NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F024379

Metagenome / Metatranscriptome Family F024379

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024379
Family Type Metagenome / Metatranscriptome
Number of Sequences 206
Average Sequence Length 43 residues
Representative Sequence CKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Number of Associated Samples 144
Number of Associated Scaffolds 206

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 15.12 %
% of genes near scaffold ends (potentially truncated) 97.09 %
% of genes from short scaffolds (< 2000 bps) 84.47 %
Associated GOLD sequencing projects 136
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.350 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(55.825 % of family members)
Environment Ontology (ENVO) Unclassified
(40.291 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.883 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 206 Family Scaffolds
PF13551HTH_29 62.14
PF00583Acetyltransf_1 1.46
PF00665rve 1.46
PF13565HTH_32 0.97
PF03819MazG 0.97
PF01527HTH_Tnp_1 0.97
PF01370Epimerase 0.97
PF00400WD40 0.49
PF02525Flavodoxin_2 0.49
PF05406WGR 0.49
PF13701DDE_Tnp_1_4 0.49
PF05050Methyltransf_21 0.49
PF03150CCP_MauG 0.49
PF14338Mrr_N 0.49
PF01936NYN 0.49
PF00589Phage_integrase 0.49
PF00005ABC_tran 0.49
PF00355Rieske 0.49
PF01381HTH_3 0.49
PF10137TIR-like 0.49
PF04909Amidohydro_2 0.49
PF13560HTH_31 0.49
PF07589PEP-CTERM 0.49
PF05987DUF898 0.49
PF00216Bac_DNA_binding 0.49
PF00126HTH_1 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 206 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.46
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.46
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.46
COG4584TransposaseMobilome: prophages, transposons [X] 1.46
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.49
COG1432NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturationGeneral function prediction only [R] 0.49
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 0.49
COG3831WGR domain, predicted DNA-binding domain in MolRTranscription [K] 0.49
COG4269Uncharacterized membrane protein YjgN, DUF898 familyFunction unknown [S] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.35 %
UnclassifiedrootN/A11.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10408509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300005332|Ga0066388_105850314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300005549|Ga0070704_102075516Not Available528Open in IMG/M
3300005561|Ga0066699_10535636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria838Open in IMG/M
3300005575|Ga0066702_10149499All Organisms → cellular organisms → Bacteria → Proteobacteria1381Open in IMG/M
3300005576|Ga0066708_10111085All Organisms → cellular organisms → Bacteria → Proteobacteria1641Open in IMG/M
3300005610|Ga0070763_10447533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria732Open in IMG/M
3300006028|Ga0070717_10177832All Organisms → cellular organisms → Bacteria1853Open in IMG/M
3300006086|Ga0075019_10549692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium720Open in IMG/M
3300006086|Ga0075019_11052785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300006174|Ga0075014_100056224All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300006606|Ga0074062_10018583All Organisms → cellular organisms → Bacteria → Proteobacteria1037Open in IMG/M
3300006794|Ga0066658_10446209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300006800|Ga0066660_10066542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2426Open in IMG/M
3300006893|Ga0073928_10261941All Organisms → cellular organisms → Bacteria → Proteobacteria1316Open in IMG/M
3300006893|Ga0073928_10607280All Organisms → cellular organisms → Bacteria → Proteobacteria772Open in IMG/M
3300006893|Ga0073928_10907044All Organisms → cellular organisms → Bacteria → Proteobacteria604Open in IMG/M
3300006893|Ga0073928_10993188Not Available572Open in IMG/M
3300010343|Ga0074044_10857120Not Available593Open in IMG/M
3300010376|Ga0126381_100842502Not Available1318Open in IMG/M
3300010376|Ga0126381_102917734All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010376|Ga0126381_103885416Not Available583Open in IMG/M
3300010376|Ga0126381_104684103Not Available527Open in IMG/M
3300012361|Ga0137360_10407861All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300012923|Ga0137359_11296368Not Available616Open in IMG/M
3300012923|Ga0137359_11521954Not Available557Open in IMG/M
3300016319|Ga0182033_10901563Not Available783Open in IMG/M
3300016341|Ga0182035_10052799All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → unclassified Spirochaetales → Spirochaetales bacterium2768Open in IMG/M
3300016341|Ga0182035_10386784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1172Open in IMG/M
3300016357|Ga0182032_10362725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1162Open in IMG/M
3300016371|Ga0182034_10088074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2186Open in IMG/M
3300016371|Ga0182034_10374231All Organisms → cellular organisms → Bacteria → Proteobacteria1162Open in IMG/M
