Basic Information | |
---|---|
Family ID | F024677 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 205 |
Average Sequence Length | 42 residues |
Representative Sequence | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYIVGQLLL |
Number of Associated Samples | 157 |
Number of Associated Scaffolds | 205 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 73.17 % |
% of genes near scaffold ends (potentially truncated) | 26.34 % |
% of genes from short scaffolds (< 2000 bps) | 88.78 % |
Associated GOLD sequencing projects | 148 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.244 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.049 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.756 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.951 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 205 Family Scaffolds |
---|---|---|
PF12773 | DZR | 22.44 |
PF00334 | NDK | 11.71 |
PF08245 | Mur_ligase_M | 7.80 |
PF10458 | Val_tRNA-synt_C | 4.39 |
PF08241 | Methyltransf_11 | 1.95 |
PF02545 | Maf | 1.46 |
PF05545 | FixQ | 0.49 |
PF07690 | MFS_1 | 0.49 |
PF00795 | CN_hydrolase | 0.49 |
PF07676 | PD40 | 0.49 |
PF06723 | MreB_Mbl | 0.49 |
PF14264 | Glucos_trans_II | 0.49 |
COG ID | Name | Functional Category | % Frequency in 205 Family Scaffolds |
---|---|---|---|
COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 11.71 |
COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.46 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.49 |
COG4736 | Cbb3-type cytochrome oxidase, subunit 3 | Energy production and conversion [C] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.24 % |
Unclassified | root | N/A | 9.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig520942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 800 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig528982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
2228664021|ICCgaii200_c1109105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1378 | Open in IMG/M |
3300000559|F14TC_103563165 | Not Available | 522 | Open in IMG/M |
3300000858|JGI10213J12805_10397612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1658 | Open in IMG/M |
3300000890|JGI11643J12802_11696886 | Not Available | 603 | Open in IMG/M |
3300000956|JGI10216J12902_104314311 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300000956|JGI10216J12902_121359593 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300001431|F14TB_100341960 | Not Available | 572 | Open in IMG/M |
3300002568|C688J35102_119547351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
3300004463|Ga0063356_105106922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300005093|Ga0062594_100338300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
3300005172|Ga0066683_10456234 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300005187|Ga0066675_10188909 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300005329|Ga0070683_100028770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5025 | Open in IMG/M |
3300005337|Ga0070682_101511699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
3300005356|Ga0070674_100099915 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
3300005444|Ga0070694_101082563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300005526|Ga0073909_10210335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
3300005526|Ga0073909_10531279 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005526|Ga0073909_10621126 | Not Available | 535 | Open in IMG/M |
3300005536|Ga0070697_101815930 | Not Available | 545 | Open in IMG/M |
3300005539|Ga0068853_100830421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 886 | Open in IMG/M |
3300005553|Ga0066695_10008641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5182 | Open in IMG/M |
3300005556|Ga0066707_10134350 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300005564|Ga0070664_100207065 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
3300005568|Ga0066703_10764949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300005577|Ga0068857_100271727 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300005598|Ga0066706_11148259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
3300005713|Ga0066905_100063973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2330 | Open in IMG/M |
3300005713|Ga0066905_100669935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 887 | Open in IMG/M |
3300005713|Ga0066905_100894087 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300005713|Ga0066905_101698983 | Not Available | 580 | Open in IMG/M |
3300005719|Ga0068861_102477939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300005844|Ga0068862_100364393 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300005937|Ga0081455_10282877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
3300005937|Ga0081455_10505486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
3300006038|Ga0075365_10165872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1541 | Open in IMG/M |
3300006046|Ga0066652_100375881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1287 | Open in IMG/M |
3300006579|Ga0074054_10011529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300006579|Ga0074054_12093448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
