NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F024677

Metagenome / Metatranscriptome Family F024677

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024677
Family Type Metagenome / Metatranscriptome
Number of Sequences 205
Average Sequence Length 42 residues
Representative Sequence VRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYIVGQLLL
Number of Associated Samples 157
Number of Associated Scaffolds 205

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.17 %
% of genes near scaffold ends (potentially truncated) 26.34 %
% of genes from short scaffolds (< 2000 bps) 88.78 %
Associated GOLD sequencing projects 148
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.244 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.049 % of family members)
Environment Ontology (ENVO) Unclassified
(29.756 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.951 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.61%    β-sheet: 0.00%    Coil/Unstructured: 51.39%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 205 Family Scaffolds
PF12773DZR 22.44
PF00334NDK 11.71
PF08245Mur_ligase_M 7.80
PF10458Val_tRNA-synt_C 4.39
PF08241Methyltransf_11 1.95
PF02545Maf 1.46
PF05545FixQ 0.49
PF07690MFS_1 0.49
PF00795CN_hydrolase 0.49
PF07676PD40 0.49
PF06723MreB_Mbl 0.49
PF14264Glucos_trans_II 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 205 Family Scaffolds
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 11.71
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 1.46
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 0.49
COG4736Cbb3-type cytochrome oxidase, subunit 3Energy production and conversion [C] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.24 %
UnclassifiedrootN/A9.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig520942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium800Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig528982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
2228664021|ICCgaii200_c1109105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1378Open in IMG/M
3300000559|F14TC_103563165Not Available522Open in IMG/M
3300000858|JGI10213J12805_10397612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1658Open in IMG/M
3300000890|JGI11643J12802_11696886Not Available603Open in IMG/M
3300000956|JGI10216J12902_104314311All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300000956|JGI10216J12902_121359593All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300001431|F14TB_100341960Not Available572Open in IMG/M
3300002568|C688J35102_119547351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300004463|Ga0063356_105106922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300005093|Ga0062594_100338300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1173Open in IMG/M
3300005172|Ga0066683_10456234All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005187|Ga0066675_10188909All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300005329|Ga0070683_100028770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5025Open in IMG/M
3300005337|Ga0070682_101511699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300005356|Ga0070674_100099915All Organisms → cellular organisms → Bacteria2112Open in IMG/M
3300005444|Ga0070694_101082563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300005526|Ga0073909_10210335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300005526|Ga0073909_10531279All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005526|Ga0073909_10621126Not Available535Open in IMG/M
3300005536|Ga0070697_101815930Not Available545Open in IMG/M
3300005539|Ga0068853_100830421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria886Open in IMG/M
3300005553|Ga0066695_10008641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5182Open in IMG/M
3300005556|Ga0066707_10134350All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300005564|Ga0070664_100207065All Organisms → cellular organisms → Bacteria1752Open in IMG/M
3300005568|Ga0066703_10764949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300005577|Ga0068857_100271727All Organisms → cellular organisms → Bacteria1558Open in IMG/M
3300005598|Ga0066706_11148259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300005713|Ga0066905_100063973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2330Open in IMG/M
3300005713|Ga0066905_100669935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales887Open in IMG/M
3300005713|Ga0066905_100894087All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300005713|Ga0066905_101698983Not Available580Open in IMG/M
3300005719|Ga0068861_102477939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300005844|Ga0068862_100364393All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300005937|Ga0081455_10282877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1197Open in IMG/M
3300005937|Ga0081455_10505486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300006038|Ga0075365_10165872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1541Open in IMG/M