3300016404|Ga0182037_10399149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1132Open in IMG/M
3300016404|Ga0182037_11701335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae562Open in IMG/M
3300016445|Ga0182038_10020175All Organisms → cellular organisms → Bacteria3990Open in IMG/M
3300016445|Ga0182038_10071851All Organisms → cellular organisms → Bacteria → Proteobacteria2407Open in IMG/M
3300016445|Ga0182038_10662973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria906Open in IMG/M
3300017955|Ga0187817_10499614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
3300018433|Ga0066667_11192048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria662Open in IMG/M
3300020170|Ga0179594_10025061All Organisms → cellular organisms → Bacteria → Proteobacteria1851Open in IMG/M
3300020170|Ga0179594_10131392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria917Open in IMG/M
3300020199|Ga0179592_10053985All Organisms → cellular organisms → Bacteria → Proteobacteria1828Open in IMG/M
3300020579|Ga0210407_10406303All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300020579|Ga0210407_10559486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria892Open in IMG/M
3300020580|Ga0210403_10095805All Organisms → cellular organisms → Bacteria2403Open in IMG/M
3300020580|Ga0210403_10151772All Organisms → cellular organisms → Bacteria → Proteobacteria1894Open in IMG/M
3300020580|Ga0210403_10529413All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300020581|Ga0210399_10157606All Organisms → cellular organisms → Bacteria → Proteobacteria1878Open in IMG/M
3300020581|Ga0210399_10178304All Organisms → cellular organisms → Bacteria → Proteobacteria1763Open in IMG/M
3300020581|Ga0210399_10307394All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300020581|Ga0210399_10362708All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Candidatus Gallionella acididurans1209Open in IMG/M
3300020582|Ga0210395_10237355All Organisms → cellular organisms → Bacteria → Proteobacteria1369Open in IMG/M
3300020583|Ga0210401_10085121All Organisms → cellular organisms → Bacteria → Proteobacteria2974Open in IMG/M
3300020583|Ga0210401_10515422All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300021088|Ga0210404_10078731All Organisms → cellular organisms → Bacteria → Proteobacteria1618Open in IMG/M
3300021088|Ga0210404_10125109All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300021168|Ga0210406_10166304All Organisms → cellular organisms → Bacteria → Proteobacteria1845Open in IMG/M
3300021168|Ga0210406_10395725All Organisms → cellular organisms → Bacteria → Proteobacteria1107Open in IMG/M
3300021168|Ga0210406_10842352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria694Open in IMG/M
3300021170|Ga0210400_10133192All Organisms → cellular organisms → Bacteria → Proteobacteria1991Open in IMG/M
3300021170|Ga0210400_10156910All Organisms → cellular organisms → Bacteria1835Open in IMG/M
3300021170|Ga0210400_10540504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria961Open in IMG/M
3300021170|Ga0210400_10828480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria757Open in IMG/M
3300021170|Ga0210400_10897928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300021171|Ga0210405_10224079All Organisms → cellular organisms → Bacteria → Proteobacteria1489Open in IMG/M
3300021178|Ga0210408_10146089All Organisms → cellular organisms → Bacteria → Proteobacteria1871Open in IMG/M
3300021178|Ga0210408_10149207All Organisms → cellular organisms → Bacteria → Proteobacteria1851Open in IMG/M
3300021178|Ga0210408_10179649All Organisms → cellular organisms → Bacteria → Proteobacteria1680Open in IMG/M
3300021178|Ga0210408_11174222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria587Open in IMG/M
3300021404|Ga0210389_10120599All Organisms → cellular organisms → Bacteria → Proteobacteria2025Open in IMG/M
3300021405|Ga0210387_10127165All Organisms → cellular organisms → Bacteria → Proteobacteria2159Open in IMG/M
3300021405|Ga0210387_10137810All Organisms → cellular organisms → Bacteria → Proteobacteria2077Open in IMG/M
3300021405|Ga0210387_10172528All Organisms → cellular organisms → Bacteria → Proteobacteria1863Open in IMG/M
3300021405|Ga0210387_11540774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300021406|Ga0210386_10121202All Organisms → cellular organisms → Bacteria → Proteobacteria2163Open in IMG/M
3300021407|Ga0210383_10551327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria994Open in IMG/M
3300021432|Ga0210384_10203167All Organisms → cellular organisms → Bacteria → Proteobacteria1781Open in IMG/M
3300021432|Ga0210384_10495868All Organisms → cellular organisms → Bacteria → Proteobacteria1099Open in IMG/M
3300021441|Ga0213871_10283171Not Available532Open in IMG/M
3300021474|Ga0210390_10176494All Organisms → cellular organisms → Bacteria → Proteobacteria1804Open in IMG/M
3300021474|Ga0210390_11233793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis602Open in IMG/M