3300006580|Ga0074049_13187304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
3300006581|Ga0074048_12941169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
3300006796|Ga0066665_10345288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1212 | Open in IMG/M |
3300006800|Ga0066660_10159160 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300006844|Ga0075428_100655044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1120 | Open in IMG/M |
3300006844|Ga0075428_102421709 | Not Available | 539 | Open in IMG/M |
3300006852|Ga0075433_10960732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
3300006854|Ga0075425_100287525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1892 | Open in IMG/M |
3300007004|Ga0079218_13485781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
3300007076|Ga0075435_101058363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
3300009012|Ga0066710_100551893 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300009012|Ga0066710_103894497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
3300009098|Ga0105245_11057178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
3300009100|Ga0075418_10490003 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300009147|Ga0114129_11437323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 850 | Open in IMG/M |
3300009147|Ga0114129_11541722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
3300009148|Ga0105243_10161619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1932 | Open in IMG/M |
3300009148|Ga0105243_10240926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1609 | Open in IMG/M |
3300009176|Ga0105242_10754860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
3300009176|Ga0105242_11594452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
3300009840|Ga0126313_10846327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
3300009840|Ga0126313_11355615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
3300010037|Ga0126304_10102366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1812 | Open in IMG/M |
3300010037|Ga0126304_10587377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
3300010038|Ga0126315_10944921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300010038|Ga0126315_11099908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300010038|Ga0126315_11117652 | Not Available | 533 | Open in IMG/M |
3300010039|Ga0126309_10388191 | Not Available | 832 | Open in IMG/M |
3300010039|Ga0126309_10507444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
3300010039|Ga0126309_10830339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
3300010039|Ga0126309_11284637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300010043|Ga0126380_11250505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300010166|Ga0126306_10960864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
3300010359|Ga0126376_10044902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3092 | Open in IMG/M |
3300010403|Ga0134123_10393085 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300010938|Ga0137716_10189060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
3300011400|Ga0137312_1004013 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300011412|Ga0137424_1087825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300012201|Ga0137365_10559636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 839 | Open in IMG/M |
3300012204|Ga0137374_10029530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6023 | Open in IMG/M |
3300012204|Ga0137374_10082238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3113 | Open in IMG/M |
3300012204|Ga0137374_10109217 | All Organisms → cellular organisms → Bacteria | 2581 | Open in IMG/M |
3300012207|Ga0137381_11643686 | Not Available | 533 | Open in IMG/M |
3300012208|Ga0137376_10347970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1287 | Open in IMG/M |
3300012208|Ga0137376_11191683 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300012212|Ga0150985_114468551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2143 | Open in IMG/M |
3300012350|Ga0137372_10087981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2631 | Open in IMG/M |
3300012530|Ga0136635_10069101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1088 | Open in IMG/M |
3300012668|Ga0157216_10223540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
3300012882|Ga0157304_1071697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
3300012900|Ga0157292_10227115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
3300012918|Ga0137396_11055771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
3300012958|Ga0164299_10329476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 951 | Open in IMG/M |
3300012985|Ga0164308_10997639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
3300013500|Ga0120195_1015004 | Not Available | 629 | Open in IMG/M |
3300014325|Ga0163163_12326439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
3300014326|Ga0157380_10207453 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
3300014965|Ga0120193_10105308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300015170|Ga0120098_1022077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 790 | Open in IMG/M |
