108288883 | 3300012922 | Vadose Zone Soil | MKRFMILALMLLAVTVPLMGVAHADLKSDEAIEQAP* |
Ga0137394_110352003 | 3300012922 | Vadose Zone Soil | MKRAIFLALMLLTVLVPLTGVAHADLKSDEAVVQAP* |
Ga0137404_111408482 | 3300012929 | Vadose Zone Soil | MKRAIVLALMLVTVLVPLMGLAHADLKSDEAIVQAP* |
Ga0137407_102503161 | 3300012930 | Vadose Zone Soil | MKRAIFLALMLLTVLVPLTSVAHADLKSDEAIPQAP* |
Ga0134087_105950241 | 3300012977 | Grasslands Soil | MKRAIVLALMLVTVLVPLMGVAHAYLKSDEAIEQAP* |
Ga0137409_103537112 | 3300015245 | Vadose Zone Soil | MKRAILFALMLVVVLAPLAGVARADLKSDQTIPQAP* |
Ga0137409_104813401 | 3300015245 | Vadose Zone Soil | GNQAMKRFMILAVMLFAVTVPLMGVAHADLKSDEAIEQAP* |
Ga0137403_115213432 | 3300015264 | Vadose Zone Soil | KMKRAIVLALMLVTVLVPLMGVAHADLKSDEAIVQAP* |
Ga0134089_102136552 | 3300015358 | Grasslands Soil | EGREIKMKRARLFALMLVAVLAPLAGVARAAVKSDQAIPQAP* |
Ga0134112_104966941 | 3300017656 | Grasslands Soil | MKRAIFLALMLLTVLVPLTGVAHADVKSDEAIVQAP |
Ga0134083_101365032 | 3300017659 | Grasslands Soil | MKRAILFALMLVTVLAPLVGVAHADLKSDQTIPQSP |
Ga0134083_102213551 | 3300017659 | Grasslands Soil | MKRARLFALMLVAGLAPLAVVARADVKSDQAIPQAP |
Ga0187775_100042212 | 3300017939 | Tropical Peatland | MKRVLFVAFVLMAVLVPLAGVAHADLRSDEAQAQAP |
Ga0184610_10069715 | 3300017997 | Groundwater Sediment | MMKRALLFALMLVAVLAPLAGVAHADLKSDQAIPQAP |
Ga0184605_101920981 | 3300018027 | Groundwater Sediment | MKRAIILALMLVAVLGQFTGVAHAGLRSDETITQAP |
Ga0184634_100540562 | 3300018031 | Groundwater Sediment | MMKRALLFALMFVAVLAPLAGVAHADLKSDQAIPQAP |
Ga0184632_101036713 | 3300018075 | Groundwater Sediment | MMKRALLFALMLVAVLAPLAAVAHADLKSDQAIPQAP |
Ga0184609_102771301 | 3300018076 | Groundwater Sediment | MMKRALLFALMLVAVLAPLAGVAHADLKSDQTIPQAP |
Ga0184612_100166497 | 3300018078 | Groundwater Sediment | MKRAILFALMLVIVLALLVGVVHADLKSDQAIPQAP |
Ga0184629_105872171 | 3300018084 | Groundwater Sediment | MTKRVLLFVLMLVAVLAPLAGVAHADLKSDQAIPQAP |
Ga0066655_102601403 | 3300018431 | Grasslands Soil | MKRAIVLALMLVTVLVPLMGVAHADLKSDEAIEQAP |
Ga0066655_114159141 | 3300018431 | Grasslands Soil | MKRAIVLALMLAAVLVPLIGVAQADLKTDETITQAP |
Ga0066667_100137576 | 3300018433 | Grasslands Soil | MKRVMILALMLFAVLVPLTGIAHADLKSDEAIEQAP |
Ga0066667_120893842 | 3300018433 | Grasslands Soil | MKRAIVLALMLAAVLVPLMGVAQADLRTDETITQAP |
Ga0066662_101349652 | 3300018468 | Grasslands Soil | MKRAIVLALMLATVLVPLMGLAHADLKSDEAIEQAP |
Ga0066662_106428123 | 3300018468 | Grasslands Soil | MKRIMILTLMLFAVLVPLTGIAHADLKSDEAIEQAP |