3300006046|Ga0066652_100375881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1287Open in IMG/M
3300006579|Ga0074054_10011529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300006579|Ga0074054_12093448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1043Open in IMG/M
3300006580|Ga0074049_13187304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300006581|Ga0074048_12941169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300006796|Ga0066665_10345288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1212Open in IMG/M
3300006800|Ga0066660_10159160All Organisms → cellular organisms → Bacteria1682Open in IMG/M
3300006844|Ga0075428_100655044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1120Open in IMG/M
3300006844|Ga0075428_102421709Not Available539Open in IMG/M
3300006852|Ga0075433_10960732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium745Open in IMG/M
3300006854|Ga0075425_100287525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1892Open in IMG/M
3300007004|Ga0079218_13485781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300007076|Ga0075435_101058363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300009012|Ga0066710_100551893All Organisms → cellular organisms → Bacteria1743Open in IMG/M
3300009012|Ga0066710_103894497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300009098|Ga0105245_11057178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300009100|Ga0075418_10490003All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300009147|Ga0114129_11437323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium850Open in IMG/M
3300009147|Ga0114129_11541722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria815Open in IMG/M
3300009148|Ga0105243_10161619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1932Open in IMG/M
3300009148|Ga0105243_10240926All Organisms → cellular organisms → Bacteria → Terrabacteria group1609Open in IMG/M
3300009176|Ga0105242_10754860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300009176|Ga0105242_11594452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300009840|Ga0126313_10846327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium745Open in IMG/M
3300009840|Ga0126313_11355615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300010037|Ga0126304_10102366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1812Open in IMG/M
3300010037|Ga0126304_10587377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300010038|Ga0126315_10944921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300010038|Ga0126315_11099908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300010038|Ga0126315_11117652Not Available533Open in IMG/M
3300010039|Ga0126309_10388191Not Available832Open in IMG/M
3300010039|Ga0126309_10507444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300010039|Ga0126309_10830339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300010039|Ga0126309_11284637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300010043|Ga0126380_11250505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300010166|Ga0126306_10960864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300010359|Ga0126376_10044902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3092Open in IMG/M
3300010403|Ga0134123_10393085All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300010938|Ga0137716_10189060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1275Open in IMG/M
3300011400|Ga0137312_1004013All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300011412|Ga0137424_1087825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300012201|Ga0137365_10559636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium839Open in IMG/M
3300012204|Ga0137374_10029530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6023Open in IMG/M
3300012204|Ga0137374_10082238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3113Open in IMG/M
3300012204|Ga0137374_10109217All Organisms → cellular organisms → Bacteria2581Open in IMG/M
3300012207|Ga0137381_11643686Not Available533Open in IMG/M
3300012208|Ga0137376_10347970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1287Open in IMG/M
3300012208|Ga0137376_11191683All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300012212|Ga0150985_114468551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2143Open in IMG/M
3300012350|Ga0137372_10087981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2631Open in IMG/M
3300012530|Ga0136635_10069101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1088Open in IMG/M
3300012668|Ga0157216_10223540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria885Open in IMG/M
3300012882|Ga0157304_1071697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300012900|Ga0157292_10227115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300012918|Ga0137396_11055771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300012958|Ga0164299_10329476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium951Open in IMG/M
3300012985|Ga0164308_10997639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300013500|Ga0120195_1015004Not Available629Open in IMG/M
