Basic Information | |
---|---|
Family ID | F024642 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 205 |
Average Sequence Length | 51 residues |
Representative Sequence | METMIGIAALLVGLGVLWLCFALGVYLFTRTGREGLRIQRMEEERRQHVP |
Number of Associated Samples | 143 |
Number of Associated Scaffolds | 205 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 84.31 % |
% of genes near scaffold ends (potentially truncated) | 19.51 % |
% of genes from short scaffolds (< 2000 bps) | 69.76 % |
Associated GOLD sequencing projects | 127 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.122 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.756 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.537 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.97% β-sheet: 0.00% Coil/Unstructured: 41.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 205 Family Scaffolds |
---|---|---|
PF05988 | DUF899 | 4.39 |
PF01522 | Polysacc_deac_1 | 3.41 |
PF00753 | Lactamase_B | 2.93 |
PF03706 | LPG_synthase_TM | 2.44 |
PF10646 | Germane | 1.95 |
PF00903 | Glyoxalase | 1.95 |
PF02826 | 2-Hacid_dh_C | 1.95 |
PF01061 | ABC2_membrane | 1.95 |
PF03704 | BTAD | 1.95 |
PF00196 | GerE | 1.46 |
PF02371 | Transposase_20 | 1.46 |
PF02656 | DUF202 | 1.46 |
PF07366 | SnoaL | 1.46 |
PF00300 | His_Phos_1 | 1.46 |
PF08281 | Sigma70_r4_2 | 0.98 |
PF10944 | DUF2630 | 0.98 |
PF01641 | SelR | 0.98 |
PF13302 | Acetyltransf_3 | 0.98 |
PF00005 | ABC_tran | 0.98 |
PF09995 | MPAB_Lcp_cat | 0.98 |
PF07676 | PD40 | 0.98 |
PF12681 | Glyoxalase_2 | 0.98 |
PF02518 | HATPase_c | 0.98 |
PF08240 | ADH_N | 0.98 |
PF07690 | MFS_1 | 0.98 |
PF04149 | DUF397 | 0.49 |
PF00106 | adh_short | 0.49 |
PF05547 | Peptidase_M6 | 0.49 |
PF04960 | Glutaminase | 0.49 |
PF02627 | CMD | 0.49 |
PF00582 | Usp | 0.49 |
PF01794 | Ferric_reduct | 0.49 |
PF03816 | LytR_cpsA_psr | 0.49 |
PF03795 | YCII | 0.49 |
PF02608 | Bmp | 0.49 |
PF13857 | Ank_5 | 0.49 |
PF13376 | OmdA | 0.49 |
PF04075 | F420H2_quin_red | 0.49 |
PF09423 | PhoD | 0.49 |
PF01243 | Putative_PNPOx | 0.49 |
PF00486 | Trans_reg_C | 0.49 |
PF12730 | ABC2_membrane_4 | 0.49 |
PF11381 | DUF3185 | 0.49 |
PF03473 | MOSC | 0.49 |
PF04932 | Wzy_C | 0.49 |
PF13449 | Phytase-like | 0.49 |
PF08031 | BBE | 0.49 |
PF07969 | Amidohydro_3 | 0.49 |
PF00144 | Beta-lactamase | 0.49 |
PF00248 | Aldo_ket_red | 0.49 |
PF07995 | GSDH | 0.49 |
PF13185 | GAF_2 | 0.49 |
PF07858 | LEH | 0.49 |
PF01965 | DJ-1_PfpI | 0.49 |
PF00480 | ROK | 0.49 |
PF13936 | HTH_38 | 0.49 |
PF11139 | SfLAP | 0.49 |
PF05958 | tRNA_U5-meth_tr | 0.49 |
PF01872 | RibD_C | 0.49 |
PF03960 | ArsC | 0.49 |
PF12697 | Abhydrolase_6 | 0.49 |
PF01070 | FMN_dh | 0.49 |
PF14025 | DUF4241 | 0.49 |
PF01544 | CorA | 0.49 |
PF13601 | HTH_34 | 0.49 |
PF00857 | Isochorismatase | 0.49 |
PF00689 | Cation_ATPase_C | 0.49 |
PF03109 | ABC1 | 0.49 |
PF09948 | DUF2182 | 0.49 |
PF07040 | DUF1326 | 0.49 |
PF03466 | LysR_substrate | 0.49 |
PF06262 | Zincin_1 | 0.49 |
COG ID | Name | Functional Category | % Frequency in 205 Family Scaffolds |
---|---|---|---|
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 4.39 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 3.41 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 2.44 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 1.95 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 1.95 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 1.46 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.46 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 0.98 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.49 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.49 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.49 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.49 |
COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.49 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.49 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.49 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.49 |
COG1316 | Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase) | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.49 |
COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 0.49 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.49 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.49 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.49 |
COG2066 | Glutaminase | Amino acid transport and metabolism [E] | 0.49 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.49 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.49 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.49 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.49 |
COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG3631 | Ketosteroid isomerase-related protein | General function prediction only [R] | 0.49 |
COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
COG4308 | Limonene-1,2-epoxide hydrolase LimA/EphG | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
COG4412 | Bacillopeptidase F, M6 metalloprotease family | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.49 % |
Unclassified | root | N/A | 39.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2040502000|ACOD_F64RS5002G1VR4 | Not Available | 505 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig505893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7808 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2443314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5559 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_10677234 | Not Available | 502 | Open in IMG/M |
3300000443|F12B_12102060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
3300000559|F14TC_102412660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
3300000858|JGI10213J12805_10179814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1044 | Open in IMG/M |
3300000956|JGI10216J12902_100064765 | Not Available | 507 | Open in IMG/M |
3300000956|JGI10216J12902_100208743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2040 | Open in IMG/M |