3300021478|Ga0210402_10175055All Organisms → cellular organisms → Bacteria → Proteobacteria1964Open in IMG/M
3300021478|Ga0210402_10558087All Organisms → cellular organisms → Bacteria → Proteobacteria1062Open in IMG/M
3300021479|Ga0210410_11660289Not Available532Open in IMG/M
3300021559|Ga0210409_10942601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria737Open in IMG/M
3300021559|Ga0210409_10971457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300024227|Ga0228598_1010444All Organisms → cellular organisms → Bacteria → Proteobacteria1849Open in IMG/M
3300025898|Ga0207692_10058789All Organisms → cellular organisms → Bacteria → Proteobacteria1982Open in IMG/M
3300025916|Ga0207663_10108407All Organisms → cellular organisms → Bacteria → Proteobacteria1880Open in IMG/M
3300025928|Ga0207700_10158010All Organisms → cellular organisms → Bacteria → Proteobacteria1880Open in IMG/M
3300025929|Ga0207664_10162563All Organisms → cellular organisms → Bacteria → Proteobacteria1905Open in IMG/M
3300026312|Ga0209153_1025190All Organisms → cellular organisms → Bacteria → Proteobacteria1994Open in IMG/M
3300026333|Ga0209158_1133154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria922Open in IMG/M
3300026340|Ga0257162_1003096All Organisms → cellular organisms → Bacteria → Proteobacteria1842Open in IMG/M
3300026360|Ga0257173_1032951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria693Open in IMG/M
3300026360|Ga0257173_1039378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300026361|Ga0257176_1003161All Organisms → cellular organisms → Bacteria → Proteobacteria1730Open in IMG/M
3300026369|Ga0257152_1027300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria613Open in IMG/M
3300026446|Ga0257178_1005955All Organisms → cellular organisms → Bacteria → Proteobacteria1252Open in IMG/M
3300026469|Ga0257169_1014113All Organisms → cellular organisms → Bacteria → Proteobacteria1065Open in IMG/M
3300026481|Ga0257155_1026568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria850Open in IMG/M
3300026490|Ga0257153_1121130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales513Open in IMG/M
3300026494|Ga0257159_1018740All Organisms → cellular organisms → Bacteria → Proteobacteria1121Open in IMG/M
3300026507|Ga0257165_1005896All Organisms → cellular organisms → Bacteria → Proteobacteria1778Open in IMG/M
3300026542|Ga0209805_1060789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1859Open in IMG/M
3300026550|Ga0209474_10094089All Organisms → cellular organisms → Bacteria → Proteobacteria2030Open in IMG/M
3300026551|Ga0209648_10391506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria920Open in IMG/M
3300026552|Ga0209577_10073157All Organisms → cellular organisms → Bacteria → Proteobacteria2836Open in IMG/M
3300026557|Ga0179587_10689319Not Available673Open in IMG/M
3300026849|Ga0207804_109738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria897Open in IMG/M
3300027330|Ga0207777_1011664All Organisms → cellular organisms → Bacteria → Proteobacteria1826Open in IMG/M
3300027512|Ga0209179_1091150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum populi676Open in IMG/M
3300027565|Ga0209219_1154853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria550Open in IMG/M
3300027610|Ga0209528_1089932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria679Open in IMG/M
3300027812|Ga0209656_10026175All Organisms → cellular organisms → Bacteria → Proteobacteria3512Open in IMG/M
3300027824|Ga0209040_10013182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5649Open in IMG/M
3300027824|Ga0209040_10170467All Organisms → cellular organisms → Bacteria → Proteobacteria1156Open in IMG/M
3300027846|Ga0209180_10435866Not Available740Open in IMG/M
3300027884|Ga0209275_10317704All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300027889|Ga0209380_10888122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium501Open in IMG/M
3300027898|Ga0209067_10925999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300028906|Ga0308309_10154071All Organisms → cellular organisms → Bacteria → Proteobacteria1852Open in IMG/M
3300028906|Ga0308309_10785385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria827Open in IMG/M
3300030906|Ga0302314_10756584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103981Open in IMG/M
3300030935|Ga0075401_10021044Not Available563Open in IMG/M
3300031122|Ga0170822_12482545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria852Open in IMG/M
3300031469|Ga0170819_15716158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300031474|Ga0170818_100914833All Organisms → cellular organisms → Bacteria → Proteobacteria1083Open in IMG/M
3300031544|Ga0318534_10162492All Organisms → cellular organisms → Bacteria → Proteobacteria1290Open in IMG/M
3300031545|Ga0318541_10040330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2359Open in IMG/M
3300031545|Ga0318541_10110455All Organisms → cellular organisms → Bacteria → Proteobacteria1484Open in IMG/M
3300031546|Ga0318538_10058805All Organisms → cellular organisms → Bacteria → Proteobacteria1901Open in IMG/M