3300015201|Ga0173478_10060147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
3300015371|Ga0132258_11236286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1888 | Open in IMG/M |
3300015371|Ga0132258_12004586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1456 | Open in IMG/M |
3300017659|Ga0134083_10055793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1496 | Open in IMG/M |
3300017997|Ga0184610_1174940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
3300017997|Ga0184610_1187670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
3300018027|Ga0184605_10014055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3123 | Open in IMG/M |
3300018027|Ga0184605_10047127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1825 | Open in IMG/M |
3300018027|Ga0184605_10108406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1230 | Open in IMG/M |
3300018028|Ga0184608_10057752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1545 | Open in IMG/M |
3300018051|Ga0184620_10029151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1437 | Open in IMG/M |
3300018052|Ga0184638_1200754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
3300018054|Ga0184621_10079815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
3300018056|Ga0184623_10071469 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300018056|Ga0184623_10072973 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300018061|Ga0184619_10001192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9105 | Open in IMG/M |
3300018061|Ga0184619_10096417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1326 | Open in IMG/M |
3300018061|Ga0184619_10174549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
3300018061|Ga0184619_10539574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
3300018071|Ga0184618_10245897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300018071|Ga0184618_10333856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
3300018072|Ga0184635_10017877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2567 | Open in IMG/M |
3300018072|Ga0184635_10080505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1277 | Open in IMG/M |
3300018072|Ga0184635_10309142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
3300018073|Ga0184624_10040553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1845 | Open in IMG/M |
3300018075|Ga0184632_10227188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
3300018076|Ga0184609_10241595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
3300018078|Ga0184612_10221400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
3300018082|Ga0184639_10489836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
3300018433|Ga0066667_10607159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
3300018466|Ga0190268_10923688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300018466|Ga0190268_11360127 | Not Available | 604 | Open in IMG/M |
3300018476|Ga0190274_11781018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
3300019255|Ga0184643_1269362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1046 | Open in IMG/M |
3300019356|Ga0173481_10052991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1404 | Open in IMG/M |
3300019356|Ga0173481_10827780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300019361|Ga0173482_10225459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
3300019767|Ga0190267_11481468 | Not Available | 521 | Open in IMG/M |
3300019869|Ga0193705_1085480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
3300019875|Ga0193701_1083302 | Not Available | 616 | Open in IMG/M |
3300019884|Ga0193741_1006945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3008 | Open in IMG/M |
3300020001|Ga0193731_1097798 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300020008|Ga0193757_1026940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
3300020020|Ga0193738_1018777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2191 | Open in IMG/M |
3300021073|Ga0210378_10163210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
3300021073|Ga0210378_10281426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
3300021418|Ga0193695_1000011 | All Organisms → cellular organisms → Bacteria | 102131 | Open in IMG/M |
3300021445|Ga0182009_10488530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
3300021510|Ga0222621_1049372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 881 | Open in IMG/M |
3300021972|Ga0193737_1058970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300022694|Ga0222623_10151572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
3300022694|Ga0222623_10287835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
3300022899|Ga0247795_1022352 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300023071|Ga0247752_1077952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
3300024347|Ga0179591_1006682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3138 | Open in IMG/M |
3300025917|Ga0207660_11094971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
3300025920|Ga0207649_10409899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
3300025934|Ga0207686_10975618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