3300000956|JGI10216J12902_111188912 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300001431|F14TB_100538931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1813 | Open in IMG/M |
3300003267|soilL1_10168173 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300003659|JGI25404J52841_10048656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
3300003911|JGI25405J52794_10027786 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300003987|Ga0055471_10076818 | Not Available | 949 | Open in IMG/M |
3300003987|Ga0055471_10114197 | Not Available | 801 | Open in IMG/M |
3300003993|Ga0055468_10088572 | Not Available | 856 | Open in IMG/M |
3300003996|Ga0055467_10025741 | Not Available | 1364 | Open in IMG/M |
3300003998|Ga0055472_10242494 | Not Available | 567 | Open in IMG/M |
3300004013|Ga0055465_10054743 | Not Available | 1084 | Open in IMG/M |
3300004013|Ga0055465_10076527 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300004013|Ga0055465_10300738 | Not Available | 552 | Open in IMG/M |
3300004114|Ga0062593_100269714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
3300004156|Ga0062589_100111010 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300004157|Ga0062590_102439101 | Not Available | 553 | Open in IMG/M |
3300004463|Ga0063356_104507208 | Not Available | 599 | Open in IMG/M |
3300004463|Ga0063356_104982525 | Not Available | 571 | Open in IMG/M |
3300004633|Ga0066395_10665759 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
3300005093|Ga0062594_102490214 | Not Available | 568 | Open in IMG/M |
3300005294|Ga0065705_10003474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5789 | Open in IMG/M |
3300005332|Ga0066388_100034345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4857 | Open in IMG/M |
3300005332|Ga0066388_100125083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3104 | Open in IMG/M |
3300005332|Ga0066388_100370285 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
3300005332|Ga0066388_103828522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
3300005332|Ga0066388_107783367 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005345|Ga0070692_10289902 | Not Available | 995 | Open in IMG/M |
3300005457|Ga0070662_100105885 | Not Available | 2135 | Open in IMG/M |
3300005459|Ga0068867_100558164 | Not Available | 993 | Open in IMG/M |
3300005526|Ga0073909_10058050 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300005535|Ga0070684_100041142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3983 | Open in IMG/M |
3300005535|Ga0070684_101792017 | Not Available | 579 | Open in IMG/M |
3300005578|Ga0068854_100101195 | Not Available | 2161 | Open in IMG/M |
3300005616|Ga0068852_102175984 | Not Available | 576 | Open in IMG/M |
3300005713|Ga0066905_100000635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10398 | Open in IMG/M |
3300005713|Ga0066905_100001079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8960 | Open in IMG/M |
3300005713|Ga0066905_100002517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6894 | Open in IMG/M |
3300005713|Ga0066905_100021461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3448 | Open in IMG/M |
3300005713|Ga0066905_100060089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus | 2385 | Open in IMG/M |
3300005713|Ga0066905_100077853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2165 | Open in IMG/M |
3300005713|Ga0066905_100598968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300005713|Ga0066905_101431157 | Not Available | 627 | Open in IMG/M |
3300005718|Ga0068866_10319296 | Not Available | 976 | Open in IMG/M |
3300005764|Ga0066903_100002518 | All Organisms → cellular organisms → Bacteria | 14416 | Open in IMG/M |
3300005764|Ga0066903_100263026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2680 | Open in IMG/M |
3300005764|Ga0066903_101550841 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300005764|Ga0066903_101840016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1158 | Open in IMG/M |
3300005764|Ga0066903_108949777 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005844|Ga0068862_101994838 | Not Available | 591 | Open in IMG/M |
3300005937|Ga0081455_10000154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 82712 | Open in IMG/M |
3300005937|Ga0081455_10016556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7112 | Open in IMG/M |
3300005937|Ga0081455_10039082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 4196 | Open in IMG/M |
3300005937|Ga0081455_10043774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3912 | Open in IMG/M |
3300005937|Ga0081455_10065792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3030 | Open in IMG/M |
3300005937|Ga0081455_10081678 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
3300005937|Ga0081455_10171683 | Not Available | 1651 | Open in IMG/M |
3300005937|Ga0081455_10243832 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300005937|Ga0081455_10695434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 648 | Open in IMG/M |
3300005981|Ga0081538_10002279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 18960 | Open in IMG/M |
3300005981|Ga0081538_10003853 | All Organisms → cellular organisms → Bacteria | 14005 | Open in IMG/M |
3300005981|Ga0081538_10282432 | Not Available | 616 | Open in IMG/M |
3300005983|Ga0081540_1003341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12720 | Open in IMG/M |
3300006038|Ga0075365_10825992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
3300006049|Ga0075417_10009842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3501 | Open in IMG/M |
3300006049|Ga0075417_10374424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 701 | Open in IMG/M |
3300006049|Ga0075417_10673264 | Not Available | 530 | Open in IMG/M |
3300006169|Ga0082029_1737891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2795 | Open in IMG/M |