Ga0066669_121289781 | 3300018482 | Grasslands Soil | MKRAIVLALMLAAVLVPLMGVAQADLRTDEIITQAP |
Ga0184645_13374851 | 3300019233 | Groundwater Sediment | GREIMMKRALLFALMLVAVLAPLAGVAHADLKSDQAIPQAP |
Ga0184646_10479212 | 3300019259 | Groundwater Sediment | EIMMKRALLFALMLVAVLAPLAGVAHADLKSDQAIPQAP |
Ga0137408_11017461 | 3300019789 | Vadose Zone Soil | MKRAIFLALMLLTVLVPLMGVANADLKSDEAIEQAP |
Ga0137408_11129405 | 3300019789 | Vadose Zone Soil | MKRAIFFALMLITILAPLASVAHADLKSDEAIEQAP |
Ga0137408_11626523 | 3300019789 | Vadose Zone Soil | MKRFMILALMLLAVTVPLMGVAQADLKSDEAIEQAP |
Ga0137408_12975703 | 3300019789 | Vadose Zone Soil | MKKAIVLALMLVTVLVPLMGVAHASLKSDEAIEQAP |
Ga0210378_100879772 | 3300021073 | Groundwater Sediment | MKRAILFALMLVTVLAPLAGVAHADLKSDQAIPQAP |
Ga0210378_101525861 | 3300021073 | Groundwater Sediment | MKRAIVLALMLVTVLVPLMGVAHADLKSDEAIPQAP |
Ga0179596_104469602 | 3300021086 | Vadose Zone Soil | MKRAIVLVLMLVAVLVPLAGANADLKSDQAIPQAP |
Ga0207684_105880662 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRAIVLALMLATVLVPLMGVAHADLKSDEAIEQAP |
Ga0207646_101152964 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRAIVLALMLATVLVPLMGVAHADLKSDEAIEQAP |
Ga0207646_101173372 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRVMILTLMLFAVLVPLTGIAHADLKSDEAIEQAP |
Ga0209350_10067893 | 3300026277 | Grasslands Soil | MKRAIVLALMLAAVLAPLAGVASADLRTDEAITQAP |
Ga0209350_10088566 | 3300026277 | Grasslands Soil | MKRAIFFALMLMAVLAPLAGNAYADVKSDEAIVQAP |
Ga0209235_10558582 | 3300026296 | Grasslands Soil | MKRALLFALMLVAVLAPLAGVARADVKSDQAIPQAP |
Ga0209235_10696862 | 3300026296 | Grasslands Soil | MKRAIVLLLMLVTVLMPLMGVAHADLKSDEAIPQSP |
Ga0209235_11013392 | 3300026296 | Grasslands Soil | MKRAILFALMLVAVLAPLAGVARADLKSDQTIPQAP |
Ga0209235_11638861 | 3300026296 | Grasslands Soil | MKRAIVLARMLVTVLVPLMGVAHADLHSDEAIPQAP |
Ga0209237_10396124 | 3300026297 | Grasslands Soil | MKRAIVLARMLVTVLVPLMGSAHADLHSDEAIPQAP |
Ga0209236_10587201 | 3300026298 | Grasslands Soil | MKRARLFALMLVAVLAPLAVVARADVKSDQAIPQAP |
Ga0209236_12113943 | 3300026298 | Grasslands Soil | MKRFMILALMLFAVLVPLTGIAHADLKSDEAIEQAP |
Ga0209761_10736971 | 3300026313 | Grasslands Soil | MKRAIFLALMPLSVLVPLMGVANADLKSDEAIEQAP |
Ga0209761_11975932 | 3300026313 | Grasslands Soil | MKRAIVLALMLLTVLVPLTSVAHADLKSDEAIPQAP |
Ga0209686_10377891 | 3300026315 | Soil | EASHCSWLMLATVLVPLMGVAHADLKSDEAIERAP |
Ga0209471_10143022 | 3300026318 | Soil | MERRKEGYQMKRAIVLALMLAAVLVPLMGVAQADLRSDETITQAP |
Ga0209471_10487755 | 3300026318 | Soil | MKRFIVLALMLAAIVAPLAGVAHADVRSDEAITQAP |