3300031561|Ga0318528_10062550All Organisms → cellular organisms → Bacteria → Proteobacteria1903Open in IMG/M
3300031573|Ga0310915_10197696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1405Open in IMG/M
3300031573|Ga0310915_11129824All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria544Open in IMG/M
3300031679|Ga0318561_10062805All Organisms → cellular organisms → Bacteria → Proteobacteria1886Open in IMG/M
3300031679|Ga0318561_10344281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria817Open in IMG/M
3300031680|Ga0318574_10047456All Organisms → cellular organisms → Bacteria → Proteobacteria2247Open in IMG/M
3300031681|Ga0318572_10120876All Organisms → cellular organisms → Bacteria → Proteobacteria1495Open in IMG/M
3300031681|Ga0318572_10421574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria793Open in IMG/M
3300031682|Ga0318560_10458330Not Available690Open in IMG/M
3300031708|Ga0310686_113104961Not Available675Open in IMG/M
3300031713|Ga0318496_10704297All Organisms → cellular organisms → Bacteria → Proteobacteria557Open in IMG/M
3300031715|Ga0307476_10712642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria743Open in IMG/M
3300031718|Ga0307474_10854703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300031719|Ga0306917_10123474All Organisms → cellular organisms → Bacteria → Proteobacteria1889Open in IMG/M
3300031719|Ga0306917_10507350All Organisms → cellular organisms → Bacteria → Proteobacteria947Open in IMG/M
3300031744|Ga0306918_10170350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1623Open in IMG/M
3300031744|Ga0306918_10711999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria785Open in IMG/M
3300031747|Ga0318502_10413950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria802Open in IMG/M
3300031748|Ga0318492_10039932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2152Open in IMG/M
3300031763|Ga0318537_10013764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2755Open in IMG/M
3300031764|Ga0318535_10034778All Organisms → cellular organisms → Bacteria → Proteobacteria2041Open in IMG/M
3300031765|Ga0318554_10162535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1269Open in IMG/M
3300031770|Ga0318521_10068215All Organisms → cellular organisms → Bacteria → Proteobacteria1886Open in IMG/M
3300031771|Ga0318546_10408462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria949Open in IMG/M
3300031771|Ga0318546_10687914Not Available720Open in IMG/M
3300031777|Ga0318543_10013815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2886Open in IMG/M
3300031779|Ga0318566_10064248All Organisms → cellular organisms → Bacteria → Proteobacteria1764Open in IMG/M
3300031793|Ga0318548_10118663All Organisms → cellular organisms → Bacteria → Proteobacteria1277Open in IMG/M
3300031795|Ga0318557_10034420All Organisms → cellular organisms → Bacteria → Proteobacteria2066Open in IMG/M
3300031795|Ga0318557_10061690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1602Open in IMG/M
3300031796|Ga0318576_10045970All Organisms → cellular organisms → Bacteria → Proteobacteria1875Open in IMG/M
3300031797|Ga0318550_10015085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3081Open in IMG/M
3300031797|Ga0318550_10069904All Organisms → cellular organisms → Bacteria → Proteobacteria1613Open in IMG/M
3300031797|Ga0318550_10083413All Organisms → cellular organisms → Bacteria → Proteobacteria1487Open in IMG/M
3300031832|Ga0318499_10019160All Organisms → cellular organisms → Bacteria → Proteobacteria2359Open in IMG/M
3300031845|Ga0318511_10217209Not Available853Open in IMG/M
3300031846|Ga0318512_10045454All Organisms → cellular organisms → Bacteria → Proteobacteria1940Open in IMG/M
3300031860|Ga0318495_10048183All Organisms → cellular organisms → Bacteria → Proteobacteria1883Open in IMG/M
3300031890|Ga0306925_10003985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria13208Open in IMG/M
3300031890|Ga0306925_10015044All Organisms → cellular organisms → Bacteria → Proteobacteria7578Open in IMG/M
3300031890|Ga0306925_11217566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae753Open in IMG/M
3300031896|Ga0318551_10487356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria706Open in IMG/M
3300031912|Ga0306921_10292753All Organisms → cellular organisms → Bacteria → Proteobacteria1906Open in IMG/M
3300031941|Ga0310912_10073121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2473Open in IMG/M
3300031941|Ga0310912_10379357All Organisms → cellular organisms → Bacteria → Proteobacteria1099Open in IMG/M
3300031942|Ga0310916_10166160All Organisms → cellular organisms → Bacteria → Proteobacteria1830Open in IMG/M
3300031945|Ga0310913_10098894All Organisms → cellular organisms → Bacteria → Proteobacteria1970Open in IMG/M
3300031947|Ga0310909_10528129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria988Open in IMG/M
3300031954|Ga0306926_10304415All Organisms → cellular organisms → Bacteria → Proteobacteria1972Open in IMG/M
3300031954|Ga0306926_11868798Not Available679Open in IMG/M
3300031959|Ga0318530_10266841Not Available706Open in IMG/M