3300006196|Ga0075422_10037655 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300006575|Ga0074053_10021975 | Not Available | 1012 | Open in IMG/M |
3300006580|Ga0074049_12314468 | Not Available | 568 | Open in IMG/M |
3300006581|Ga0074048_13385739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. Ac-20353 | 847 | Open in IMG/M |
3300006844|Ga0075428_100006122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 13388 | Open in IMG/M |
3300006844|Ga0075428_100031162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5897 | Open in IMG/M |
3300006844|Ga0075428_100195169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2189 | Open in IMG/M |
3300006844|Ga0075428_100411858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1448 | Open in IMG/M |
3300006844|Ga0075428_101666911 | Not Available | 666 | Open in IMG/M |
3300006845|Ga0075421_100023274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 7799 | Open in IMG/M |
3300006845|Ga0075421_100890838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1016 | Open in IMG/M |
3300006847|Ga0075431_100303958 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300006853|Ga0075420_100017186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6466 | Open in IMG/M |
3300006853|Ga0075420_100465259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1092 | Open in IMG/M |
3300006871|Ga0075434_100929841 | Not Available | 884 | Open in IMG/M |
3300006880|Ga0075429_100082958 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
3300006880|Ga0075429_100087432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2716 | Open in IMG/M |
3300006969|Ga0075419_10001536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14971 | Open in IMG/M |
3300009081|Ga0105098_10241025 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300009081|Ga0105098_10289663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 784 | Open in IMG/M |
3300009094|Ga0111539_10001841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 28209 | Open in IMG/M |
3300009094|Ga0111539_10069482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4159 | Open in IMG/M |
3300009094|Ga0111539_11622462 | Not Available | 750 | Open in IMG/M |
3300009098|Ga0105245_13218474 | Not Available | 506 | Open in IMG/M |
3300009100|Ga0075418_11695578 | Not Available | 687 | Open in IMG/M |
3300009146|Ga0105091_10779912 | Not Available | 507 | Open in IMG/M |
3300009156|Ga0111538_10085244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4019 | Open in IMG/M |
3300009168|Ga0105104_10261399 | Not Available | 946 | Open in IMG/M |
3300009553|Ga0105249_11294577 | Not Available | 800 | Open in IMG/M |
3300009810|Ga0105088_1111299 | Not Available | 514 | Open in IMG/M |
3300009840|Ga0126313_10084615 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
3300009868|Ga0130016_10001306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 51851 | Open in IMG/M |
3300009870|Ga0131092_10000217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 159214 | Open in IMG/M |
3300009873|Ga0131077_10006779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 24917 | Open in IMG/M |
3300009873|Ga0131077_10030491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8917 | Open in IMG/M |
3300010037|Ga0126304_10107448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinokineospora → Actinokineospora alba | 1771 | Open in IMG/M |
3300010046|Ga0126384_11299225 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
3300010047|Ga0126382_11620084 | Not Available | 601 | Open in IMG/M |
3300010147|Ga0126319_1136478 | Not Available | 514 | Open in IMG/M |
3300010336|Ga0134071_10576150 | Not Available | 587 | Open in IMG/M |
3300010362|Ga0126377_10294054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora → Phytoactinopolyspora halotolerans | 1599 | Open in IMG/M |
3300010362|Ga0126377_12671825 | Not Available | 574 | Open in IMG/M |
3300010362|Ga0126377_13527802 | Not Available | 506 | Open in IMG/M |
3300010375|Ga0105239_10402647 | Not Available | 1549 | Open in IMG/M |
3300010398|Ga0126383_10448022 | Not Available | 1339 | Open in IMG/M |
3300012204|Ga0137374_10385884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1118 | Open in IMG/M |
3300012355|Ga0137369_10213284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1484 | Open in IMG/M |
3300012355|Ga0137369_10684030 | Not Available | 706 | Open in IMG/M |
3300012355|Ga0137369_10697963 | Not Available | 698 | Open in IMG/M |
3300012909|Ga0157290_10027460 | Not Available | 1307 | Open in IMG/M |
3300012948|Ga0126375_10628294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 825 | Open in IMG/M |
3300012961|Ga0164302_10345761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 992 | Open in IMG/M |
3300012961|Ga0164302_10998243 | Not Available | 652 | Open in IMG/M |
3300012971|Ga0126369_13212867 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300012987|Ga0164307_10991417 | Not Available | 683 | Open in IMG/M |
3300012989|Ga0164305_10830143 | Not Available | 770 | Open in IMG/M |
3300014254|Ga0075312_1059196 | Not Available | 741 | Open in IMG/M |
3300014267|Ga0075313_1038584 | Not Available | 1105 | Open in IMG/M |
3300014302|Ga0075310_1160014 | Not Available | 517 | Open in IMG/M |
3300014311|Ga0075322_1147947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
3300014965|Ga0120193_10064219 | Not Available | 568 | Open in IMG/M |
3300015371|Ga0132258_10020580 | All Organisms → cellular organisms → Bacteria | 14377 | Open in IMG/M |
3300015371|Ga0132258_13298159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1111 | Open in IMG/M |
3300015373|Ga0132257_100007366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10775 | Open in IMG/M |
3300017939|Ga0187775_10109657 | Not Available | 938 | Open in IMG/M |
3300017965|Ga0190266_10000883 | All Organisms → cellular organisms → Bacteria | 5254 | Open in IMG/M |
3300017966|Ga0187776_10850077 | Not Available | 659 | Open in IMG/M |
3300018073|Ga0184624_10441211 | Not Available | 573 | Open in IMG/M |