3300025934|Ga0207686_10986161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300025935|Ga0207709_10067938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2251 | Open in IMG/M |
3300025937|Ga0207669_11405530 | Not Available | 594 | Open in IMG/M |
3300025942|Ga0207689_11133158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
3300025944|Ga0207661_10205996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1731 | Open in IMG/M |
3300026089|Ga0207648_10919883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
3300026306|Ga0209468_1099461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 937 | Open in IMG/M |
3300026538|Ga0209056_10055280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3518 | Open in IMG/M |
3300026552|Ga0209577_10117854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2129 | Open in IMG/M |
3300027032|Ga0209877_1029531 | Not Available | 546 | Open in IMG/M |
3300027587|Ga0209220_1067857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 946 | Open in IMG/M |
3300027907|Ga0207428_10844824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
3300028379|Ga0268266_12133787 | Not Available | 533 | Open in IMG/M |
3300028380|Ga0268265_10865810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 885 | Open in IMG/M |
3300028380|Ga0268265_12195171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
3300028589|Ga0247818_10164971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1448 | Open in IMG/M |
3300028589|Ga0247818_10530079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
3300028597|Ga0247820_11043746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300028711|Ga0307293_10098172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
3300028722|Ga0307319_10031978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1631 | Open in IMG/M |
3300028722|Ga0307319_10196393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
3300028722|Ga0307319_10235183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300028744|Ga0307318_10301872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300028744|Ga0307318_10305968 | Not Available | 557 | Open in IMG/M |
3300028784|Ga0307282_10195281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
3300028796|Ga0307287_10199851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
3300028803|Ga0307281_10133271 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300028807|Ga0307305_10073379 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300028824|Ga0307310_10226303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
3300028828|Ga0307312_11136385 | Not Available | 517 | Open in IMG/M |
3300028878|Ga0307278_10006866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5390 | Open in IMG/M |
3300028881|Ga0307277_10471810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
3300030600|Ga0247659_1080180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
3300031058|Ga0308189_10350310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300031114|Ga0308187_10248424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
3300031731|Ga0307405_11343274 | Not Available | 623 | Open in IMG/M |
3300031995|Ga0307409_101302069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
3300032075|Ga0310890_11470132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
3300032126|Ga0307415_100040254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3095 | Open in IMG/M |
3300032126|Ga0307415_102297937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300032174|Ga0307470_11058345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
3300033475|Ga0310811_10230455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2220 | Open in IMG/M |
3300033551|Ga0247830_10131061 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
3300033551|Ga0247830_10915271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
3300033551|Ga0247830_11060925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300034113|Ga0364937_099938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
3300034176|Ga0364931_0299051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.05% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 12.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.27% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.39% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.95% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.95% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.95% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.46% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.46% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.46% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.49% |
Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.49% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.49% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.49% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.49% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.49% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.49% |
Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.49% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.49% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.49% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030600 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_15670180 | 2124908045 | Soil | VTKAGERVTVFAFATVVVAAIVGIAFALGYIVGQLLL |