3300014325|Ga0163163_12326439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300014326|Ga0157380_10207453All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300014965|Ga0120193_10105308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300015170|Ga0120098_1022077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia790Open in IMG/M
3300015201|Ga0173478_10060147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1277Open in IMG/M
3300015371|Ga0132258_11236286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1888Open in IMG/M
3300015371|Ga0132258_12004586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1456Open in IMG/M
3300017659|Ga0134083_10055793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1496Open in IMG/M
3300017997|Ga0184610_1174940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium711Open in IMG/M
3300017997|Ga0184610_1187670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300018027|Ga0184605_10014055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3123Open in IMG/M
3300018027|Ga0184605_10047127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1825Open in IMG/M
3300018027|Ga0184605_10108406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1230Open in IMG/M
3300018028|Ga0184608_10057752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1545Open in IMG/M
3300018051|Ga0184620_10029151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1437Open in IMG/M
3300018052|Ga0184638_1200754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300018054|Ga0184621_10079815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300018056|Ga0184623_10071469All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300018056|Ga0184623_10072973All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300018061|Ga0184619_10001192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9105Open in IMG/M
3300018061|Ga0184619_10096417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1326Open in IMG/M
3300018061|Ga0184619_10174549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria985Open in IMG/M
3300018061|Ga0184619_10539574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300018071|Ga0184618_10245897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300018071|Ga0184618_10333856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300018072|Ga0184635_10017877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2567Open in IMG/M
3300018072|Ga0184635_10080505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1277Open in IMG/M
3300018072|Ga0184635_10309142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300018073|Ga0184624_10040553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1845Open in IMG/M
3300018075|Ga0184632_10227188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium819Open in IMG/M
3300018076|Ga0184609_10241595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300018078|Ga0184612_10221400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300018082|Ga0184639_10489836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300018433|Ga0066667_10607159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium913Open in IMG/M
3300018466|Ga0190268_10923688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300018466|Ga0190268_11360127Not Available604Open in IMG/M
3300018476|Ga0190274_11781018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300019255|Ga0184643_1269362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1046Open in IMG/M
3300019356|Ga0173481_10052991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1404Open in IMG/M
3300019356|Ga0173481_10827780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300019361|Ga0173482_10225459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300019767|Ga0190267_11481468Not Available521Open in IMG/M
3300019869|Ga0193705_1085480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300019875|Ga0193701_1083302Not Available616Open in IMG/M
3300019884|Ga0193741_1006945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3008Open in IMG/M
3300020001|Ga0193731_1097798All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300020008|Ga0193757_1026940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300020020|Ga0193738_1018777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2191Open in IMG/M
3300021073|Ga0210378_10163210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium858Open in IMG/M
3300021073|Ga0210378_10281426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300021418|Ga0193695_1000011All Organisms → cellular organisms → Bacteria102131Open in IMG/M
3300021445|Ga0182009_10488530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300021510|Ga0222621_1049372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium881Open in IMG/M
3300021972|Ga0193737_1058970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300022694|Ga0222623_10151572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria902Open in IMG/M