3300031962|Ga0307479_10233949All Organisms → cellular organisms → Bacteria → Proteobacteria1812Open in IMG/M
3300031962|Ga0307479_12025180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300032001|Ga0306922_10021042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6519Open in IMG/M
3300032010|Ga0318569_10200464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria924Open in IMG/M
3300032010|Ga0318569_10450293Not Available600Open in IMG/M
3300032025|Ga0318507_10032822All Organisms → cellular organisms → Bacteria → Proteobacteria1949Open in IMG/M
3300032025|Ga0318507_10464138All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300032039|Ga0318559_10045735Not Available1815Open in IMG/M
3300032041|Ga0318549_10030293All Organisms → cellular organisms → Bacteria → Proteobacteria2126Open in IMG/M
3300032041|Ga0318549_10151112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1033Open in IMG/M
3300032043|Ga0318556_10056166All Organisms → cellular organisms → Bacteria → Proteobacteria1916Open in IMG/M
3300032043|Ga0318556_10099531All Organisms → cellular organisms → Bacteria → Proteobacteria1470Open in IMG/M
3300032044|Ga0318558_10045755All Organisms → cellular organisms → Bacteria → Proteobacteria1916Open in IMG/M
3300032052|Ga0318506_10032348All Organisms → cellular organisms → Bacteria → Proteobacteria2012Open in IMG/M
3300032054|Ga0318570_10040331All Organisms → cellular organisms → Bacteria → Proteobacteria1898Open in IMG/M
3300032054|Ga0318570_10151058All Organisms → cellular organisms → Bacteria → Proteobacteria1039Open in IMG/M
3300032059|Ga0318533_10447263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria945Open in IMG/M
3300032064|Ga0318510_10048249All Organisms → cellular organisms → Bacteria → Proteobacteria1498Open in IMG/M
3300032064|Ga0318510_10183772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria839Open in IMG/M
3300032094|Ga0318540_10151565Not Available1111Open in IMG/M
3300032180|Ga0307471_100334155All Organisms → cellular organisms → Bacteria → Proteobacteria1618Open in IMG/M
3300032261|Ga0306920_100162331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3331Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil55.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.37%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.43%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.43%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.94%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.46%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.46%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.49%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.49%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.49%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026369Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-AEnvironmentalOpen in IMG/M
3300026446Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-BEnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026849Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1040850923300001867Forest SoilGEEEGCKRNIEMTPLCKVEVTLSRVLGSREVRRGGGVDEQAGVQPS*
Ga0066388_10585031413300005332Tropical Forest SoilCKSNIEMTPLCKVEVTLARVLGSWEVHRGGGVVDEQAGVQPS*
Ga0070704_10207551623300005549Corn, Switchgrass And Miscanthus RhizosphereMSCISNIEMTPLCKVEVTLPRGQGFREMRRAGGVDEQTGIRSAERAAGRAVG
Ga0066699_1053563613300005561SoilSHAFSAACKRNIEMTPFCKIEVTHLRVLGSREVRCGGVVYEQAGVQPS*
Ga0066702_1014949913300005575SoilCKRNIEMTPLCKIEVTHPRVLGSREVRRGGGVDEQAGVQPS*
Ga0066708_1011108513300005576SoilCKRNIEMTPLCKIEVTHPRVLGSREVRRGGVVDEQTGVQPS*
Ga0070763_1044753323300005610SoilCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS*
Ga0070717_1017783213300006028Corn, Switchgrass And Miscanthus RhizosphereLDINRNCDCKRNIEMTPLCKIEETLPRVLGSREVRRGGGVIDEQAGVQPS*
Ga0075019_1054969213300006086WatershedsMTPYARFCCKSNIEMTPLCKVAVTLRRVLGSRRVRRGGGVDEQAGVQPA
Ga0075019_1105278513300006086WatershedsIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS*
Ga0075014_10005622433300006174WatershedsVTFQTGTDTHCSRNIGMTPLCKIEVTLPLVLGSREMRHGGGVDEQAG
Ga0074062_1001858323300006606SoilCKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA*
Ga0066658_1044620923300006794SoilFCKRNIEMTPLCKIEVTHPRVLGSREVRRGGVVDEQTGVQPS*
Ga0066660_1006654233300006800SoilCKRNIEMTHLCKIEVTHPRVLGSREVRFGGGVDEQAGVQPS*
Ga0073928_1026194133300006893Iron-Sulfur Acid SpringMCKRNIEMTPLCKIEVTHPRVLGSGEVRRGGVVDEQAG
Ga0073928_1060728013300006893Iron-Sulfur Acid SpringMRMCKRNIEMTPLCKIEVTHPRVLGSGEVRRGGVVDEQAGVQP
Ga0073928_1090704413300006893Iron-Sulfur Acid SpringMTPLCKIEVTHPRVLGSGEVRRGGVVDEQAGVQPS
Ga0073928_1099318823300006893Iron-Sulfur Acid SpringMTCKRNIEMTPLCKIEVTHPRVLGSGEVRRGGVVDEQAGVQPS
Ga0074044_1085712013300010343Bog Forest SoilMAPLCNIEMTLPRVLGSREMRHGGAVDEQARVQPA
Ga0126381_10084250213300010376Tropical Forest SoilMTPLCKIEVTHPRVLGSREVHRGGVVDEQAGVQPP
Ga0126381_10291773413300010376Tropical Forest SoilMTPLCKIEVTHLGVLGSREVHRGGVVDEQAGVRWTR
Ga0126381_10388541613300010376Tropical Forest SoilMRLRCKSNIEMTPLCKIEATHPRVLGSREVRRGGVVDEQAGVQPP
Ga0126381_10468410313300010376Tropical Forest SoilMTPLCKVEVTLVRVLGSGEVHRGGGVVDEQAGVQPS