KansclcFeb2_16418670 | 2124908045 | Soil | VTKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL |
ICCgaii200_11091053 | 2228664021 | Soil | VTKAGERLTVFAFAAVVVATIVGIAFALGYIVGQLLL |
F14TC_1035631652 | 3300000559 | Soil | VTKAGERVTVFAFATVVVAAIVGIAFALGYIVGQLLL* |
JGI10213J12805_103976124 | 3300000858 | Soil | MEKAAEKLSVFAFAALALLVIVGIAFAAGYVVGQLLL* |
JGI11643J12802_116968862 | 3300000890 | Soil | CGVTKAGERLTVFAFAAVVVATIVGIAFALGYIVGQLLL* |
JGI10216J12902_1043143112 | 3300000956 | Soil | LTKAGERITVFAFAAVVVLSIVGVAFAVGYIVGQLLL* |
JGI10216J12902_1213595932 | 3300000956 | Soil | LTKAGERLSVFAFALVVVATIVGLAFALGYIVGQLLL* |
F14TB_1003419602 | 3300001431 | Soil | MRGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL* |
C688J35102_1195473512 | 3300002568 | Soil | MRGRRRKATKAGERLSVFAFAAAAVAAIVGLAFALGYIVGQLLL* |
Ga0063356_1051069221 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL* |
Ga0062594_1003383002 | 3300005093 | Soil | MRGRRRKATKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL* |
Ga0066683_104562342 | 3300005172 | Soil | MRGRRRKVTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0066675_101889092 | 3300005187 | Soil | VRGRRRSATKAGERLSVFVFAGVVVLAIAGLAFAAGYVVGQLLL* |
Ga0070683_1000287702 | 3300005329 | Corn Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYIVGQLLL* |
Ga0070682_1015116992 | 3300005337 | Corn Rhizosphere | VRGRRRRRSKAGERLSVFTFAAVVVLTIVGIAFALGYVVGQLLL* |
Ga0070674_1000999152 | 3300005356 | Miscanthus Rhizosphere | VRGRRRRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL* |
Ga0070694_1010825632 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGRKRTATKAGERLTVFAFAAVVVLTIVGLAFAVGYIIGQLLL* |
Ga0073909_102103352 | 3300005526 | Surface Soil | LTKAGERITVFAFAAVVVLTIVGIAFALGYIVGQLLL* |
Ga0073909_105312792 | 3300005526 | Surface Soil | LTKAGERFTVFAFAAVVVLSIVGIAFALGYIIGQLLL* |
Ga0073909_106211262 | 3300005526 | Surface Soil | VRGRKPGATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL* |
Ga0070697_1018159302 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGRRRRATKAGERLSVFVFAAVVVLTIVGLAFAVGYVVGQLLL* |
Ga0068853_1008304213 | 3300005539 | Corn Rhizosphere | RLPLSAGGSLRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL* |
Ga0066695_100086414 | 3300005553 | Soil | VTKAGERLTVFAFAAVVVATIVGIAFALGYIVGQLLL* |
Ga0066707_101343503 | 3300005556 | Soil | VTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0070664_1002070652 | 3300005564 | Corn Rhizosphere | LTKAGERITVFAFAAIVVASIVGIAFALGYIVGQLLL* |
Ga0066703_107649492 | 3300005568 | Soil | VRGRRRRATKAGERLSVFVFAAVVVLMIVGLAFAAGYVVGQLLL* |
Ga0068857_1002717271 | 3300005577 | Corn Rhizosphere | LTKAGERITVFAFAAIVVASIVGVAFALGYIVGQLLL* |
Ga0066706_111482591 | 3300005598 | Soil | TKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0066905_1000639732 | 3300005713 | Tropical Forest Soil | LTKAGERITVFAFAAVVVLSIVGIAFALGYIVGQLLL* |
Ga0066905_1006699352 | 3300005713 | Tropical Forest Soil | VKGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL* |
Ga0066905_1008940872 | 3300005713 | Tropical Forest Soil | VTKAGERLSVFAFALVVVGMIVGLAFALGYVVGQLLL* |
Ga0066905_1016989832 | 3300005713 | Tropical Forest Soil | LTKAGERITVFTFAAFIVLSIVGIAFALGYIVGQLLL* |
Ga0068861_1024779392 | 3300005719 | Switchgrass Rhizosphere | LTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL* |
Ga0068862_1003643932 | 3300005844 | Switchgrass Rhizosphere | VRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL* |
Ga0081455_102828773 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VRGRRRRRSKFGERLSVFVFAAFVVVTIVGLAFAAGYIVGQLLL* |
Ga0081455_105054862 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVLAIVGLAFAAGYVVGQLLL* |
Ga0075365_101658722 | 3300006038 | Populus Endosphere | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0066652_1003758812 | 3300006046 | Soil | MRGRRGRRTKAGERLTVFAFATLVVLMIVGIAFAAGYVVGQLLL* |
Ga0074054_100115292 | 3300006579 | Soil | TLTKAGERITVFAFAALVVLSIVGIAFALGYIVGQLLL* |
Ga0074054_120934482 | 3300006579 | Soil | LTKAGERITVFAFAAFVVLLIVGIAFALGYIVGQLLL* |
Ga0074049_131873041 | 3300006580 | Soil | LTKAGERITVFAFAALVVLSIVGIAFALGYIVGQLLL* |
Ga0074048_129411692 | 3300006581 | Soil | MRGRTRRATKAGERLSVFVFAGVVVLTIVGLAFAAGYVVGQLLL* |
Ga0066665_103452882 | 3300006796 | Soil | VRGRRRSATKAGERLSVFVFAGVVVLAIVGLAFAAGYVVGQLLL* |
Ga0066660_101591602 | 3300006800 | Soil | VRGRRRRATKSGERLSVFVFAAVVVLAIVGLAFAAGYVVGQLLL* |
Ga0075428_1006550442 | 3300006844 | Populus Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYIVGQLLL* |
Ga0075428_1024217091 | 3300006844 | Populus Rhizosphere | VRGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL* |
Ga0075433_109607322 | 3300006852 | Populus Rhizosphere | VTKAGERLTVFAFAAVVVATIVGLAFALGYIVGQLLL* |
Ga0075425_1002875253 | 3300006854 | Populus Rhizosphere | LTKAGERISVFAFAAVVVLSIVGIAFALGYIVGQLLL* |
Ga0079218_134857811 | 3300007004 | Agricultural Soil | SRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0075435_1010583631 | 3300007076 | Populus Rhizosphere | RRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL* |
Ga0066710_1005518934 | 3300009012 | Grasslands Soil | VRGRRQRATKAGERLSVFVFAGVVVLAIVGLAFAAGYVVGQLLL |
Ga0066710_1038944972 | 3300009012 | Grasslands Soil | AGRSRHPTERRTMEKPSARLSVFAFAAIIVLGFVGLAFAAGYVVGKLLL |
