NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F024371

Metagenome / Metatranscriptome Family F024371

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024371
Family Type Metagenome / Metatranscriptome
Number of Sequences 206
Average Sequence Length 40 residues
Representative Sequence MKWRSLEESSPGTDLRPLREIFAERKELIAKYVPAETQA
Number of Associated Samples 172
Number of Associated Scaffolds 206

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 45.85 %
% of genes near scaffold ends (potentially truncated) 98.06 %
% of genes from short scaffolds (< 2000 bps) 90.29 %
Associated GOLD sequencing projects 164
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.243 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.165 % of family members)
Environment Ontology (ENVO) Unclassified
(26.214 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.602 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.33%    β-sheet: 0.00%    Coil/Unstructured: 65.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 206 Family Scaffolds
PF02978SRP_SPB 64.56
PF14534DUF4440 5.83
PF00850Hist_deacetyl 2.43
PF00072Response_reg 1.94
PF12867DinB_2 1.94
PF12158DUF3592 1.46
PF09969DUF2203 1.46
PF12686DUF3800 0.97
PF00111Fer2 0.97
PF02272DHHA1 0.97
PF00989PAS 0.49
PF14885GHL15 0.49
PF13426PAS_9 0.49
PF13578Methyltransf_24 0.49
PF00578AhpC-TSA 0.49
PF01156IU_nuc_hydro 0.49
PF05163DinB 0.49
PF13175AAA_15 0.49
PF07279DUF1442 0.49
PF07676PD40 0.49
PF00082Peptidase_S8 0.49
PF13520AA_permease_2 0.49
PF01613Flavin_Reduct 0.49
PF05187ETF_QO 0.49
PF07883Cupin_2 0.49
PF14103DUF4276 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 206 Family Scaffolds
COG0541Signal recognition particle GTPaseIntracellular trafficking, secretion, and vesicular transport [U] 64.56
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 4.85
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.49
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.49
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 0.49
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.49
COG2440Ferredoxin-like protein FixXEnergy production and conversion [C] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.24 %
UnclassifiedrootN/A24.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908043|A2_c1_ConsensusfromContig13562All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300002245|JGIcombinedJ26739_100070910All Organisms → cellular organisms → Bacteria3213Open in IMG/M
3300002245|JGIcombinedJ26739_100286635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1532Open in IMG/M
3300002245|JGIcombinedJ26739_101661891All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300003218|JGI26339J46600_10042829All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300004101|Ga0058896_1373797All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300004152|Ga0062386_100695910Not Available834Open in IMG/M
3300005186|Ga0066676_10418670All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300005353|Ga0070669_101205440Not Available654Open in IMG/M
3300005435|Ga0070714_100049572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3574Open in IMG/M
3300005435|Ga0070714_102293036All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae525Open in IMG/M
3300005440|Ga0070705_100423233Not Available992Open in IMG/M
3300005561|Ga0066699_10918104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300005569|Ga0066705_10036523All Organisms → cellular organisms → Bacteria2685Open in IMG/M
3300005569|Ga0066705_10890841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300005598|Ga0066706_10273530All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300005764|Ga0066903_108681199All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300005842|Ga0068858_101399007Not Available689Open in IMG/M
3300005921|Ga0070766_10766477All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300005950|Ga0066787_10090051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300006052|Ga0075029_100477330Not Available820Open in IMG/M
3300006052|Ga0075029_100958821All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300006059|Ga0075017_100147602Not Available1672Open in IMG/M
3300006059|Ga0075017_100546785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas882Open in IMG/M
3300006059|Ga0075017_101143884All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006059|Ga0075017_101303324All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300006102|Ga0075015_100806075Not Available564Open in IMG/M
3300006162|Ga0075030_101158415All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300006175|Ga0070712_100254440Not Available1405Open in IMG/M
3300006176|Ga0070765_100903299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae835Open in IMG/M
3300006176|Ga0070765_102268902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300006358|Ga0068871_101049816All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300006800|Ga0066660_10969601All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300006800|Ga0066660_11291531All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006852|Ga0075433_10187292All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1841Open in IMG/M
3300006854|Ga0075425_102634188All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300006871|Ga0075434_101911652All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300006893|Ga0073928_10832729All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300009090|Ga0099827_10873008All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300009093|Ga0105240_11648340All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300009137|Ga0066709_100279786All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2253Open in IMG/M
3300009162|Ga0075423_11105267Not Available844Open in IMG/M
3300009162|Ga0075423_11941874All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300009628|Ga0116125_1097009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae785Open in IMG/M
3300009644|Ga0116121_1236663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345583Open in IMG/M
3300009700|Ga0116217_10929285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300010301|Ga0134070_10089268All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300010358|Ga0126370_10220626All Organisms → cellular organisms → Bacteria → Acidobacteria1448Open in IMG/M
3300010358|Ga0126370_12290658All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010360|Ga0126372_11378909All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300010360|Ga0126372_13110771All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300010361|Ga0126378_11033832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300010361|Ga0126378_12102891All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300010366|Ga0126379_10319407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1569Open in IMG/M
3300010379|Ga0136449_100104516All Organisms → cellular organisms → Bacteria5791Open in IMG/M
3300010379|Ga0136449_102250013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium793Open in IMG/M