3300022694|Ga0222623_10287835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300022899|Ga0247795_1022352All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300023071|Ga0247752_1077952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300024347|Ga0179591_1006682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3138Open in IMG/M
3300025917|Ga0207660_11094971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300025920|Ga0207649_10409899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1016Open in IMG/M
3300025934|Ga0207686_10975618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300025934|Ga0207686_10986161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300025935|Ga0207709_10067938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2251Open in IMG/M
3300025937|Ga0207669_11405530Not Available594Open in IMG/M
3300025942|Ga0207689_11133158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300025944|Ga0207661_10205996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1731Open in IMG/M
3300026089|Ga0207648_10919883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300026306|Ga0209468_1099461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales937Open in IMG/M
3300026538|Ga0209056_10055280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3518Open in IMG/M
3300026552|Ga0209577_10117854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2129Open in IMG/M
3300027032|Ga0209877_1029531Not Available546Open in IMG/M
3300027587|Ga0209220_1067857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium946Open in IMG/M
3300027907|Ga0207428_10844824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300028379|Ga0268266_12133787Not Available533Open in IMG/M
3300028380|Ga0268265_10865810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium885Open in IMG/M
3300028380|Ga0268265_12195171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300028589|Ga0247818_10164971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1448Open in IMG/M
3300028589|Ga0247818_10530079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300028597|Ga0247820_11043746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300028711|Ga0307293_10098172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria929Open in IMG/M
3300028722|Ga0307319_10031978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1631Open in IMG/M
3300028722|Ga0307319_10196393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300028722|Ga0307319_10235183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300028744|Ga0307318_10301872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300028744|Ga0307318_10305968Not Available557Open in IMG/M
3300028784|Ga0307282_10195281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300028796|Ga0307287_10199851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium759Open in IMG/M
3300028803|Ga0307281_10133271All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300028807|Ga0307305_10073379All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300028824|Ga0307310_10226303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium891Open in IMG/M
3300028828|Ga0307312_11136385Not Available517Open in IMG/M
3300028878|Ga0307278_10006866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5390Open in IMG/M
3300028881|Ga0307277_10471810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300030600|Ga0247659_1080180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300031058|Ga0308189_10350310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300031114|Ga0308187_10248424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300031731|Ga0307405_11343274Not Available623Open in IMG/M
3300031995|Ga0307409_101302069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300032075|Ga0310890_11470132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300032126|Ga0307415_100040254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3095Open in IMG/M
3300032126|Ga0307415_102297937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300032174|Ga0307470_11058345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300033475|Ga0310811_10230455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2220Open in IMG/M
3300033551|Ga0247830_10131061All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300033551|Ga0247830_10915271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300033551|Ga0247830_11060925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300034113|Ga0364937_099938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300034176|Ga0364931_0299051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.05%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment12.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.27%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.39%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.95%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.46%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.46%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.46%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.98%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.49%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment0.49%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.49%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.49%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.49%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.49%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.49%