Ga0105245_110571782 | 3300009098 | Miscanthus Rhizosphere | MRGRRRKATKAGERLSVFAFAAVAVAAIVGLAFALGYIVGQLLL* |
Ga0075418_104900031 | 3300009100 | Populus Rhizosphere | LSPGGSLLVRGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL* |
Ga0114129_114373232 | 3300009147 | Populus Rhizosphere | VRGRRRSTTKAGGRLSVFAFAAVVVLTIVGLAFAAGYIVGQLLL* |
Ga0114129_115417221 | 3300009147 | Populus Rhizosphere | RSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0105243_101616192 | 3300009148 | Miscanthus Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL* |
Ga0105243_102409264 | 3300009148 | Miscanthus Rhizosphere | VRGRRQRRSKAGERLSVFTFAAVVVLTIVGTAFALGYIVGQLLL* |
Ga0105242_107548601 | 3300009176 | Miscanthus Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGVAFALGYIVGQLL |
Ga0105242_115944522 | 3300009176 | Miscanthus Rhizosphere | ARGRRCRLTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL* |
Ga0126313_108463272 | 3300009840 | Serpentine Soil | VTKAGERLTVFAFAAVVVLSIVGIAFALGYIVGQLLL* |
Ga0126313_113556152 | 3300009840 | Serpentine Soil | MRGRRRRVTKVVDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL* |
Ga0126304_101023662 | 3300010037 | Serpentine Soil | MRGRHRRRSKASERLSVFAFAAVVVLTIVGLAFAVGYIVGQLLL* |
Ga0126304_105873772 | 3300010037 | Serpentine Soil | VRGRRRRRSKAGERLSVFAFAAAVVLTIVGLAFAVGYVVGQLLL* |
Ga0126315_109449212 | 3300010038 | Serpentine Soil | MRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0126315_110999082 | 3300010038 | Serpentine Soil | VTKLGERLTVLGFAAAVVGTIVVLAFAAGYVIGRLLL* |
Ga0126315_111176522 | 3300010038 | Serpentine Soil | VRGRRRKATKAGERLSVLAFAAVVVATIVGIAFALGYVVGQLLL* |
Ga0126309_103881912 | 3300010039 | Serpentine Soil | MTKLAERLTVFAFAAAIVLTIVGLAFAAGYVVGQLLL* |
Ga0126309_105074442 | 3300010039 | Serpentine Soil | VRGRRRRATKVGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0126309_108303392 | 3300010039 | Serpentine Soil | MRGRRRRVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL* |
Ga0126309_112846372 | 3300010039 | Serpentine Soil | VRGRKRTATKAGGRLTVFAFAAVVVLTIVGLAFAVGYIVGQLLL* |
Ga0126380_112505052 | 3300010043 | Tropical Forest Soil | VTKAGERITVFAFAAVVVLSIVGIAFALGYIVGQLLL* |
Ga0126306_109608642 | 3300010166 | Serpentine Soil | MRGRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL* |
Ga0126376_100449024 | 3300010359 | Tropical Forest Soil | LTKAGERITVFAFAAVVVASIVGIAFALGYIVGQLLL* |
Ga0134123_103930854 | 3300010403 | Terrestrial Soil | AGGFLLVRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL* |
Ga0137716_101890603 | 3300010938 | Hot Spring Fe-Si Sediment | VAKLGEWLTVLAFAAFVVAAIVGTAFALGYIVGRLLL* |
Ga0137312_10040132 | 3300011400 | Soil | VRGRRRRRSKAGERLSVFAFAAFVVLTIVGLAFAAGYVVGQLLL* |
Ga0137424_10878252 | 3300011412 | Soil | VRGRRRGRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0137365_105596362 | 3300012201 | Vadose Zone Soil | VTKAGERLTVFAFAAVVVAAIVGIAFALGYIVGQLLL* |
Ga0137374_100295303 | 3300012204 | Vadose Zone Soil | MRGRRRRATKAAERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0137374_100822381 | 3300012204 | Vadose Zone Soil | LPARGSPLVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0137374_101092173 | 3300012204 | Vadose Zone Soil | MRGRRRKATKAGERLSVFVFAAVVVLVIVGLAFAAGYVVGQLLL* |
Ga0137381_116436862 | 3300012207 | Vadose Zone Soil | VRGRKRTATKAGERLTVFVFAAVVVLTIVGLAFAVGYIVGQLLL* |
Ga0137376_103479704 | 3300012208 | Vadose Zone Soil | VRGRRGKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0137376_111916832 | 3300012208 | Vadose Zone Soil | VRGRKRRATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL* |
Ga0150985_1144685511 | 3300012212 | Avena Fatua Rhizosphere | PVPMRGRRRKATKAGERLSVFAFAAAAVAAIVGLAFALGYIVGQLLL* |
Ga0137372_100879812 | 3300012350 | Vadose Zone Soil | VRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0136635_100691012 | 3300012530 | Polar Desert Sand | MRGRRRKPTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL* |
Ga0157216_102235402 | 3300012668 | Glacier Forefield Soil | MSRIGERLSVFAFAFVVVALIVGSAFAVGYILGKLLL* |
Ga0157304_10716972 | 3300012882 | Soil | KAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL* |
Ga0157292_102271152 | 3300012900 | Soil | RGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL* |
Ga0137396_110557712 | 3300012918 | Vadose Zone Soil | VKGRTRRTTKAGERLSVFVFAAVVVLMIVGLAFAAGYVVGQLLL* |
Ga0164299_103294762 | 3300012958 | Soil | LTKAGERFSVFAFAAVVVLSIVGIAFALGYIIGQLLL* |
Ga0164308_109976392 | 3300012985 | Soil | AAGARRPMRRRTMGKTGERRSVFAVAGVVVVAIVGLAFAAGYVVGKILL* |
Ga0120195_10150042 | 3300013500 | Terrestrial | VRGRRRRRSKAGERLSVFAFAAIVVLTIVGLAFAAGYIVGQLLL* |
Ga0163163_123264392 | 3300014325 | Switchgrass Rhizosphere | CALTKAGERITVFAFAAIVVASIVGVAFALGYIVGQLLL* |
Ga0157380_102074532 | 3300014326 | Switchgrass Rhizosphere | VRGRRQRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL* |
Ga0120193_101053081 | 3300014965 | Terrestrial | STSLPTSRSAGRRRGAPKLVERLSVFAFAAAVLLTIVGLAFAAGYVVGQLLL* |
Ga0120098_10220772 | 3300015170 | Fossill | VTKLGERLTVLAFATAVVGTIVGLAFAAGYVIGKLLL* |
Ga0173478_100601474 | 3300015201 | Soil | LVRGRKRTATKAGERLTVFAFAAVVVLTIVGLAFAVGYIIGQLLL* |
Ga0132258_112362864 | 3300015371 | Arabidopsis Rhizosphere | LTKAGERITVFAFASLVVLSIVGVAFALGYIIGQLLL* |
Ga0132258_120045862 | 3300015371 | Arabidopsis Rhizosphere | LTKAGERISVFAFAALVVAAIVGSAFALGYIIGQLLL* |