Ga0137360_1040786143300012361Vadose Zone SoilMRWLCKRNIEMTPLCNIEVTLPRVLGSREVRRGGGVVDEQAGV
Ga0137359_1129636813300012923Vadose Zone SoilMYNYATGFCKRNIEMTPLCKVEVTLSRVLGSREVRRGGGVDERAGIQPS
Ga0137359_1152195413300012923Vadose Zone SoilMVACKRNIEMTPLCNIEVTLPRVLGSREVRRGGGVDEQAGVQP
Ga0182033_1090156323300016319SoilVIFQKPSSATLRCSSNIEMTPLCKVDVTLPRILGSRGMRRGGGVDEQ
Ga0182035_1005279913300016341SoilMTPLGEVDVTLARVLGSGEVHRGGGVVDEQAGVQPS
Ga0182035_1038678413300016341SoilADIIRNRNIEMTPLCKIEVTLPRGWGSRGLRRGGVLEEQAGVQPS
Ga0182032_1036272523300016357SoilLSCADIICNRNIEMTPLCKIEVTLPRVWGSRGLRRGGVLEEQAGVQPS
Ga0182034_1008807413300016371SoilMGFCKRNIEMTPLCKIEVTPPGVLGSREVRRGGVVDEQAGVQS
Ga0182034_1037423113300016371SoilVTEEMTPLCKIEVTLPRVWGSRGLRRGGVVEEQAGVQPS
Ga0182037_1039914913300016404SoilMTPLCKVEVTLPRVVGSGEVHRGGGVVDEQAGVQPS
Ga0182037_1170133533300016404SoilIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0182038_1002017513300016445SoilMTPHCKVEVTLPRVLGSREVRLGGGVDEQAGVQPSRGAVAGSVGSSA
Ga0182038_1007185133300016445SoilCKRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0182038_1066297313300016445SoilHCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0187817_1049961423300017955Freshwater SedimentTFLSVRIVTFLSVKDIACKRNIEMTPLCKIKGTQLRVLGSREVRRGGVVDEQAGVQPA
Ga0066667_1119204823300018433Grasslands SoilCKRNIEMTPLCKIEVTHPRVLGSREVRRGGVVDEQTGVQPS
Ga0179594_1002506113300020170Vadose Zone SoilIYKICKSNIEMTPLCKVEVTLPGVLGSREERRGGGVDEQAGIQPS
Ga0179594_1013139213300020170Vadose Zone SoilTALCKRNIEMTPLCNIEVTLPRVLGSREVRRGGGVDEQAGVQPS
Ga0179592_1005398523300020199Vadose Zone SoilIEMTPLCKVEVTLPGVLGSREERRGGGVDEQAGIQPS
Ga0210407_1040630313300020579SoilMYVSTLVFCKRNIEMTPLCKIEATLPRVLGSREVRRGGVVDEQAGV
Ga0210407_1055948613300020579SoilVRDIVCKRHIEMTPLCKIEVTLPRVLGSREVRGGGGVVDEQAGVQPS
Ga0210403_1009580513300020580SoilMYVSTLVFCKRNIEMTPLCKIEATLPRVLGSREVRLGGVV
Ga0210403_1015177213300020580SoilRRQLYASNFCKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0210403_1052941313300020580SoilMCKRNIEMTPLCKIEVTHPRVLREVRRGGVVDEQAGV
Ga0210399_1015760623300020581SoilFLSCADKRCKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0210399_1017830423300020581SoilLCKRNIEMTPLCKVEVTLPRFLGSREVRLGGGVDEQAGVQPS
Ga0210399_1030739413300020581SoilMYVSTLVFCKRNIEMTPLCKIEATLPRVLGSREVRRGGVVD
Ga0210399_1036270813300020581SoilMACKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDE
Ga0210395_1023735523300020582SoilADFPPFPCKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0210401_1008512113300020583SoilDFPPFPCKRNIEMTPLCKIEVTLLRIVGFRGARRGGVVDEQAGVQPS
Ga0210401_1051542213300020583SoilMYVSTLVFCKRNIEMTPLCKIEATLPRVLGSREVRRGGVVDEQAGVQP
Ga0210404_1007873113300021088SoilFDCKRNIEMTPLCKIEVTHPRVLGSREVRRGGGVDEQAGVQSS
Ga0210404_1012510913300021088SoilMKSRQIACKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVK
Ga0210406_1016630423300021168SoilGRSAPSGDLCKRNIEMTPLCKVEVTLPRFLGSREVRLGGGVDEQAGVQPS
Ga0210406_1039572523300021168SoilPAIICKRNIEMTPLCNIEVTLPRVLGSREERRGGGVDEQAGVQPS
Ga0210406_1084235213300021168SoilCKRNIEMTPLCKIEATLPRVLGSREVRRGGVVDEQAGVQPA
Ga0210400_1013319233300021170SoilPYAAFRCKRNIEITPLCNIEVTLPRVLGSREVRRGGGVDEQAGVQPS
Ga0210400_1015691033300021170SoilMYVSTLVFCKRNIEMTPLCKIEATLPRVLGSREVRRGGVVDEQAGVQPA
Ga0210400_1054050423300021170SoilPCKRNIEMTPLCKIEVTLLRIVGFRGARRGGVVDEQAGVQPS
Ga0210400_1082848013300021170SoilTMCKRNIEMTPLCKVEVTLPRVLGSREVRRGGGVDEQAGVQPS
Ga0210400_1089792823300021170SoilDGGCKRNIEMTPLCKVEVTLPRFLGSREVRLGGGVDEQAGVQPS
Ga0210405_1022407913300021171SoilRQICKRNIEMTPLCKVEVTLPPVLGSGEVHRGGGVVDEQARVQPS
Ga0210408_1014608913300021178SoilFQYERCKRNIEMTPLCKVEVTLPPVLGSGEVHRGGGVVDEQARVQPS
Ga0210408_1014920713300021178SoilCECWAISCKRNIEMTPLCKVEVTLPRFLGSREVRLGGGVDEQAGVQPS
Ga0210408_1017964923300021178SoilESCKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0210408_1117422213300021178SoilNIEMTPLCKVEVTLPRVLGSREVRRGGGVDEQAGIQPA
Ga0210389_1012059913300021404SoilHKSDSATFGCKRNIEMTPLCKIEVTHPRVLGSREVRRGGVVDEQAGVQPS
Ga0210387_1012716533300021405SoilLSCADIDCKRNIEMTPLCKIEVTLLRIVGFRGARRGGVVDEQAGVQPS
Ga0210387_1013781033300021405SoilMTPLYKVEATLRRILGSREVRRGGGVDEQAGIQPS
Ga0210387_1017252823300021405SoilATKRCKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0210387_1154077413300021405SoilIVLTLCKRSIEMTPLCKVEVTLPRFLGSREVRLGGGVDEQAGVQPS
Ga0210386_1012120213300021406SoilHNYAVTACSSNIEMAPLCNIEMTLFRVSGSREKRHDGAVDEQAGIQPA
Ga0210383_1055132713300021407SoilTRKSFTACKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0210384_1020316713300021432SoilPLCIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0210384_1049586813300021432SoilQNVNYPTFDCKRNIEMTPLCNIEVTLPRVLGSREVRRGGGVNEQAGVQPS
Ga0213871_1028317113300021441RhizosphereMTPLSKVEVTLPGASAVPEVHRVGGVDEQAGIQPA
Ga0210390_1017649413300021474SoilMTPLCKVEVTLPRVLGSREVRRGGGVDEQAGVQPS
Ga0210390_1123379313300021474SoilMTPLCKVEVTLRRVQGSREVRHGGGVDEQAGVQPP
Ga0210402_1017505523300021478SoilRVTFLSCADTACKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0210402_1055808713300021478SoilQKTRFLRPLCKRNIEMTPLCKIEVTHPRVLGSREVRRGGVVDEQAGVQPS
Ga0210410_1166028923300021479SoilMRLFWCKRNIEMTPLCKIEATLPRVLGSREVRLGGVVD