3300018078|Ga0184612_10184582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
3300018465|Ga0190269_11508273 | Not Available | 554 | Open in IMG/M |
3300018469|Ga0190270_10000884 | All Organisms → cellular organisms → Bacteria | 13520 | Open in IMG/M |
3300018469|Ga0190270_10008322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5689 | Open in IMG/M |
3300018469|Ga0190270_10032644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3410 | Open in IMG/M |
3300019356|Ga0173481_10000351 | All Organisms → cellular organisms → Bacteria | 9494 | Open in IMG/M |
3300019361|Ga0173482_10653985 | Not Available | 536 | Open in IMG/M |
3300019767|Ga0190267_10486661 | Not Available | 724 | Open in IMG/M |
3300020005|Ga0193697_1052462 | Not Available | 1012 | Open in IMG/M |
3300022893|Ga0247787_1009256 | Not Available | 1205 | Open in IMG/M |
3300022893|Ga0247787_1022805 | Not Available | 845 | Open in IMG/M |
3300022901|Ga0247788_1015343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1314 | Open in IMG/M |
3300022915|Ga0247790_10200370 | Not Available | 530 | Open in IMG/M |
3300025537|Ga0210061_1058225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
3300025537|Ga0210061_1071740 | Not Available | 600 | Open in IMG/M |
3300025559|Ga0210087_1002843 | All Organisms → cellular organisms → Bacteria | 4045 | Open in IMG/M |
3300025567|Ga0210076_1078808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
3300025791|Ga0210115_1032257 | Not Available | 1154 | Open in IMG/M |
3300025796|Ga0210113_1033177 | Not Available | 1051 | Open in IMG/M |
3300025901|Ga0207688_10163446 | Not Available | 1321 | Open in IMG/M |
3300025938|Ga0207704_10486326 | Not Available | 992 | Open in IMG/M |
3300025944|Ga0207661_10163163 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300026028|Ga0208420_1022185 | Not Available | 555 | Open in IMG/M |
3300026089|Ga0207648_10432109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
3300026535|Ga0256867_10056176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica → Pseudonocardia asaccharolytica DSM 44247 = NBRC 16224 | 1580 | Open in IMG/M |
3300027646|Ga0209466_1087743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 628 | Open in IMG/M |
3300027743|Ga0209593_10322017 | Not Available | 529 | Open in IMG/M |
3300027873|Ga0209814_10181704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
3300027880|Ga0209481_10000015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 109690 | Open in IMG/M |
3300027880|Ga0209481_10080594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1551 | Open in IMG/M |
3300027880|Ga0209481_10664649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 541 | Open in IMG/M |
3300027907|Ga0207428_10038763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3872 | Open in IMG/M |
3300027907|Ga0207428_10069848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2762 | Open in IMG/M |
3300027909|Ga0209382_11032005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
3300028589|Ga0247818_10227478 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300028589|Ga0247818_11313975 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 519 | Open in IMG/M |
3300028812|Ga0247825_11414751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
3300028878|Ga0307278_10110566 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300028889|Ga0247827_10845611 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300030006|Ga0299907_10037186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3812 | Open in IMG/M |
3300030336|Ga0247826_11408658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300030619|Ga0268386_10845022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Actinomarinicola → Actinomarinicola tropica | 580 | Open in IMG/M |
3300031170|Ga0307498_10000302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6239 | Open in IMG/M |
3300031226|Ga0307497_10000554 | All Organisms → cellular organisms → Bacteria | 8791 | Open in IMG/M |
3300031228|Ga0299914_10022383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5150 | Open in IMG/M |
3300031228|Ga0299914_10144719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2104 | Open in IMG/M |
3300031229|Ga0299913_10904525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 852 | Open in IMG/M |
3300031547|Ga0310887_10233930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
3300031561|Ga0318528_10397755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 740 | Open in IMG/M |
3300031665|Ga0316575_10054613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1591 | Open in IMG/M |
3300031720|Ga0307469_11806999 | Not Available | 591 | Open in IMG/M |
3300031893|Ga0318536_10315453 | Not Available | 793 | Open in IMG/M |
3300031908|Ga0310900_11598373 | Not Available | 552 | Open in IMG/M |
3300032012|Ga0310902_11161315 | Not Available | 542 | Open in IMG/M |
3300032075|Ga0310890_10257126 | Not Available | 1233 | Open in IMG/M |
3300032075|Ga0310890_11631137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
3300032174|Ga0307470_11427416 | Not Available | 572 | Open in IMG/M |
3300034148|Ga0364927_0136917 | Not Available | 699 | Open in IMG/M |
3300034150|Ga0364933_169829 | Not Available | 568 | Open in IMG/M |
3300034151|Ga0364935_0149617 | Not Available | 738 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.76% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 5.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.41% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.44% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.44% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.46% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.46% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.46% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.46% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.46% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.46% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.49% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.49% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.49% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.49% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.49% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.49% |
Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.49% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2040502000 | Fungus garden microbial communities from Atta colombica in Panama - dump bottom | Host-Associated | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026028 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ACODB_6270080 | 2040502000 | Fungus Garden | METLIGIAVLLAGIGVLWICFAIGVYFLTRTGREGMRIARMADERRDRPAD |
KansclcFeb2_14733310 | 2124908045 | Soil | METMIGIAALLVGLGVAWLCFALGVYFFTRTGREGMRIQRMEEEHRHHTT |
ICChiseqgaiiDRAFT_24433142 | 3300000033 | Soil | METLFGVAALLAGIGVLWLCFALGVYYFTRTGREGMRIQRMEDEHRQQMLRERP* |
ICChiseqgaiiFebDRAFT_106772341 | 3300000363 | Soil | METMIGIAALLVGLGVAWLCFAVGVYFFTRTGREGLRIQRMEDERRQHTP* |
F12B_121020601 | 3300000443 | Soil | METMIGIAVLLVGIGVLWVCFAVGVYYLTRTGREGMRIERMAADRRREQALEGE* |
F14TC_1024126602 | 3300000559 | Soil | METMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEERRHHTT* |
JGI10213J12805_101798143 | 3300000858 | Soil | MIGIAALLVGVGIGWLCFAVGVYFLTRTGREGMRIARMEDERRERLSSQ* |
JGI10216J12902_1000647652 | 3300000956 | Soil | MIGIAALLVGLGVLWVCFALGVYLFTRTGREGIRIQRMTEEQHRTPSPQ* |
JGI10216J12902_1002087433 | 3300000956 | Soil | MIGIAALLVGVGIAWVCFAVGVYFLTRTGREGMRIARMEDERRQRMPHER* |
JGI10216J12902_1111889123 | 3300000956 | Soil | METMIGIAALLVGLGVAWVCFAVGVYFFTRTGREGLRIERMEEERRHRAP* |
F14TB_1005389313 | 3300001431 | Soil | METMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEEHRHHTT* |
soilL1_101681733 | 3300003267 | Sugarcane Root And Bulk Soil | MIGIAALLVGLGILWLCFALGVFFFTRTGREGMRIQRMEDERRERVAPER* |
JGI25404J52841_100486562 | 3300003659 | Tabebuia Heterophylla Rhizosphere | METMIGIAALLVGVGVAWVCFAWGVYLFTRTGREGLRIERMEEERRHRAP* |
JGI25405J52794_100277861 | 3300003911 | Tabebuia Heterophylla Rhizosphere | DRAAKGPTVWRCALETMIGIGVLLVGIGILWVCFAIGVWFFTRTGREGMRIQRMQADRWREQAPEE* |
Ga0055471_100768181 | 3300003987 | Natural And Restored Wetlands | LETMIGIAALLVGAGVLWLCFALGVFFFTRTGREGLRIQRMEEERQTR |
Ga0055471_101141972 | 3300003987 | Natural And Restored Wetlands | METMIGIAALLVGAGVGWLCFAVGVYFLTRTGREGMRIQRMEDERQHRLSSEQ* |
Ga0055468_100885722 | 3300003993 | Natural And Restored Wetlands | METMIGIAALLVGAGVFWVCFAFGVYLFTRTGREGLRIQRMEEERHTRVPPG* |
Ga0055467_100257411 | 3300003996 | Natural And Restored Wetlands | MVGIAALLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRDRQSADR* |
Ga0055472_102424942 | 3300003998 | Natural And Restored Wetlands | MIGIAALLVGAGVLWLCFALGVFFFTRTGREGLRIQRMEEERQTRVPPE* |
Ga0055465_100547431 | 3300004013 | Natural And Restored Wetlands | LETMIGIAALLVGAGVLWLCFALGVFFFTRTGREGLRIQRMEEERQTRVPPPE* |
Ga0055465_100765272 | 3300004013 | Natural And Restored Wetlands | MIGIAALLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRDRQSADR* |
Ga0055465_103007382 | 3300004013 | Natural And Restored Wetlands | METMIGIAALLVGAGVFWVCFAFGVYLFTRTGREGLRIQRMEEERHTRVPP |
Ga0062593_1002697141 | 3300004114 | Soil | VETMIGIAALLVGLGVAWVCFAAGVYLFTRTGREGLRIERMEEERRHRAP* |
Ga0062589_1001110102 | 3300004156 | Soil | MIEAMETMIGIAALLVGLGVAWVCFAAGVYLFTRTGREGLRIERMEEERRHRVP* |
Ga0062590_1024391011 | 3300004157 | Soil | LETMIGIAALLVGAGVAWLCFAAGVYFFTRTGREGMRIARMEEEQRHHPPRET* |
Ga0063356_1045072081 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIGIAALLVGAGVAWLCFAAGVYFFTRTGREGMRIARMEEEQRRPPRET* |
Ga0063356_1049825251 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LETMIGIAVLLVGAGLLWLCFAIGVYYLTRTGREGMRIQRMEDERRERLSPDK* |
Ga0066395_106657591 | 3300004633 | Tropical Forest Soil | METMIGLAALLAGLGVAWVCFAAGVYLFTRTGREGLRIERMEEERRHRTP* |
Ga0062594_1024902141 | 3300005093 | Soil | MIGIAALLVGIGLLWLCFALGVFFFTRTGREGMRIQRMEDERRERVTSD |
Ga0065705_100034745 | 3300005294 | Switchgrass Rhizosphere | LETMIGIAALLVGAGVAWLCFAAGVYFFTRTGREGMRIARMEEEQRRPPRET* |
Ga0066388_1000343456 | 3300005332 | Tropical Forest Soil | MGPPGAPGYGGGMETMIGIAALLVGIGVLWVSFAYGVYLFTRTGREGIRIAQEERKLHPQT* |
Ga0066388_1001250832 | 3300005332 | Tropical Forest Soil | METMFGVAALLAGIGVLWLCFALGVFYFTRTGREGMRIQRMEDEHRQQMRQQ* |
Ga0066388_1003702853 | 3300005332 | Tropical Forest Soil | METLIGIAVLLAGIGVLWICFAIGVYFLTRTGREGMRIARMADERRDRPAD* |
Ga0066388_1038285222 | 3300005332 | Tropical Forest Soil | METMIGIAALLVGAGVLWLCFALGVYFFTRTGREGMRIQRMEDERRQQQVPREQ* |
Ga0066388_1077833672 | 3300005332 | Tropical Forest Soil | LETMIGIAALLVAAGVLWVCFALGVFLFTRTGREGMRIQRMEDERRRERDSP* |
Ga0070692_102899021 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | RAVETMIGIAALLVGLGILWLCFALGVFFFTRTGREGMRIQRMEDERRERVTSDR* |
Ga0070662_1001058854 | 3300005457 | Corn Rhizosphere | MIGIAALLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRERVTSDR* |
Ga0068867_1005581641 | 3300005459 | Miscanthus Rhizosphere | MIGIAALLVGLGVAWLCFAVGVYFFTRTGREGLRIQRMEDERRQHTP* |
Ga0073909_100580503 | 3300005526 | Surface Soil | METMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEERRHPHA* |
Ga0070684_1000411422 | 3300005535 | Corn Rhizosphere | METMIGIAALLVGLGVAWVCFALGVYFFTRTGREGLRIERMEQERRQHAP* |
Ga0070684_1017920171 | 3300005535 | Corn Rhizosphere | MIGIAALLVGAGVAWLCFAAGVYFFTRTGREGMRIARMEEEQRHRPPRET* |
Ga0068854_1001011952 | 3300005578 | Corn Rhizosphere | MIGIAALLVGIGLLWLCFALGVFFFTRTGREGMRIQRMEDERRERVTSDR* |
Ga0068852_1021759841 | 3300005616 | Corn Rhizosphere | LETMIGIAALLVGAGVAWLCFAAGVYFFTRTGREGMRIARMEEEQRHRPPRET* |
Ga0066905_10000063514 | 3300005713 | Tropical Forest Soil | MQIMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEEHRHQHPPA* |
Ga0066905_1000010792 | 3300005713 | Tropical Forest Soil | METMIGISALIVSLGVLWLCFAIGVFFLTRTGREGMRIQRMEDERRQQLRDQS* |
Ga0066905_1000025178 | 3300005713 | Tropical Forest Soil | METLFGVAALLAGIGVLWLCFALGVFYFTRTGREGMRIQRMEDEHRQQMLRDRP* |