Ga0134083_100557932 | 3300017659 | Grasslands Soil | VTKAGERLPVIAFAAVVVATIVGIAFALGYIVGQLLL |
Ga0184610_11749402 | 3300017997 | Groundwater Sediment | VRGRRRRATKAGERLSVFVFAAVVVMTIVGLAFAAGYVVGQLLL |
Ga0184610_11876702 | 3300017997 | Groundwater Sediment | VGKVGERVTVLAFAAGVIVVIVGVAFALGYIVGKLLI |
Ga0184605_100140552 | 3300018027 | Groundwater Sediment | VRGRRGKATKAGERLSVFAFAAVVVLTIVGLAFAVGYIVGQLLL |
Ga0184605_100471274 | 3300018027 | Groundwater Sediment | AGGSVLVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0184605_101084062 | 3300018027 | Groundwater Sediment | VRGRSRKATKAGERLSVFVFAAVVVLTIVGLAFAVGYIVGQLLL |
Ga0184608_100577523 | 3300018028 | Groundwater Sediment | LTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL |
Ga0184620_100291512 | 3300018051 | Groundwater Sediment | VRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL |
Ga0184638_12007542 | 3300018052 | Groundwater Sediment | MRGRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0184621_100798153 | 3300018054 | Groundwater Sediment | MRGRGRRVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0184623_100714694 | 3300018056 | Groundwater Sediment | VGKVGERVTVLAFAAGVIVVIVGVAFALGYIVGKLLL |
Ga0184623_100729732 | 3300018056 | Groundwater Sediment | LRGRRRRATKAGGRLSVFVFAGVVVLTIVGLAFAAGYIVGQLLL |
Ga0184619_100011927 | 3300018061 | Groundwater Sediment | VRGRRRRATKVGERLSVFVLAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0184619_100964172 | 3300018061 | Groundwater Sediment | VRGRSRKATKAGERLSVFVFAAVVVLTIIGLAFAVGYIVGQLLL |
Ga0184619_101745492 | 3300018061 | Groundwater Sediment | VRGRRRRATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0184619_105395741 | 3300018061 | Groundwater Sediment | MRGRRRKATKAGERLSVFVFAGVVVLMIVGLAFAAGYIVGQLLL |
Ga0184618_102458972 | 3300018071 | Groundwater Sediment | VSGRRRGATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0184618_103338562 | 3300018071 | Groundwater Sediment | VRGRKRGATKAGERLTVFAFAAVVVLTIVGLAFAVGYIVGQLLL |
Ga0184635_100178773 | 3300018072 | Groundwater Sediment | LTKAGERISVFAFAAVVVLSIVGIAFVLGYIIGQLLL |
Ga0184635_100805052 | 3300018072 | Groundwater Sediment | VTKAGERLTVFAFAAVVVATIVGLAFALGYIVGQLLL |
Ga0184635_103091422 | 3300018072 | Groundwater Sediment | VRGRRRKATKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL |
Ga0184624_100405532 | 3300018073 | Groundwater Sediment | VRGRRRRTSKAGERLSVFAFAAVVVLTIVGIAFALGYIVGQLLL |
Ga0184632_102271882 | 3300018075 | Groundwater Sediment | MRGRGRKVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0184609_102415952 | 3300018076 | Groundwater Sediment | VRGRKHGATKAGERLTVFAFAAVVVLTIVGLAFAVGYIVGQLLL |
Ga0184612_102214002 | 3300018078 | Groundwater Sediment | LRGRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0184639_104898362 | 3300018082 | Groundwater Sediment | HRLALSSGGSLLLRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0066667_106071592 | 3300018433 | Grasslands Soil | VRGRRRSATKAGERLSVFVFAGVVVLAIAGLAFAAGYVVGQLLL |
Ga0190268_109236882 | 3300018466 | Soil | MRGRGRKVTKAADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0190268_113601272 | 3300018466 | Soil | VRGRRRKRSKAGERLSVFAFAAIVVLTIVVLAFAAGYIVGQLLL |
Ga0190274_117810182 | 3300018476 | Soil | VRGRRRRRSKAGERLSVFAFAALVVLTIVGLAFAAGYVVGQLLL |
Ga0184643_12693623 | 3300019255 | Groundwater Sediment | VRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0173481_100529912 | 3300019356 | Soil | VRGRKRTATKAGERLTVFAFAAVVVLTIVGLAFAVGYIIGQLLL |
Ga0173481_108277802 | 3300019356 | Soil | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL |
Ga0173482_102254591 | 3300019361 | Soil | KAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL |
Ga0190267_114814681 | 3300019767 | Soil | VRGRRRRRSKAGERLSVFAFAAIVVLTIVGLAFAAGYIVGQLLL |
Ga0193705_10854801 | 3300019869 | Soil | VRGRRRRTSKAGERLSVFAFAAVVVLTIVGIAFALGYIVGQLL |
Ga0193701_10833022 | 3300019875 | Soil | MRGRRRKATKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL |
Ga0193741_10069452 | 3300019884 | Soil | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0193731_10977982 | 3300020001 | Soil | VRGRKRGATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL |
Ga0193757_10269401 | 3300020008 | Soil | RIPLPARGSLLVRGRKRGATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL |
Ga0193738_10187772 | 3300020020 | Soil | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYIVGQLLL |
Ga0210378_101632101 | 3300021073 | Groundwater Sediment | RGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0210378_102814262 | 3300021073 | Groundwater Sediment | LRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0193695_100001147 | 3300021418 | Soil | VRGRERGATKVGERLTVFAFAAVVLLTIVGLAFAVGYIVGQLLL |
Ga0182009_104885301 | 3300021445 | Soil | PLSAGGSLRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL |
Ga0222621_10493722 | 3300021510 | Groundwater Sediment | LTKAGERISVFAFAAVVVLSIVGIAFALGYIIGQLLL |
Ga0193737_10589702 | 3300021972 | Soil | MRGRGRRVTKVTDRLSVFALAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0222623_101515721 | 3300022694 | Groundwater Sediment | GSVLVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0222623_102878352 | 3300022694 | Groundwater Sediment | VRGRKRTATKAGERLTVFAFAAVVVLMIVGLAFAVG |