FossillEnvironmental → Terrestrial → Soil → Fossil → Unclassified → Fossill0.49%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.49%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.49%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.49%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.49%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010938Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013500Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015170Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020008Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021972Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027032Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030600Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_156701802124908045SoilVTKAGERVTVFAFATVVVAAIVGIAFALGYIVGQLLL
KansclcFeb2_164186702124908045SoilVTKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL
ICCgaii200_110910532228664021SoilVTKAGERLTVFAFAAVVVATIVGIAFALGYIVGQLLL
F14TC_10356316523300000559SoilVTKAGERVTVFAFATVVVAAIVGIAFALGYIVGQLLL*
JGI10213J12805_1039761243300000858SoilMEKAAEKLSVFAFAALALLVIVGIAFAAGYVVGQLLL*
JGI11643J12802_1169688623300000890SoilCGVTKAGERLTVFAFAAVVVATIVGIAFALGYIVGQLLL*
JGI10216J12902_10431431123300000956SoilLTKAGERITVFAFAAVVVLSIVGVAFAVGYIVGQLLL*
JGI10216J12902_12135959323300000956SoilLTKAGERLSVFAFALVVVATIVGLAFALGYIVGQLLL*
F14TB_10034196023300001431SoilMRGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL*
C688J35102_11954735123300002568SoilMRGRRRKATKAGERLSVFAFAAAAVAAIVGLAFALGYIVGQLLL*
Ga0063356_10510692213300004463Arabidopsis Thaliana RhizosphereLRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL*
Ga0062594_10033830023300005093SoilMRGRRRKATKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL*
Ga0066683_1045623423300005172SoilMRGRRRKVTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0066675_1018890923300005187SoilVRGRRRSATKAGERLSVFVFAGVVVLAIAGLAFAAGYVVGQLLL*
Ga0070683_10002877023300005329Corn RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYIVGQLLL*
Ga0070682_10151169923300005337Corn RhizosphereVRGRRRRRSKAGERLSVFTFAAVVVLTIVGIAFALGYVVGQLLL*
Ga0070674_10009991523300005356Miscanthus RhizosphereVRGRRRRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL*
Ga0070694_10108256323300005444Corn, Switchgrass And Miscanthus RhizosphereVRGRKRTATKAGERLTVFAFAAVVVLTIVGLAFAVGYIIGQLLL*
Ga0073909_1021033523300005526Surface SoilLTKAGERITVFAFAAVVVLTIVGIAFALGYIVGQLLL*
Ga0073909_1053127923300005526Surface SoilLTKAGERFTVFAFAAVVVLSIVGIAFALGYIIGQLLL*
Ga0073909_1062112623300005526Surface SoilVRGRKPGATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL*
Ga0070697_10181593023300005536Corn, Switchgrass And Miscanthus RhizosphereVRGRRRRATKAGERLSVFVFAAVVVLTIVGLAFAVGYVVGQLLL*
Ga0068853_10083042133300005539Corn RhizosphereRLPLSAGGSLRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL*
Ga0066695_1000864143300005553SoilVTKAGERLTVFAFAAVVVATIVGIAFALGYIVGQLLL*
Ga0066707_1013435033300005556SoilVTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0070664_10020706523300005564Corn RhizosphereLTKAGERITVFAFAAIVVASIVGIAFALGYIVGQLLL*
Ga0066703_1076494923300005568SoilVRGRRRRATKAGERLSVFVFAAVVVLMIVGLAFAAGYVVGQLLL*
Ga0068857_10027172713300005577Corn RhizosphereLTKAGERITVFAFAAIVVASIVGVAFALGYIVGQLLL*
Ga0066706_1114825913300005598SoilTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0066905_10006397323300005713Tropical Forest SoilLTKAGERITVFAFAAVVVLSIVGIAFALGYIVGQLLL*
Ga0066905_10066993523300005713Tropical Forest SoilVKGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL*
Ga0066905_10089408723300005713Tropical Forest SoilVTKAGERLSVFAFALVVVGMIVGLAFALGYVVGQLLL*
Ga0066905_10169898323300005713Tropical Forest SoilLTKAGERITVFTFAAFIVLSIVGIAFALGYIVGQLLL*
Ga0068861_10247793923300005719Switchgrass RhizosphereLTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL*
Ga0068862_10036439323300005844Switchgrass RhizosphereVRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL*
Ga0081455_1028287733300005937Tabebuia Heterophylla RhizosphereVRGRRRRRSKFGERLSVFVFAAFVVVTIVGLAFAAGYIVGQLLL*
Ga0081455_1050548623300005937Tabebuia Heterophylla RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVLAIVGLAFAAGYVVGQLLL*
Ga0075365_1016587223300006038Populus EndosphereVRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0066652_10037588123300006046SoilMRGRRGRRTKAGERLTVFAFATLVVLMIVGIAFAAGYVVGQLLL*
Ga0074054_1001152923300006579SoilTLTKAGERITVFAFAALVVLSIVGIAFALGYIVGQLLL*
Ga0074054_1209344823300006579SoilLTKAGERITVFAFAAFVVLLIVGIAFALGYIVGQLLL*
Ga0074049_1318730413300006580SoilLTKAGERITVFAFAALVVLSIVGIAFALGYIVGQLLL*
Ga0074048_1294116923300006581SoilMRGRTRRATKAGERLSVFVFAGVVVLTIVGLAFAAGYVVGQLLL*
Ga0066665_1034528823300006796SoilVRGRRRSATKAGERLSVFVFAGVVVLAIVGLAFAAGYVVGQLLL*