Ga0066905_1000214615 | 3300005713 | Tropical Forest Soil | METMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEEHRHQHPPA* |
Ga0066905_1000600892 | 3300005713 | Tropical Forest Soil | METLIGIAALLVGLGVAWVCFAAGVYLFTRTGREGLRIERMEEERRQRTP* |
Ga0066905_1000778534 | 3300005713 | Tropical Forest Soil | METMIGISALIVSLGVLWLCFAIGVFFLTRTGREGMRIQRMEDERRQQLRDQV* |
Ga0066905_1005989682 | 3300005713 | Tropical Forest Soil | METMIGIAVLLVGAGIAWLCFALGVWFFTRTGREGMRIQRMEDERRERLSPEP* |
Ga0066905_1014311571 | 3300005713 | Tropical Forest Soil | METMIGIAVLLVGAGIAWLCFAVGVYFFTRTGREGMRIQRMED |
Ga0068866_103192961 | 3300005718 | Miscanthus Rhizosphere | METMIGIAALLVGLGVAWLCRGVYFFTRTGREGLRIQRMEDERR |
Ga0066903_10000251813 | 3300005764 | Tropical Forest Soil | MIGVGALLVGIGVFWVCFAFGIYLFTRTGREGIRIAQEERKLHPQT* |
Ga0066903_1002630265 | 3300005764 | Tropical Forest Soil | MIGIAALLIGIGVLWVCFALGVYLFTRTGREGMRIQRMEDERRQHSSTDAQPNP* |
Ga0066903_1015508412 | 3300005764 | Tropical Forest Soil | METMIGIAALLAGLGVAWVCFAAGVYLFTRTGREGLRIERMEEERRHRHE* |
Ga0066903_1018400162 | 3300005764 | Tropical Forest Soil | METMIGIAVLLVGIGVAWVCFAYGVYLFTRTGREGIRIAQEERKLHPQP* |
Ga0066903_1089497772 | 3300005764 | Tropical Forest Soil | METMIGIAVLLVGAGIAWLCFAVGVYFFTRTGREGMRIQRMEDERKQRLSPDM* |
Ga0068862_1019948382 | 3300005844 | Switchgrass Rhizosphere | METMIGIAALLVGLGVAWLCFAVGVYFFTRTGREGLRIQRMEDERRQH |
Ga0081455_1000015460 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METLIGIAVLLAGIGVLWLCFAVGVYFLTRTGREGLRIARMEDARRDRLAGD* |
Ga0081455_100165563 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METLIGIAVLLAGMGVLWLCFAIGVYFLTRTGREGLRIARMEDRRRERLSDDD* |
Ga0081455_100390826 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LETMIGIGVLLVGIGILWVCFAIGVWFFTRTGREGMRIQRMQADRWREQAPEE* |
Ga0081455_100437744 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIGIAVLIVALGLAWVCFAVGVYYLTRTGREGMRIARMADERQERLSHER* |
Ga0081455_100657922 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VETMIGIAALLVGLGILWLCFAVGVYFLTRTGREGMRIARMADERREHVPPSQ* |
Ga0081455_100816783 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LETMIGIAALLVGAGLAWLCFAGGVFLFTRTGREGMRIARMEEERRQHLPPNE* |
Ga0081455_101716832 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIGIGVLLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRERLSPDP* |
Ga0081455_102438324 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LETMIGIAALLVGAGIAWLCFAVGVYFFTRTGREGMRIARMEQERQQHMPRGE* |
Ga0081455_106954342 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METLIGIAVLLAGLGVLWLCFAVGVYFLTRTGREGLRIARMEDKRRDRLAGDD* |
Ga0081538_1000227910 | 3300005981 | Tabebuia Heterophylla Rhizosphere | LETLIGVGVLLVGIGILWVCFAIGVWFFTRTGREGMRIQRMQADRWREQAQEE* |
Ga0081538_100038537 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MIGIAALLVGAGIAWVCFALGVYFFTRTGREGIRIARMEEERRQHRPPDA* |
Ga0081538_102824322 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MIGIGVLLVGIGILWVCFAIGVWFFTRTGREGMRIQRMQADRWREQAQED* |
Ga0081540_10033411 | 3300005983 | Tabebuia Heterophylla Rhizosphere | METMIGIAVLLVGAGIAWLCFALGVYFFTRTGREGMRIQRMEDERKHRLSADQ* |
Ga0075365_108259922 | 3300006038 | Populus Endosphere | MIGIAVLLVGAGIGWLCFAVGVYFFTRTGREGLRIQRMEDELRKESVRER* |
Ga0075417_100098423 | 3300006049 | Populus Rhizosphere | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERQTRVPPE* |
Ga0075417_103744242 | 3300006049 | Populus Rhizosphere | METLIGIAVLLAGIGVLWLCFAIGVYFLTRTGREGLRIARMEDARRDRLAGD* |
Ga0075417_106732642 | 3300006049 | Populus Rhizosphere | VETMIGIGVLLAGIGILWVCFAVGVYVFTRTGREGLRLQRMEDERRREQSREG* |
Ga0082029_17378914 | 3300006169 | Termite Nest | METMIGIAARLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEDERRSRVPPD* |
Ga0075422_100376552 | 3300006196 | Populus Rhizosphere | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETPVPPE* |
Ga0074053_100219752 | 3300006575 | Soil | IGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEERRHPHA* |
Ga0074049_123144682 | 3300006580 | Soil | METMIGIAALLVGLGVAWLCFAVGVYFFTRTGREGLRIQRMEEERRHHTP* |
Ga0074048_133857392 | 3300006581 | Soil | METLFGVAALLAGIGVLWLCFALGVFFFTRTGREGMRIQRMEDEHRQQMLREGP* |
Ga0075428_10000612214 | 3300006844 | Populus Rhizosphere | METMIGIAVLLAGVGVLWLCFAVGVFFLTRTGREGLRIQRMEEARRQDL* |
Ga0075428_1000311621 | 3300006844 | Populus Rhizosphere | METMIGVAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETPVPPE* |
Ga0075428_1001951692 | 3300006844 | Populus Rhizosphere | METMIGISALIVSLGVLWLCFAVGVFFLTRTGREGMRIQRMEDERRQQLRDPS* |
Ga0075428_1004118584 | 3300006844 | Populus Rhizosphere | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETRVPPE* |
Ga0075428_1016669111 | 3300006844 | Populus Rhizosphere | GIGVLLVGIGILWVCFAIGVWFFTRTGREGMRIQRMQADRWREQAQEE* |
Ga0075421_1000232747 | 3300006845 | Populus Rhizosphere | MIGIAVLFVGLGVLWLCFAVGVYYLTRTGREGMRIQRMEDERRQHLREQ* |
Ga0075421_1008908383 | 3300006845 | Populus Rhizosphere | GIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETRVPPE* |
Ga0075431_1003039582 | 3300006847 | Populus Rhizosphere | METMIGVAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETRVPPE* |
Ga0075420_10001718611 | 3300006853 | Populus Rhizosphere | METMIGITALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEE |
Ga0075420_1004652591 | 3300006853 | Populus Rhizosphere | ALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETPVPPE* |
Ga0075434_1009298412 | 3300006871 | Populus Rhizosphere | VETMIGIAALLVGLGVLWLCFALGVFFFTRTGREGMRIQRMEDERRQRATSEP* |
Ga0075429_1000829585 | 3300006880 | Populus Rhizosphere | LVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETPVPPE* |
Ga0075429_1000874323 | 3300006880 | Populus Rhizosphere | MIGIAVLFVGLGVLWLCFAVVYYLTRTGREGMRIQRMEDERRQHLREQ* |
Ga0075419_1000153611 | 3300006969 | Populus Rhizosphere | METMIGITALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERQTRVPPE* |
Ga0105098_102410253 | 3300009081 | Freshwater Sediment | MIGIAALLVGAGIAWLCFALGVFFFTRTGREGMRIARMEQERREHLPPHG* |
Ga0105098_102896631 | 3300009081 | Freshwater Sediment | MIGISAILVGAGVLWLCFALGVYFFTRTGREGLRIQRMEDERRQRVPPE |