Ga0247795_10223521 | 3300022899 | Soil | ATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL |
Ga0247752_10779522 | 3300023071 | Soil | TATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL |
Ga0179591_10066824 | 3300024347 | Vadose Zone Soil | LTKAGERITVFAFAAVVVLSIVGIAFALGYIVGQLLL |
Ga0207660_110949712 | 3300025917 | Corn Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVATIVGLAFALGYIVGQLLL |
Ga0207649_104098992 | 3300025920 | Corn Rhizosphere | LTKAGERITVFAFAAIVVASIVGIAFALGYIVGQLLL |
Ga0207686_109756182 | 3300025934 | Miscanthus Rhizosphere | RARGRRCRLTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL |
Ga0207686_109861612 | 3300025934 | Miscanthus Rhizosphere | VRGRRRGRSKAGERLSVFAFAAVVVLTIVGTAFALGYIVGQLLL |
Ga0207709_100679382 | 3300025935 | Miscanthus Rhizosphere | VRGRRQRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL |
Ga0207669_114055302 | 3300025937 | Miscanthus Rhizosphere | VRGRRQRRSKAGERLSVFTFAAVVVLTIVGTAFALGYIVGQLLL |
Ga0207689_111331582 | 3300025942 | Miscanthus Rhizosphere | RLPLSAGGSLRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL |
Ga0207661_102059964 | 3300025944 | Corn Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYIVGQLLL |
Ga0207648_109198832 | 3300026089 | Miscanthus Rhizosphere | VRGRRRRRSKAGERLSVFTFAAVVVLTIVGTAFALGYIVGQLLL |
Ga0209468_10994613 | 3300026306 | Soil | PVTKAGERLTVFAFAAVVVATIVGIAFALGYIVGQLLL |
Ga0209056_100552805 | 3300026538 | Soil | VKGRRRRATKAGERLSVFVFAGVVVLAIVGLAFAAGYVVGQLLL |
Ga0209577_101178542 | 3300026552 | Soil | VRGRRRRATKSGERLSVFVFAAVVVLAIVGLAFAAGYVVGQLLL |
Ga0209877_10295312 | 3300027032 | Groundwater Sand | VRGRRRRRSKAGERLSVFAFATVVVLTIVGLAFAAGYIVGQLLL |
Ga0209220_10678572 | 3300027587 | Forest Soil | VRGRRRKATKAGERLSVFVFAGVVVLTIVGLAFAAGYVVGQLLL |
Ga0207428_108448242 | 3300027907 | Populus Rhizosphere | RRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL |
Ga0268266_121337872 | 3300028379 | Switchgrass Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFAFGYVVGQLLL |
Ga0268265_108658103 | 3300028380 | Switchgrass Rhizosphere | MRGRRRKATKAGERLSVFAFAAVAVAAIVGLAFALGYIVGQLLL |
Ga0268265_121951712 | 3300028380 | Switchgrass Rhizosphere | HRLPLFAGGFLLVRGRKRTATKAGERLTVFTFAAVVVLMIVGLAFAVGYIVGQLLL |
Ga0247818_101649712 | 3300028589 | Soil | VRGGRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0247818_105300792 | 3300028589 | Soil | VGKVGERITVFAFAGGVIAAIVGAAFALGYIVGKLLL |
Ga0247820_110437461 | 3300028597 | Soil | VGKVGERITVLAFAGGVIVAIVGAAFALGYIVGKLLL |
Ga0307293_100981722 | 3300028711 | Soil | VRGRRRRATKVGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0307319_100319784 | 3300028722 | Soil | RVRKVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0307319_101963932 | 3300028722 | Soil | VRPTRRRTMRKLGERLSVFAFAAFVLGAIVGLAFAAGYIVGQLLL |
Ga0307319_102351831 | 3300028722 | Soil | VRGRKRTATKAGERLTVFAFAAVVVLMIVGLAFAVGYIVGQLLL |
Ga0307318_103018722 | 3300028744 | Soil | PVPMRGRRRKATKAGERLSVFAFAAVVVAAIVGLAFALGYIVGQLLL |
Ga0307318_103059682 | 3300028744 | Soil | MRGRRRKATKAGERLSVFAFAAVVVAAIVGLAFALGYIVG |
Ga0307282_101952812 | 3300028784 | Soil | VRGRRRGATKVGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0307287_101998512 | 3300028796 | Soil | KATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0307281_101332713 | 3300028803 | Soil | RLTKAGERISVFAFAAVVVLSIVGIAFVLGYIIGQLLL |
Ga0307305_100733793 | 3300028807 | Soil | VRGRKSTATKAGERLTVFAFAAVVVLTIVGLAFAVGYIVGQLLL |
Ga0307310_102263032 | 3300028824 | Soil | VRGRTRRATKAGERLTVFAFAAFVVLTIVGLAFAVGYIVGQLLL |
Ga0307312_111363852 | 3300028828 | Soil | VRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVV |
Ga0307278_100068663 | 3300028878 | Soil | VTKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0307277_104718101 | 3300028881 | Soil | PGSRHRLPLSAGGSVLVRGRRRKATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0247659_10801801 | 3300030600 | Soil | PLSSGGSLPLRGRGRRVTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0308189_103503101 | 3300031058 | Soil | RARGRRCRFTKAGERITVFAFAAVVVLSIVGIAFALGYIIGQLLL |
Ga0308187_102484242 | 3300031114 | Soil | GSLPMRGRGRRVTKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
Ga0307405_113432742 | 3300031731 | Rhizosphere | VRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAVGYVVGQLLL |
Ga0307409_1013020691 | 3300031995 | Rhizosphere | RRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0310890_114701322 | 3300032075 | Soil | VRGRRRRRSKAGERLSVFTFAAVVVLTIVGIAFALGYIVGQLLL |
Ga0307415_1000402542 | 3300032126 | Rhizosphere | MRGRRRRRSKAGERLSVFAFAAVVVLTIVGLAFAAGYVVGQLLL |
Ga0307415_1022979372 | 3300032126 | Rhizosphere | LPTSNRPTRRTTMRKLGEKLSVFAFAAFVLGTIVGLAFAAGYIVGQLLL |
Ga0307470_110583452 | 3300032174 | Hardwood Forest Soil | LTKAGERITVFAFATVVVLSIVGIAFALGYIIGQLLL |
Ga0310811_102304555 | 3300033475 | Soil | LRVRGRRRRRSKAGERLSVFAFAAVVVLTIVGIAFALGYVVGQLLL |
Ga0247830_101310614 | 3300033551 | Soil | VGKVGERITVFAFAGGVIVAIVGAAFALGYIVGKLLL |
Ga0247830_109152712 | 3300033551 | Soil | VTKAGERLTVFAFAAVVVAMIVGLAFALGYIVGQLLL |
Ga0247830_110609251 | 3300033551 | Soil | VGKVVERITVFAFAGGVIVAIVGAAFALGYIVGKLLL |
Ga0364937_099938_375_509 | 3300034113 | Sediment | VRGRSRTATKAGERLSVFVFAAVVVLTIVGLAFAAGYVVGELLL |
Ga0364931_0299051_71_184 | 3300034176 | Sediment | VGKVGERVTVLVFAAGVIVVIVGVAFALGYIVGKLLI |
⦗Top⦘ |