Ga0210409_1094260113300021559SoilNIEMTPLCKVEVTLPRFLGSREVRLGGGVDEQAGVQPS
Ga0210409_1097145713300021559SoilQKPGYAAKICKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0228598_101044413300024227RhizosphereIMCTSNIEMTPLCKVKVTLARVLGSWGMRRDGGVDEQAGVQPA
Ga0207692_1005878913300025898Corn, Switchgrass And Miscanthus RhizosphereEMQANPCKRNIEMTPLRKIEVTHPRVLGSREVRRGGGVNEQAGVQPS
Ga0207663_1010840713300025916Corn, Switchgrass And Miscanthus RhizospherePTKACKRNIEMTPLRKIEVTHPRVLGSREVRRGGGVNEQAGVQPS
Ga0207700_1015801013300025928Corn, Switchgrass And Miscanthus RhizosphereTCKRNIEMTPLRKIEVTHPRVLGSREVRRGGGVNEQAGVQPS
Ga0207664_1016256323300025929Agricultural SoilQNGAYVSLTCKRNIEMTPLRKIEVTHPRVLGSREVRRGGGVNEQAGVQPS
Ga0209153_102519023300026312SoilCADTMCKRNIEMTPLCKIEVTHPRVLGSREVRRGGVVDEQTGVQPS
Ga0209158_113315413300026333SoilCKRNIEMTPLCKVEVTLSRVLGSREVRRGGGVDERAGIQPS
Ga0257162_100309623300026340SoilCKRNIDMTPLCKVEVTLPPVLGSGEVHRGGGVVDEQARVQPS
Ga0257173_103295123300026360SoilKRNIEMTPLCKVEVTLPRVLGSREVRLGGVVDEQAGVQPA
Ga0257173_103937813300026360SoilHCKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0257176_100316113300026361SoilKCKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0257152_102730023300026369SoilGYTSCKSNIEMTPLCKVEVTLPRILGSRDVRRGGGVDEQAGIQPS
Ga0257178_100595513300026446SoilLACKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0257169_101411323300026469SoilACKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0257155_102656813300026481SoilKRNIEMTPPCNIEVTLARVLGSREVRRGGGVVDEQAGVQPS
Ga0257153_112113013300026490SoilMTPLCKIEATLPRVLGSREVRRGGVVDEQAGVQPA
Ga0257159_101874023300026494SoilDILCKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0257165_100589623300026507SoilKSNIEMTPLCKVEVTLPRVLGSREERRGGGVDEQAGIQPS
Ga0209805_106078943300026542SoilTECKRNIEMTPLCKIEVTHPRVLGSREVRRGGGVDEQAGVQPA
Ga0209474_1009408913300026550SoilKQIYPLIYFLGYPRCKRNIEMTPLCKIEVTHPRVLGSREVRRGGVVDEQTGVQPS
Ga0209648_1039150613300026551Grasslands SoilLVTLCRRNIEMTPLCKVEVTLPRVLGSREVHRGGGVDEQAGIQPS
Ga0209577_1007315713300026552SoilRLIACKRNIEMTPLCKIEVTHPRVLGSREVRRGGGVDEQAGVQPS
Ga0179587_1068931913300026557Vadose Zone SoilMTPLCNIEVTLPRILGSREVRRGGGVVDEQAGVQP
Ga0207804_10973823300026849Tropical Forest SoilCKSNIEMTPLCKVEVTLPRVLGSREVRRGGGVDEQAGVQSS
Ga0207777_101166413300027330Tropical Forest SoilIEMTPLCKVEVTLPRVLGSREVRRGGGVDEQAGVQSS
Ga0209179_109115013300027512Vadose Zone SoilFICKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0209219_115485323300027565Forest SoilIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0209528_108993223300027610Forest SoilCKRIIEMTPLCKIEATLPRVVGSREVRLGGVVDEQAGVKPA
Ga0209656_1002617543300027812Bog Forest SoilSVFLVTLCKRNIEMTPLCKVEVTLPRVLGSREVRRGGGVDEQAGVQPS
Ga0209040_1001318273300027824Bog Forest SoilMTPLCKIEVTLPRVLGSREVRRGGGVDEQARVQPP
Ga0209040_1017046713300027824Bog Forest SoilCKRNIEMTPLCKIEVTLPRVLGSREVRRGGGVVDEQAGVQPS
Ga0209180_1043586623300027846Vadose Zone SoilMTPLCKVEVAFPWVLGSREVRRGGVVDEQAGIQPS
Ga0209275_1031770423300027884SoilMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0209380_1088812223300027889SoilMTPLCKIEVTHPPVLGSRDVRRGGVVDEQAGVQPSSGAV
Ga0209067_1092599913300027898WatershedsIEMTPLCKVEVTLPRVLGSREVRRGGGVDEQAGVQPS
Ga0308309_1015407113300028906SoilIRLFATHTCKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0308309_1078538513300028906SoilNPSALCKRNIEMTPLCKIEVTLLRIVGFRGARRGGVVDEQAGVQPS
Ga0302314_1075658413300030906PalsaMTPFCKIAVTLLWVLGFRKVHHAGGVDEQAGVQPS
Ga0075401_1002104413300030935SoilLRTGCHFYVALTRSCKRSIEMTPLCKIEVTHPRVLREVRRGGVVDEQA
Ga0170822_1248254523300031122Forest SoilGNCKRNIEMTPLCKIEATLPRVLGSREVRLAGVVDEQAGVQPA
Ga0170819_1571615813300031469Forest SoilQNRSYPSFDCKRNIEMTPLCKIEATLPRVLGSREVRLGGVVDEQAGVQPA
Ga0170818_10091483313300031474Forest SoilIEMTPLCNIEVTLPRVLGSREERRGGGVDEQAGVQPS
Ga0318534_1016249223300031544SoilRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0318541_1004033033300031545SoilTKTLVNQCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318541_1011045543300031545SoilMTPLCKVEVTLARVLGSGEVHRGGGVVDEQAGVQPS
Ga0318538_1005880513300031546SoilVSACKRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0318528_1006255023300031561SoilMCKRNIEMTPLCKIEVTLPWVLGSRGVHRGGVWIST
Ga0310915_1019769633300031573SoilMTPLCKVEVTLARVLGSGEVHRGGGVVDEQAGVQP
Ga0310915_1112982423300031573SoilNIEMTPLCKIEVTPPGGLGSREVRHGGGVNDQAGVQLL
Ga0318561_1006280513300031679SoilNIYYATLLCKRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0318561_1034428113300031679SoilIEMTPLCKVEVTHPRVLGSREVRRGGVVDEQAGVQPA
Ga0318574_1004745613300031680SoilTLVNQCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318572_1012087623300031681SoilTYVTLTCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318572_1042157413300031681SoilVTVDCTRNIEMTPLSKVEVTLPRVLGFRGMRRGGGVDEQAGVQPA
Ga0318560_1045833013300031682SoilMTPLCKLEVTLPRVLGSRGVHRGRVVDEQAGVQPSR
Ga0310686_11310496123300031708SoilMCTSNIEMTPLCKVKVTLARVLGSWGMRRDGGVDEQAGVQ
Ga0318496_1070429713300031713SoilIEMTPLCKVEVILARVLGSGEVHRGGGVVDEQAGVQPS
Ga0307476_1071264223300031715Hardwood Forest SoilFCKRNIEMTPLCKVEVTLPRVLGSREVRRGGGVDEQAGIQPA
Ga0307474_1085470323300031718Hardwood Forest SoilVTFQTGTDTACKRHIEMTPLCKVQMALPLGAGSREVCRGGGVDERA