Ga0066660_1015916023300006800SoilVRGRRRRATKSGERLSVFVFAAVVVLAIVGLAFAAGYVVGQLLL*
Ga0075428_10065504423300006844Populus RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYIVGQLLL*
Ga0075428_10242170913300006844Populus RhizosphereVRGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL*
Ga0075433_1096073223300006852Populus RhizosphereVTKAGERLTVFAFAAVVVATIVGLAFALGYIVGQLLL*
Ga0075425_10028752533300006854Populus RhizosphereLTKAGERISVFAFAAVVVLSIVGIAFALGYIVGQLLL*
Ga0079218_1348578113300007004Agricultural SoilSRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0075435_10105836313300007076Populus RhizosphereRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL*
Ga0066710_10055189343300009012Grasslands SoilVRGRRQRATKAGERLSVFVFAGVVVLAIVGLAFAAGYVVGQLLL
Ga0066710_10389449723300009012Grasslands SoilAGRSRHPTERRTMEKPSARLSVFAFAAIIVLGFVGLAFAAGYVVGKLLL
Ga0105245_1105717823300009098Miscanthus RhizosphereMRGRRRKATKAGERLSVFAFAAVAVAAIVGLAFALGYIVGQLLL*
Ga0075418_1049000313300009100Populus RhizosphereLSPGGSLLVRGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL*
Ga0114129_1143732323300009147Populus RhizosphereVRGRRRSTTKAGGRLSVFAFAAVVVLTIVGLAFAAGYIVGQLLL*
Ga0114129_1154172213300009147Populus RhizosphereRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0105243_1016161923300009148Miscanthus RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL*
Ga0105243_1024092643300009148Miscanthus RhizosphereVRGRRQRRSKAGERLSVFTFAAVVVLTIVGTAFALGYIVGQLLL*
Ga0105242_1075486013300009176Miscanthus RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVLTIVGVAFALGYIVGQLL
Ga0105242_1159445223300009176Miscanthus RhizosphereARGRRCRLTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL*
Ga0126313_1084632723300009840Serpentine SoilVTKAGERLTVFAFAAVVVLSIVGIAFALGYIVGQLLL*
Ga0126313_1135561523300009840Serpentine SoilMRGRRRRVTKVVDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL*
Ga0126304_1010236623300010037Serpentine SoilMRGRHRRRSKASERLSVFAFAAVVVLTIVGLAFAVGYIVGQLLL*
Ga0126304_1058737723300010037Serpentine SoilVRGRRRRRSKAGERLSVFAFAAAVVLTIVGLAFAVGYVVGQLLL*
Ga0126315_1094492123300010038Serpentine SoilMRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0126315_1109990823300010038Serpentine SoilVTKLGERLTVLGFAAAVVGTIVVLAFAAGYVIGRLLL*
Ga0126315_1111765223300010038Serpentine SoilVRGRRRKATKAGERLSVLAFAAVVVATIVGIAFALGYVVGQLLL*
Ga0126309_1038819123300010039Serpentine SoilMTKLAERLTVFAFAAAIVLTIVGLAFAAGYVVGQLLL*
Ga0126309_1050744423300010039Serpentine SoilVRGRRRRATKVGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0126309_1083033923300010039Serpentine SoilMRGRRRRVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL*
Ga0126309_1128463723300010039Serpentine SoilVRGRKRTATKAGGRLTVFAFAAVVVLTIVGLAFAVGYIVGQLLL*
Ga0126380_1125050523300010043Tropical Forest SoilVTKAGERITVFAFAAVVVLSIVGIAFALGYIVGQLLL*
Ga0126306_1096086423300010166Serpentine SoilMRGRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL*
Ga0126376_1004490243300010359Tropical Forest SoilLTKAGERITVFAFAAVVVASIVGIAFALGYIVGQLLL*
Ga0134123_1039308543300010403Terrestrial SoilAGGFLLVRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL*
Ga0137716_1018906033300010938Hot Spring Fe-Si SedimentVAKLGEWLTVLAFAAFVVAAIVGTAFALGYIVGRLLL*
Ga0137312_100401323300011400SoilVRGRRRRRSKAGERLSVFAFAAFVVLTIVGLAFAAGYVVGQLLL*
Ga0137424_108782523300011412SoilVRGRRRGRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0137365_1055963623300012201Vadose Zone SoilVTKAGERLTVFAFAAVVVAAIVGIAFALGYIVGQLLL*
Ga0137374_1002953033300012204Vadose Zone SoilMRGRRRRATKAAERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0137374_1008223813300012204Vadose Zone SoilLPARGSPLVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0137374_1010921733300012204Vadose Zone SoilMRGRRRKATKAGERLSVFVFAAVVVLVIVGLAFAAGYVVGQLLL*
Ga0137381_1164368623300012207Vadose Zone SoilVRGRKRTATKAGERLTVFVFAAVVVLTIVGLAFAVGYIVGQLLL*
Ga0137376_1034797043300012208Vadose Zone SoilVRGRRGKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0137376_1119168323300012208Vadose Zone SoilVRGRKRRATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL*
Ga0150985_11446855113300012212Avena Fatua RhizospherePVPMRGRRRKATKAGERLSVFAFAAAAVAAIVGLAFALGYIVGQLLL*
Ga0137372_1008798123300012350Vadose Zone SoilVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0136635_1006910123300012530Polar Desert SandMRGRRRKPTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL*
Ga0157216_1022354023300012668Glacier Forefield SoilMSRIGERLSVFAFAFVVVALIVGSAFAVGYILGKLLL*
Ga0157304_107169723300012882SoilKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL*
Ga0157292_1022711523300012900SoilRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL*
Ga0137396_1105577123300012918Vadose Zone SoilVKGRTRRTTKAGERLSVFVFAAVVVLMIVGLAFAAGYVVGQLLL*
Ga0164299_1032947623300012958SoilLTKAGERFSVFAFAAVVVLSIVGIAFALGYIIGQLLL*
Ga0164308_1099763923300012985SoilAAGARRPMRRRTMGKTGERRSVFAVAGVVVVAIVGLAFAAGYVVGKILL*
Ga0120195_101500423300013500TerrestrialVRGRRRRRSKAGERLSVFAFAAIVVLTIVGLAFAAGYIVGQLLL*