Ga0111539_1000184124 | 3300009094 | Populus Rhizosphere | MIGIGVLLAGIGILWVCFAVGVYVFTRTGREGLRLQRMEDERRREQSREG* |
Ga0111539_100694826 | 3300009094 | Populus Rhizosphere | METMIGITALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETPVPPE* |
Ga0111539_116224623 | 3300009094 | Populus Rhizosphere | METMIGIAALLVGAGVLWVCFALGVYLFTRTGREGLRIQRIEDERRLREPPE* |
Ga0105245_132184742 | 3300009098 | Miscanthus Rhizosphere | METMIGIAALLVGAGVLWVCFALGVYLFTRTGREGLRIQRIED |
Ga0075418_109476181 | 3300009100 | Populus Rhizosphere | LLAGIGILWVCFAVGVYVFTRTGREGLRLQRMEDERRREQSREG* |
Ga0075418_116955781 | 3300009100 | Populus Rhizosphere | MIGIGVLLVGIGILWVCFAIGVWFFTRTGREGMRIQRMQADRWREQAQEE* |
Ga0105091_107799121 | 3300009146 | Freshwater Sediment | TRRSALETMIGIAAILVGAGVLWLCFALGVYFFTRTGREGLRSQHMEDELRQRVPPER* |
Ga0111538_100852446 | 3300009156 | Populus Rhizosphere | AGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETPVPPE* |
Ga0105104_102613993 | 3300009168 | Freshwater Sediment | MIGIAAILVGAGVLWLCFALGVYFFTRTGREGLRIQHMEDELRQRVPPER* |
Ga0105249_112945772 | 3300009553 | Switchgrass Rhizosphere | METMIGIAVLLVGIGVLWICFAVGVFFLTRTGREGMRIQRMEDERKRQRPTES* |
Ga0105088_11112991 | 3300009810 | Groundwater Sand | MIGIAVLLVGLGVLWLCFAVGVYYLTRTGREGMRIQRMEDERRQQLREQ* |
Ga0126313_100846152 | 3300009840 | Serpentine Soil | METMIGIAALLVGLGVLWLCFALGVYLFTRTGREGLRIQRMEEERRQHVP* |
Ga0130016_1000130615 | 3300009868 | Wastewater | MIGIAVLLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRERLAPE* |
Ga0131092_10000217108 | 3300009870 | Activated Sludge | MIGIAALLVGIGILWLCFALGVFFFTRTGREGMRIQKMEDERRERVSPS* |
Ga0131077_100067793 | 3300009873 | Wastewater | MIGIGVLLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRERMAPGG* |
Ga0131077_100304917 | 3300009873 | Wastewater | MIGIAVLLVGIGVLWLCFALGVFFFTRTGREGMRIQRMEDERRERVSTS* |
Ga0126304_101074482 | 3300010037 | Serpentine Soil | MIGIAALFVGVGIGWLCYSIGVYVLTRTGREGMRIQRMEDERRQGPSAEQ* |
Ga0126384_112992252 | 3300010046 | Tropical Forest Soil | METMIGIAALLVGLGVAWVCFAAGVYLFTRTGREGLRIERMEEERRHRTP* |
Ga0126382_116200842 | 3300010047 | Tropical Forest Soil | MQIMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEEHRH |
Ga0126319_11364782 | 3300010147 | Soil | SRMETMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEERGHQHP* |
Ga0134071_105761502 | 3300010336 | Grasslands Soil | METMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIERMEEERRRQHPPA* |
Ga0126377_102940543 | 3300010362 | Tropical Forest Soil | METMFGVAALLAGIGVLWLCFALGVFYFTRTGREGMRIQRMEDEHRQQMMRERP* |
Ga0126377_126718252 | 3300010362 | Tropical Forest Soil | MIGIAALLVGAGIAWLCFAVGVYYFTRTGREGMRIARMGEELRERQPPGD* |
Ga0126377_135278022 | 3300010362 | Tropical Forest Soil | METLFGVAALLAGIGVLWLCFALGVFYFTRTGREGMRIQRMEDEHRQQMMRERP* |
Ga0105239_104026473 | 3300010375 | Corn Rhizosphere | MIGIAALLVGLGILWLCFALGVFFFTRTGREGMRIQRMEDERRERVTSDR* |
Ga0126383_104480222 | 3300010398 | Tropical Forest Soil | METMIGVGVLLAGIGVLWLCFAAGVYFFTRTGREGMRIQRMEEERRQHLA* |
Ga0137374_103858841 | 3300012204 | Vadose Zone Soil | METMIGIAALIVSVGVLWLCFAVGVWFFTRTGREGMRIQRMEDEHRQQVLRQQ* |
Ga0137369_102132842 | 3300012355 | Vadose Zone Soil | MIGIAALLVGAGVLWLCFAIGVYFFTRTGREGMRIQRMEDERRQQLSREQ* |
Ga0137369_106840301 | 3300012355 | Vadose Zone Soil | METMIGIAALIMSVGVLWLCFAIGVYFFTRTGREGMRIQRMEDERRQQPLREQ* |
Ga0137369_106979631 | 3300012355 | Vadose Zone Soil | MIGIGVLLAGIGVLWVCFAIGVYFFTRTGREGIRIQRMEPDWRREQSQAEQRPSPSAE* |
Ga0157290_100274603 | 3300012909 | Soil | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETRVPPG* |
Ga0126375_106282941 | 3300012948 | Tropical Forest Soil | METMIGIAALLVGLGVLWLCFALGVFFFTRTGREGMRIQRMEDERRKRVTSGP* |
Ga0164302_103457612 | 3300012961 | Soil | MIEAMETMIGISALLVGLGVAWVCFAAGVYLFTRTGREGLRIERMEEERRHRVP* |
Ga0164302_109982431 | 3300012961 | Soil | METMIGIAALLVGVGVAWLCFALGVYFFTRTGREGLRIQRMEEEHRHHST* |
Ga0126369_132128671 | 3300012971 | Tropical Forest Soil | METMIGVGALLVGIGVFWVCFAFGIYLFTRTGREGIRIAQEERKLHPQT* |
Ga0164307_109914171 | 3300012987 | Soil | METMIGIAALLVGMGVAWLCFALGVYFFTRTGREGLRIQRMEEERRHPH |
Ga0164305_108301431 | 3300012989 | Soil | METMIGIAALLVGMGVAWLCFALGVYFFTRTGREGLRIQRMEEERRHPHA* |
Ga0075312_10591962 | 3300014254 | Natural And Restored Wetlands | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERHTRVPPG* |
Ga0075313_10385843 | 3300014267 | Natural And Restored Wetlands | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERHTRVPPE* |
Ga0075310_11600142 | 3300014302 | Natural And Restored Wetlands | MIGIAALLVGAGVLWLCFALDVFFFTRTGREGLRIQRMEEERQTRVPPE* |
Ga0075322_11479471 | 3300014311 | Natural And Restored Wetlands | METMIGIAALLVGAGVGWLCFAVGVYFLTRGGREGMRIQRMEDE |
Ga0120193_100642192 | 3300014965 | Terrestrial | MIGIAALLAGAGVGWLCFAVGVYFLTRTGREGMRIQRMADERQERVSAEEQTRS* |
Ga0132258_100205804 | 3300015371 | Arabidopsis Rhizosphere | MIGIGVLLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRERQGPER* |
Ga0132258_132981593 | 3300015371 | Arabidopsis Rhizosphere | MIERPKGGRMETMIGIGVLLVGLGVAWLCFAGGVYLFTRTGREGLRIERMEEERRHRAT* |
Ga0132257_10000736615 | 3300015373 | Arabidopsis Rhizosphere | METMIGIGVLLVGLGVAWLCFAGGVYLFTRTGREGLRIERMEEERRHRAT* |
Ga0187775_101096572 | 3300017939 | Tropical Peatland | METMIGIAALLVGVGVLWLCFAIGVYYLTRTGREGMRIQRMEDER |
Ga0190266_100008834 | 3300017965 | Soil | VQLETMIGIAALLVGAGVAWLCFAAGVYFFTRTGREGMRIARMEEEQRRPPRET |
Ga0187776_108500771 | 3300017966 | Tropical Peatland | METMIGIAALLVGVGVLWLCFAIGVYYLTRTGREGMRIQRMEDERQQRLTSEHERP |
Ga0184624_104412111 | 3300018073 | Groundwater Sediment | METMIGIGVLLAGIGVFWVCFALGVYYFTSIGQEGMQIQRMEEERRHQVSQG |
Ga0184612_101845822 | 3300018078 | Groundwater Sediment | VETMIGIAVLLVGLGVLWLCFAVGVYYLTRTGREGMRIQRMEDERRQQLREP |
Ga0190269_115082731 | 3300018465 | Soil | METMIGIAALLAGLGVLWLCFALGVYFLTRSGKEGMRIQRMEDERRR |
Ga0190270_100008845 | 3300018469 | Soil | MIGIAALLVGAGVAWLCFAAGVYFFTRTGREGMRIARMEEEQRRPPRET |
Ga0190270_100083222 | 3300018469 | Soil | METMIGIAALLVGAGVLWVCFAYGVYLFTRTGREGLRIQRMEDEQRARPAPPEA |