Ga0209057_10484634 | 3300026342 | Soil | MKRLMILALMLFAVLVPLTGIAHADLKSDEAIEQAP |
Ga0209058_10145908 | 3300026536 | Soil | MKRAILFALMLVTVLAPLAGVAHADLRSDQTIPQAP |
Ga0209648_1000012420 | 3300026551 | Grasslands Soil | MKRAIVLALMLVAVLVPLMGVAHADLKSDDAITQAP |
Ga0209897_10022601 | 3300027169 | Groundwater Sand | MKRAILVALMLLAVLTPLAEVAHADLKSDQTIPQAP |
Ga0209899_10070062 | 3300027490 | Groundwater Sand | MKRVLLFALMLVAVLAPLAGVAHADLKSDQAIPQAP |
Ga0209684_10407052 | 3300027527 | Tropical Forest Soil | MTGWKQLMILALMLLAVTVPLMGVAHADLKSDEAIEQAP |
Ga0209076_11406411 | 3300027643 | Vadose Zone Soil | MKRAIVLALMLLTVLVPLTSVAHADLKSDEAIEQAP |
Ga0208991_12092222 | 3300027681 | Forest Soil | MKRIIVLALMLATVLVPLMGVAHADLKSDEAIVQAP |
Ga0209180_101851011 | 3300027846 | Vadose Zone Soil | MKRAVFLAPMLIAVLAPLAGVAHADLRSDEAIGQAP |
Ga0209180_101997434 | 3300027846 | Vadose Zone Soil | MKRAIVLALMFVALLVPLMGVAQADLKSDEAIEQAP |
Ga0209701_100632782 | 3300027862 | Vadose Zone Soil | MKRAIVLALMLVAVLVPLVGVAHADLKSDEAITQAP |
Ga0137415_100139598 | 3300028536 | Vadose Zone Soil | MKRAIVLALMLAAVLVPLAGVAYADLKGDETITQAP |
Ga0137415_1001934211 | 3300028536 | Vadose Zone Soil | MGERKGGHEMKRVIILALMLFAVLIPLTGIAQADLKSDEAIQQAP |
Ga0137415_100616854 | 3300028536 | Vadose Zone Soil | MKRIIVLALMLATVLVPLMGVAHADLKSDEAIEQAP |
Ga0257175_10455212 | 3300028673 | Soil | MMKRAILFALMLVAVLAPLAGVARADLKSDQTIPQAP |
Ga0307296_107735021 | 3300028819 | Soil | AGRSAIKKGERREGEQMKRAIILALMLVAVLGQFTGVAHAGLRSDETITQAP |
(restricted) Ga0255311_10994351 | 3300031150 | Sandy Soil | MKKAMILALMLFAVLVPLTGIAHADLKSDEAITQAP |
(restricted) Ga0255312_10062643 | 3300031248 | Sandy Soil | MKKAMILALMLFVVLVPLTGIAHADLKSDEAITQAP |
Ga0318516_100169333 | 3300031543 | Soil | MMKRLMILALMLFAVTVPLMGVAHADLKSDEAIEQAP |
Ga0307469_101896573 | 3300031720 | Hardwood Forest Soil | MKRAIVLALMLVTVLVPFIGVAHADLKSDEAIEQAP |
Ga0307469_114367631 | 3300031720 | Hardwood Forest Soil | MKRDIVLALMLATVLVPLMGVAHADLKSDEAIEQAP |
Ga0307468_1000191316 | 3300031740 | Hardwood Forest Soil | MMKRFMILALMLFAVTVPLLGVAHADLKSDEAIEQAP |
Ga0307468_1020254072 | 3300031740 | Hardwood Forest Soil | MKRAVFFALMLITLLAPLASIAHADLKSDEAIEQAP |
Ga0307470_119203402 | 3300032174 | Hardwood Forest Soil | MKRFMILALMLFAVTVPLLGVAHADLKSDEAIEQAP |
Ga0307471_1007422042 | 3300032180 | Hardwood Forest Soil | MKRAIFFALMLIGILAPLASVAHADLKSDEAIVQAP |
Ga0307471_1032365532 | 3300032180 | Hardwood Forest Soil | MKRAIFFALMLMAILAPLAGTAYADVKGDEAIVQAP |
⦗Top⦘ |