Ga0163163_1232643923300014325Switchgrass RhizosphereCALTKAGERITVFAFAAIVVASIVGVAFALGYIVGQLLL*
Ga0157380_1020745323300014326Switchgrass RhizosphereVRGRRQRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL*
Ga0120193_1010530813300014965TerrestrialSTSLPTSRSAGRRRGAPKLVERLSVFAFAAAVLLTIVGLAFAAGYVVGQLLL*
Ga0120098_102207723300015170FossillVTKLGERLTVLAFATAVVGTIVGLAFAAGYVIGKLLL*
Ga0173478_1006014743300015201SoilLVRGRKRTATKAGERLTVFAFAAVVVLTIVGLAFAVGYIIGQLLL*
Ga0132258_1123628643300015371Arabidopsis RhizosphereLTKAGERITVFAFASLVVLSIVGVAFALGYIIGQLLL*
Ga0132258_1200458623300015371Arabidopsis RhizosphereLTKAGERISVFAFAALVVAAIVGSAFALGYIIGQLLL*
Ga0134083_1005579323300017659Grasslands SoilVTKAGERLPVIAFAAVVVATIVGIAFALGYIVGQLLL
Ga0184610_117494023300017997Groundwater SedimentVRGRRRRATKAGERLSVFVFAAVVVMTIVGLAFAAGYVVGQLLL
Ga0184610_118767023300017997Groundwater SedimentVGKVGERVTVLAFAAGVIVVIVGVAFALGYIVGKLLI
Ga0184605_1001405523300018027Groundwater SedimentVRGRRGKATKAGERLSVFAFAAVVVLTIVGLAFAVGYIVGQLLL
Ga0184605_1004712743300018027Groundwater SedimentAGGSVLVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0184605_1010840623300018027Groundwater SedimentVRGRSRKATKAGERLSVFVFAAVVVLTIVGLAFAVGYIVGQLLL
Ga0184608_1005775233300018028Groundwater SedimentLTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL
Ga0184620_1002915123300018051Groundwater SedimentVRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL
Ga0184638_120075423300018052Groundwater SedimentMRGRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0184621_1007981533300018054Groundwater SedimentMRGRGRRVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0184623_1007146943300018056Groundwater SedimentVGKVGERVTVLAFAAGVIVVIVGVAFALGYIVGKLLL
Ga0184623_1007297323300018056Groundwater SedimentLRGRRRRATKAGGRLSVFVFAGVVVLTIVGLAFAAGYIVGQLLL
Ga0184619_1000119273300018061Groundwater SedimentVRGRRRRATKVGERLSVFVLAAVVVLTIVGLAFAAGYVVGQLLL
Ga0184619_1009641723300018061Groundwater SedimentVRGRSRKATKAGERLSVFVFAAVVVLTIIGLAFAVGYIVGQLLL
Ga0184619_1017454923300018061Groundwater SedimentVRGRRRRATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0184619_1053957413300018061Groundwater SedimentMRGRRRKATKAGERLSVFVFAGVVVLMIVGLAFAAGYIVGQLLL
Ga0184618_1024589723300018071Groundwater SedimentVSGRRRGATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0184618_1033385623300018071Groundwater SedimentVRGRKRGATKAGERLTVFAFAAVVVLTIVGLAFAVGYIVGQLLL
Ga0184635_1001787733300018072Groundwater SedimentLTKAGERISVFAFAAVVVLSIVGIAFVLGYIIGQLLL
Ga0184635_1008050523300018072Groundwater SedimentVTKAGERLTVFAFAAVVVATIVGLAFALGYIVGQLLL
Ga0184635_1030914223300018072Groundwater SedimentVRGRRRKATKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL
Ga0184624_1004055323300018073Groundwater SedimentVRGRRRRTSKAGERLSVFAFAAVVVLTIVGIAFALGYIVGQLLL
Ga0184632_1022718823300018075Groundwater SedimentMRGRGRKVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0184609_1024159523300018076Groundwater SedimentVRGRKHGATKAGERLTVFAFAAVVVLTIVGLAFAVGYIVGQLLL
Ga0184612_1022140023300018078Groundwater SedimentLRGRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0184639_1048983623300018082Groundwater SedimentHRLALSSGGSLLLRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0066667_1060715923300018433Grasslands SoilVRGRRRSATKAGERLSVFVFAGVVVLAIAGLAFAAGYVVGQLLL
Ga0190268_1092368823300018466SoilMRGRGRKVTKAADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0190268_1136012723300018466SoilVRGRRRKRSKAGERLSVFAFAAIVVLTIVVLAFAAGYIVGQLLL
Ga0190274_1178101823300018476SoilVRGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL
Ga0184643_126936233300019255Groundwater SedimentVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0173481_1005299123300019356SoilVRGRKRTATKAGERLTVFAFAAVVVLTIVGLAFAVGYIIGQLLL
Ga0173481_1082778023300019356SoilVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL
Ga0173482_1022545913300019361SoilKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL
Ga0190267_1148146813300019767SoilVRGRRRRRSKAGERLSVFAFAAIVVLTIVGLAFAAGYIVGQLLL
Ga0193705_108548013300019869SoilVRGRRRRTSKAGERLSVFAFAAVVVLTIVGIAFALGYIVGQLL
Ga0193701_108330223300019875SoilMRGRRRKATKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL
Ga0193741_100694523300019884SoilVRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0193731_109779823300020001SoilVRGRKRGATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL
Ga0193757_102694013300020008SoilRIPLPARGSLLVRGRKRGATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL
Ga0193738_101877723300020020SoilVRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYIVGQLLL
Ga0210378_1016321013300021073Groundwater SedimentRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0210378_1028142623300021073Groundwater SedimentLRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0193695_1000011473300021418SoilVRGRERGATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL
Ga0182009_1048853013300021445SoilPLSAGGSLRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL
Ga0222621_104937223300021510Groundwater SedimentLTKAGERISVFAFAAVVVLSIVGIAFALGYIIGQLLL
Ga0193737_105897023300021972SoilMRGRGRRVTKVTDRLSVFALAAVVVLAIVGLAFAAGYLVGQLLL