Ga0306917_1012347423300031719SoilYALFFCKRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0306917_1050735013300031719SoilNDCKRNIEMTPLCKVEVTHPRVLGSREVRRGGVVDEQAGVQPA
Ga0306918_1017035013300031744SoilVVQCGYRCKRNIEMTPPCKVEVTLPRVVGSGEVHRGGGVVDEQAG
Ga0306918_1071199923300031744SoilPCKSNIEMTPLCKVEVTLARVLGSREVHRGGGGVDEQAGVQPS
Ga0318502_1041395023300031747SoilCKSNIEMTPLCKVEVTLARVLGSREVHRGGGGVDEQAGVQPS
Ga0318492_1003993213300031748SoilQCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318537_1001376433300031763SoilYVTLTCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318535_1003477823300031764SoilPVTFLSVIYSRCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318554_1016253523300031765SoilMSFANTSHTCCKRNIEMTPLCKIEVTHPRVLGSREVRRGGVVDEQAGVQPS
Ga0318521_1006821513300031770SoilCAVTVCTRNIEMTPLSKVEVTLPRVLGSRGMRRGGGVDEQAGVQPA
Ga0318546_1040846233300031771SoilTEFEHNWCKRNIEMTPLCKIEVTPPRVLGSREVRRGGVVDEQAGVQSS
Ga0318546_1068791413300031771SoilMGFCKRNIEMTPLCKIEVTPPGVLGSREVRRGGVVDEQA
Ga0318543_1001381513300031777SoilCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318566_1006424823300031779SoilDFPPSLCKRNIEMTPPCKVEVTLPRVVGSGEVHRGGGVVDEQAGVQPS
Ga0318547_1007067413300031781SoilPEWAASPFLLSDECTRNIEMTPLSKVEVTLPRVLGSRGMRRGGGVDEQAGVQPA
Ga0318548_1011866313300031793SoilLSVIYSRCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318557_1003442013300031795SoilRSLCKRNIEMTPPCKVEVTLPRVVGSGEVHRGGGVVDEQAGVQPS
Ga0318557_1006169013300031795SoilVVQCGYRCKRNIEMTPPCKVEVTLPRVVGSGEVHRGGGVVDE
Ga0318576_1004597023300031796SoilIEMTPLSKVEVTLPRVLGFRGMRRGGGVDEQAGVQPA
Ga0318550_1001508543300031797SoilVTFLSVIYSRCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318550_1006990423300031797SoilMGLYATKSCKSNIEMTPLCKVEVTLARVLGSREVHRGGGGVDEQAGVQPS
Ga0318550_1008341323300031797SoilVCKRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0318499_1001916013300031832SoilASRVTQACKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318511_1021720913300031845SoilMTPLCKVDVTLPRILGSRGMRRGGGVDEQAGVQPA
Ga0318512_1004545413300031846SoilVVVRIDEQQSCTRNIEMTPLSKVEVTLPRVLGSRGMRRGGGVDEQAGVQPA
Ga0318495_1004818323300031860SoilTTYTIKICTRNIEMTPLSKVEVTLPRVLGSRGMRRGGGVDEQAGVQPA
Ga0306925_1000398543300031890SoilMTPLCKIEVTLPRVVGSREVRCGGGVDEQAGVRPS
Ga0306925_10015044113300031890SoilMGFCKRNIEMTPLCKIEVTPPGVLGSREVRRGGVVDEQAGVQSS
Ga0306925_1121756633300031890SoilCKRNIEMTPLCKIEVTPPGVLGSREVRRGGVVDEQAGVQSS
Ga0318551_1048735613300031896SoilIEMTPLCKVQVTHPRVLGSREVRRGGVVDEQAGVQPA
Ga0306921_1029275313300031912SoilTCKSNIEMTPLCKVEVTLARVLGSREVHRGGGGVDEQAGVQPS
Ga0310912_1007312113300031941SoilMGFCKRNIEMTPLCKIEVTPPGVLGSREVRRGGVVDEQAGVQ
Ga0310912_1037935713300031941SoilKSNIEMTPLCKVEVTLARVLGSREVHRGGGGVDEQAGVQPS
Ga0310916_1016616013300031942SoilGDYATFACKRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0310913_1009889413300031945SoilLCKRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0310909_1052812923300031947SoilPTGNCKSNIEMTPLCKVEVTLARVLGSREVHRGGGGVDEQAGVQPS
Ga0306926_1030441523300031954SoilPYAAATCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0306926_1186879813300031954SoilMTPLCKIEVTPPGVLGSREVRRGGVVDEQAGVQSS
Ga0318530_1026684113300031959SoilMGFCKRNIEMTPLCKIEVTPPGVLGSREVRRGGVVDEQAGV
Ga0307479_1023394913300031962Hardwood Forest SoilYRDDTLCKIEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0307479_1202518013300031962Hardwood Forest SoilDMTCKRNIEMTPLCKVEVTLPRVLGFREVRRGGGVDEQAGVQPS
Ga0306922_1002104293300032001SoilMGFCKRNIEMTPLCKIEVTPPGVLGSREVRRGGVV
Ga0318569_1020046413300032010SoilSAIFDCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318569_1045029313300032010SoilMRLQCKRNIEMTPLCKLEVTLPRVLGSRGVHRGRVVDE
Ga0318507_1003282213300032025SoilLVNQCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318507_1046413813300032025SoilMTPLCKVAVTLCRVVGSRRVRRGGGVDEQAGVQSAR
Ga0318559_1004573513300032039SoilLCDTDSRRNIEMTPLCKIEVTHPGVLGSREVHRGGVVDEQAGVQPP
Ga0318549_1003029313300032041SoilSSGVTRMCTRNIEMTPLSKVEVTLPRVLGSRGMRRGGGVDEQAGVQPA
Ga0318549_1015111223300032041SoilPSSAIFDCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318556_1005616613300032043SoilNQCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318556_1009953123300032043SoilFFCKRNIEMTPLCKVEVTLPRALGSREVRLGGGVVDEQAGVQPA
Ga0318558_1004575523300032044SoilIFDCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318506_1003234823300032052SoilDYAALTCKRNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318570_1004033113300032054SoilNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318570_1015105813300032054SoilIEMTPLCKVEVTLARVLGSREVHRGGGGVDEQAGVQPS
Ga0318533_1044726313300032059SoilIYYATFLCKSNIEMTPLCKVEVTLARVLGSREVHRGGGGVDEQAGVQPS
Ga0318510_1004824923300032064SoilGSEPVQCKSNIEMTPLCKVEVTLPRVLGSREVRLGGGVDEQAGVQPS
Ga0318510_1018377213300032064SoilDCKRNIEMTPLCKVQVTHPRVLGSREVRRGGVVDEQAGVQPA
Ga0318540_1015156513300032094SoilMTPPCKVKVTLPRVVGSGEVHRGGGVVDEQAGVQPS
Ga0307471_10033415523300032180Hardwood Forest SoilFGCKRNIDMTPLCKVEVTLPPVLGSGEVHRGGGVVDEQARVQPS
Ga0306920_10016233153300032261SoilMTPPCKVEVTLPRVVGSGEVHRGGGVVDEQAGVQP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.