Ga0190270_100326441 | 3300018469 | Soil | METMIGIAALLAGLGVLWLCFAIGVYFLTRTGREGMRLQRIEDKRRERIADEDE |
Ga0173481_100003517 | 3300019356 | Soil | MIGIAALLVGLGILWLCFALGVFFFTRTGREGMRIQRMEDERRERVTSDR |
Ga0173482_106539852 | 3300019361 | Soil | MIGIAALLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRERVTSDR |
Ga0190267_104866612 | 3300019767 | Soil | METMIGIAAILAGLGVLWLCFALGVYFLTRTGKEGMRIQRIEDERRR |
Ga0193697_10524621 | 3300020005 | Soil | METMIGIGVLLAGIGVFWVCFALGVYYFTRTGREGMRIQRMEEERRHQVSQGDSGAE |
Ga0247787_10092563 | 3300022893 | Soil | METMIGIAALLVGAGVLWVCFALGVYLFTRTGREGLRIQRIEDERRLREPPE |
Ga0247787_10228051 | 3300022893 | Soil | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERQTRVPPE |
Ga0247788_10153433 | 3300022901 | Soil | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETRVPPE |
Ga0247790_102003701 | 3300022915 | Soil | PPGGGPMETMIGIAALLVGAGVLWVCFALGVYLFTRTGREGLRIQRIEDERRLREPPE |
Ga0210061_10582251 | 3300025537 | Natural And Restored Wetlands | METMIGIAALLVGAGVGWLCFAVGVYFLTRTGREGMRIQRMEDERQHRLSSEQ |
Ga0210061_10717402 | 3300025537 | Natural And Restored Wetlands | METMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERHTRVPPG |
Ga0210087_10028434 | 3300025559 | Natural And Restored Wetlands | METMIGIAALLVGAGVFWVCFAFGVYLFTRTGREGLRIQRMEEERHTRVPPG |
Ga0210076_10788081 | 3300025567 | Natural And Restored Wetlands | METMIGIAALLVGAGVGWLCFAVGVYFLTRTGREGMRIQRMED |
Ga0210115_10322572 | 3300025791 | Natural And Restored Wetlands | MIGIAALLVGAGVLWLCFALGVFFFTRTGREGLRIQRMEEERQTRVPPE |
Ga0210113_10331773 | 3300025796 | Natural And Restored Wetlands | METMIGIAALLVGAGVFWVCFAFGVYLFTRTGREGMRIQRMEEERHTRVPPG |
Ga0207688_101634462 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MIGIAALLVGIGLLWLCFALGVFFFTRTGREGMRIQRMEDERRERVTSDR |
Ga0207704_104863261 | 3300025938 | Miscanthus Rhizosphere | METMIGIAALLVGLGVAWLCFAVGVYFFTRTGREGLRIQRMEDERRQHTPWRRYGGDASV |
Ga0207661_101631633 | 3300025944 | Corn Rhizosphere | METMIGIAALLVGLGVAWVCFALGVYFFTRTGREGLRIERMEQERRQHAP |
Ga0208420_10221852 | 3300026028 | Natural And Restored Wetlands | MIGIAALLVGAGVLWLCFALGVFFFTRTGREGLRIQRMEEERHTRVPPG |
Ga0207648_104321093 | 3300026089 | Miscanthus Rhizosphere | IETMIGIAALLVGLGVAWLCFAVGVYFFTRTGREGLRIQRMEDERRQHTP |
Ga0256867_100561762 | 3300026535 | Soil | VETMIGIGVLLAGIGVLWVCFAIGVYFFTRTGREGIRIQGMEADR |
Ga0209466_10877431 | 3300027646 | Tropical Forest Soil | METMIGISALIVSLGVLWLCFAIGVFFLTRTGREGMRIQRMEDERRQQLRDQS |
Ga0209593_103220171 | 3300027743 | Freshwater Sediment | ALETMIGIAAILVGAGVLWLCFALGVYFFTRTGREGLRIQRMEDELRQRVPPER |
Ga0209814_101817042 | 3300027873 | Populus Rhizosphere | METLIGIAVLLAGIGVLWLCFAIGVYFLTRTGREGLRIARMEDARRDRLAGD |
Ga0209481_1000001512 | 3300027880 | Populus Rhizosphere | METMIGIAVLLAGVGVLWLCFAVGVFFLTRTGREGLRIQRMEEARRQDL |
Ga0209481_100805942 | 3300027880 | Populus Rhizosphere | MIGIAVLLVGAGIGWLCFAVGVYFFTRTGREGLRIQRMEDELRKESVRER |
Ga0209481_106646491 | 3300027880 | Populus Rhizosphere | METMIGIAVLLVGIGVLWVCFAVGVYYLTRTGREGMRIERMAADRRREQALEGE |
Ga0207428_100387631 | 3300027907 | Populus Rhizosphere | GAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERETPVPPE |
Ga0207428_100698483 | 3300027907 | Populus Rhizosphere | VETMIGIGVLLAGIGILWVCFAVGVYVFTRTGREGLRLQRMEDERRREQSREG |
Ga0209382_110320052 | 3300027909 | Populus Rhizosphere | METMIGISALIVSLGVLWLCFAVGVFFLTRTGREGMRIQRMEDERRQQLRDPS |
Ga0247818_102274782 | 3300028589 | Soil | METMIGIAALLAGAGILWLCFALGVYFFTRTGREGMRIQRLEDERRGRVPPG |
Ga0247818_113139751 | 3300028589 | Soil | METMIGIAALLVGVGVAWLCFALGVYFFTRTGREGLRIQRMEEEHRHHTT |
Ga0247825_114147511 | 3300028812 | Soil | VGVLLVGIGVLWVCFAVGVYFFTRTGREGMRIQRMEDERRQLRSGEPTVGP |
Ga0307278_101105662 | 3300028878 | Soil | METMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIERMEEERRRQST |
Ga0247827_108456111 | 3300028889 | Soil | MIGIAALLVAAGVLWVCFALGVFLFTRTGREGMRIQRMEDERRERGTSP |
Ga0299907_100371865 | 3300030006 | Soil | VETMIGIGVLLAGIGVLWVCFAIGVYFFTRTGREGMRIQGMEADRRRERSREG |
Ga0247826_114086582 | 3300030336 | Soil | MIGIAALLVAAGVLWVCFALGVFLFTRTGREGMRIQRMEDERRQRGESP |
Ga0268386_108450222 | 3300030619 | Soil | VRRCAVETMIGIGVLLAGIGVLWVCFAIGVYFFTRTGREGMRIQRMEVDRRREQPREE |
Ga0307498_100003027 | 3300031170 | Soil | METMIGIAALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEERRHPHAPA |
Ga0307497_100005541 | 3300031226 | Soil | AALLVGLGVAWLCFALGVYFFTRTGREGLRIQRMEEERRHPHAPA |
Ga0299914_100223837 | 3300031228 | Soil | VETMIGIGVLLAGIGVLWVCFAIGVYFFTRTGREGMRIQRMEVDRRREQPREE |
Ga0299914_101447192 | 3300031228 | Soil | VETMIGIGVLLAGIGVLWVCFAIGVYFFTRTGREGIRIQGMEADRRRERSREG |
Ga0299913_109045252 | 3300031229 | Soil | IGIGVLLAGIGVLWVCFAIGVYFFTRTGREGIRIQGMEADRRRERSREG |
Ga0310887_102339301 | 3300031547 | Soil | GPMETMIGIAALLVGAGVLWVCFALGVYLFTRTGREGLRIQRIEDERRLREPPE |
Ga0318528_103977552 | 3300031561 | Soil | METMIGLGVLLAGIGVLWLCFAMGVFFFTRTGREGMRIQRMEEERREHLSADR |
Ga0316575_100546132 | 3300031665 | Rhizosphere | METMIGIAALLIGAGVLWLCFALGVYFFTRTGREGMRLQRMEEEWRQQHSSGDE |
Ga0307469_118069992 | 3300031720 | Hardwood Forest Soil | METMIGFAALLVGLGVAWLCFAVGVYFFTRTGREGLRIQRMEDERRQHTP |
Ga0318536_103154532 | 3300031893 | Soil | MGTMIGLGVLLAGIGVLWLCFAAGVFFFTRTGREGMRIQRMEDERRRHVPSDR |
Ga0310900_115983732 | 3300031908 | Soil | MIGIAALLVGIGILWLCFALGVFFFTRTGREGMRIQRMEDERRERVTS |
Ga0310902_111613152 | 3300032012 | Soil | METMIGIAALLVGAGVLWVCFALGVDLFTRTGREGLRIQRIEDERRLREPPE |
Ga0310890_102571261 | 3300032075 | Soil | METMIGIAALLVGAGVLWLCFALGVYFFTRTGREGLRIQRMEDERKLRGPSE |
Ga0310890_116311371 | 3300032075 | Soil | ETMIGIAALLVGAGVLWVCFAFGVYLFTRTGREGLRIQRMEEERQTRVPPE |
Ga0307470_114274162 | 3300032174 | Hardwood Forest Soil | METMIGIAALLVGLGVAWLCFAVGVYFFTRTGREGLRIQRMEDERRQHTP |
Ga0364927_0136917_174_326 | 3300034148 | Sediment | MIGIGVLLVGIGVLWVCFAIGVYFFTRTGREGMRIQRMEEERRQQQSPDQ |
Ga0364933_169829_282_455 | 3300034150 | Sediment | METMIGIGVLLAGIGVFWVCFALGVYYFTRTGREGMRIQRMEEERRHQVSQGGSGAE |
Ga0364935_0149617_296_469 | 3300034151 | Sediment | METMIGIGVLLAGIGVFWVCFALGVYYFTRTGREGMRIQRMEEERRDQLSQGGSGAE |
⦗Top⦘ |