Ga0222623_1015157213300022694Groundwater SedimentGSVLVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0222623_1028783523300022694Groundwater SedimentVRGRKRTATKAGERLTVFAFAAVVVLMIVGLAFAVG
Ga0247795_102235213300022899SoilATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL
Ga0247752_107795223300023071SoilTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL
Ga0179591_100668243300024347Vadose Zone SoilLTKAGERITVFAFAAVVVLSIVGIAFALGYIVGQLLL
Ga0207660_1109497123300025917Corn RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL
Ga0207649_1040989923300025920Corn RhizosphereLTKAGERITVFAFAAIVVASIVGIAFALGYIVGQLLL
Ga0207686_1097561823300025934Miscanthus RhizosphereRARGRRCRLTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL
Ga0207686_1098616123300025934Miscanthus RhizosphereVRGRRRGRSKAGERLSVFAFAAVVVLTIVGTAFALGYIVGQLLL
Ga0207709_1006793823300025935Miscanthus RhizosphereVRGRRQRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL
Ga0207669_1140553023300025937Miscanthus RhizosphereVRGRRQRRSKAGERLSVFTFAAVVVLTIVGTAFALGYIVGQLLL
Ga0207689_1113315823300025942Miscanthus RhizosphereRLPLSAGGSLRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL
Ga0207661_1020599643300025944Corn RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYIVGQLLL
Ga0207648_1091988323300026089Miscanthus RhizosphereVRGRRRRRSKAGERLSVFTFAAVVVLTIVGTAFALGYIVGQLLL
Ga0209468_109946133300026306SoilPVTKAGERLTVFAFAAVVVATIVGIAFALGYIVGQLLL
Ga0209056_1005528053300026538SoilVKGRRRRATKAGERLSVFVFAGVVVLAIVGLAFAAGYVVGQLLL
Ga0209577_1011785423300026552SoilVRGRRRRATKSGERLSVFVFAAVVVLAIVGLAFAAGYVVGQLLL
Ga0209877_102953123300027032Groundwater SandVRGRRRRRSKAGERLSVFAFATVVVLTIVGLAFAAGYIVGQLLL
Ga0209220_106785723300027587Forest SoilVRGRRRKATKAGERLSVFVFAGVVVLTIVGLAFAAGYVVGQLLL
Ga0207428_1084482423300027907Populus RhizosphereRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL
Ga0268266_1213378723300028379Switchgrass RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFAFGYVVGQLLL
Ga0268265_1086581033300028380Switchgrass RhizosphereMRGRRRKATKAGERLSVFAFAAVAVAAIVGLAFALGYIVGQLLL
Ga0268265_1219517123300028380Switchgrass RhizosphereHRLPLFAGGFLLVRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL
Ga0247818_1016497123300028589SoilVRGGRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0247818_1053007923300028589SoilVGKVGERITVFAFAGGVIAAIVGAAFALGYIVGKLLL
Ga0247820_1104374613300028597SoilVGKVGERITVLAFAGGVIVAIVGAAFALGYIVGKLLL
Ga0307293_1009817223300028711SoilVRGRRRRATKVGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0307319_1003197843300028722SoilRVRKVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0307319_1019639323300028722SoilVRPTRRRTMRKLGERLSVFAFAAFVLGAIVGLAFAAGYIVGQLLL
Ga0307319_1023518313300028722SoilVRGRKRTATKAGERLTVFAFAAVVVLMIVGLAFAVGYIVGQLLL
Ga0307318_1030187223300028744SoilPVPMRGRRRKATKAGERLSVFAFAAVVVAAIVGLAFALGYIVGQLLL
Ga0307318_1030596823300028744SoilMRGRRRKATKAGERLSVFAFAAVVVAAIVGLAFALGYIVG
Ga0307282_1019528123300028784SoilVRGRRRGATKVGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0307287_1019985123300028796SoilKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0307281_1013327133300028803SoilRLTKAGERISVFAFAAVVVLSIVGIAFVLGYIIGQLLL
Ga0307305_1007337933300028807SoilVRGRKSTATKAGERLTVFAFAAVVVLTIVGLAFAVGYIVGQLLL
Ga0307310_1022630323300028824SoilVRGRTRRATKAGERLTVFAFAAFVVLTIVGLAFAVGYIVGQLLL
Ga0307312_1113638523300028828SoilVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVV
Ga0307278_1000686633300028878SoilVTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0307277_1047181013300028881SoilPGSRHRLPLSAGGSVLVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0247659_108018013300030600SoilPLSSGGSLPLRGRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0308189_1035031013300031058SoilRARGRRCRFTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL
Ga0308187_1024842423300031114SoilGSLPMRGRGRRVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL
Ga0307405_1134327423300031731RhizosphereVRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAVGYVVGQLLL
Ga0307409_10130206913300031995RhizosphereRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0310890_1147013223300032075SoilVRGRRRRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL
Ga0307415_10004025423300032126RhizosphereMRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL
Ga0307415_10229793723300032126RhizosphereLPTSNRPTRRTTMRKLGEKLSVFAFAAFVLGTIVGLAFAAGYIVGQLLL
Ga0307470_1105834523300032174Hardwood Forest SoilLTKAGERITVFAFATVVVLSIVGIAFALGYIIGQLLL
Ga0310811_1023045553300033475SoilLRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL
Ga0247830_1013106143300033551SoilVGKVGERITVFAFAGGVIVAIVGAAFALGYIVGKLLL
Ga0247830_1091527123300033551SoilVTKAGERLTVFAFAAVVVAMIVGLAFALGYIVGQLLL
Ga0247830_1106092513300033551SoilVGKVVERITVFAFAGGVIVAIVGAAFALGYIVGKLLL
Ga0364937_099938_375_5093300034113SedimentVRGRSRTATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGELLL
Ga0364931_0299051_71_1843300034176SedimentVGKVGERVTVLVFAAGVIVVIVGVAFALGYIVGKLLI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.