3300010398|Ga0126383_11413341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300010398|Ga0126383_12555698All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010937|Ga0137776_1032430All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300011270|Ga0137391_11208249All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300011270|Ga0137391_11274132All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300011411|Ga0153933_1077099Not Available708Open in IMG/M
3300012096|Ga0137389_11313787All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300012189|Ga0137388_10824728Not Available859Open in IMG/M
3300012199|Ga0137383_11189266All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012209|Ga0137379_11746768All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300012357|Ga0137384_11585686All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300012361|Ga0137360_11426813All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300012363|Ga0137390_10655153All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300012918|Ga0137396_10564347Not Available843Open in IMG/M
3300012918|Ga0137396_10793786Not Available696Open in IMG/M
3300012923|Ga0137359_10193470All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas1817Open in IMG/M
3300012929|Ga0137404_10834752All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group838Open in IMG/M
3300012930|Ga0137407_10679089Not Available969Open in IMG/M
3300012930|Ga0137407_10946842Not Available815Open in IMG/M
3300012944|Ga0137410_11923598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli → Fimbriimonas ginsengisoli Gsoil 348524Open in IMG/M
3300012971|Ga0126369_11995339All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300012984|Ga0164309_11076056All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300013104|Ga0157370_10607938All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas1001Open in IMG/M
3300013296|Ga0157374_11038430Not Available839Open in IMG/M
3300013308|Ga0157375_13107978All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300014168|Ga0181534_10395772Not Available763Open in IMG/M
3300015054|Ga0137420_1280232Not Available1365Open in IMG/M
3300015264|Ga0137403_10078560Not Available3336Open in IMG/M
3300015373|Ga0132257_103640222All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300016702|Ga0181511_1206054All Organisms → cellular organisms → Bacteria2212Open in IMG/M
3300016750|Ga0181505_10697342All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300017924|Ga0187820_1073024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium956Open in IMG/M
3300017932|Ga0187814_10425560All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300017933|Ga0187801_10070580All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas oleovorans/pseudoalcaligenes group → Pseudomonas oleovorans1293Open in IMG/M
3300017943|Ga0187819_10407234Not Available781Open in IMG/M
3300017943|Ga0187819_10433825All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300017946|Ga0187879_10096349Not Available1698Open in IMG/M
3300017961|Ga0187778_11050010All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300017972|Ga0187781_10027861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3903Open in IMG/M
3300017974|Ga0187777_10920884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300017975|Ga0187782_10603437All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300017995|Ga0187816_10020247All Organisms → cellular organisms → Bacteria2605Open in IMG/M
3300017995|Ga0187816_10209308All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300018007|Ga0187805_10542597All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300018033|Ga0187867_10463299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300018037|Ga0187883_10157793All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300018044|Ga0187890_10417431Not Available753Open in IMG/M
3300018062|Ga0187784_11514348Not Available531Open in IMG/M
3300018085|Ga0187772_11000430Not Available611Open in IMG/M
3300019787|Ga0182031_1302144All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300019879|Ga0193723_1106756Not Available786Open in IMG/M
3300019890|Ga0193728_1187639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium879Open in IMG/M
3300020001|Ga0193731_1015811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1956Open in IMG/M
3300020006|Ga0193735_1078253Not Available947Open in IMG/M
3300020580|Ga0210403_10107902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2260Open in IMG/M
3300020580|Ga0210403_10581498All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300020581|Ga0210399_10242615Not Available1501Open in IMG/M
3300020581|Ga0210399_10857017All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300020581|Ga0210399_11569740All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300021088|Ga0210404_10034651All Organisms → cellular organisms → Bacteria2286Open in IMG/M
3300021170|Ga0210400_10250126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1450Open in IMG/M
3300021181|Ga0210388_10500510All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300021181|Ga0210388_10615201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin510949Open in IMG/M
3300021181|Ga0210388_11287137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300021401|Ga0210393_11000907All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300021432|Ga0210384_11141114Not Available683Open in IMG/M
3300021559|Ga0210409_10500301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300021560|Ga0126371_12649820All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes607Open in IMG/M
3300022531|Ga0242660_1040856All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300022713|Ga0242677_1036522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300022872|Ga0224526_1020754Not Available1501Open in IMG/M
3300023255|Ga0224547_1033871Not Available659Open in IMG/M
3300024176|Ga0224565_1034163All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300024288|Ga0179589_10425389Not Available611Open in IMG/M
3300025427|Ga0208077_1037885Not Available682Open in IMG/M
3300025527|Ga0208714_1060351All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300025906|Ga0207699_11359811All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300025910|Ga0207684_11684729All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300025915|Ga0207693_10085507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2470Open in IMG/M
3300025915|Ga0207693_11005237Not Available636Open in IMG/M
3300025917|Ga0207660_10478799All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300025924|Ga0207694_10271812Not Available1390Open in IMG/M
3300025927|Ga0207687_11334130All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300025939|Ga0207665_10501506Not Available938Open in IMG/M
3300025942|Ga0207689_10662084Not Available880Open in IMG/M
3300025945|Ga0207679_11000532Not Available766Open in IMG/M
3300026035|Ga0207703_11396660Not Available673Open in IMG/M
3300026041|Ga0207639_11689623All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300026322|Ga0209687_1189628All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300026528|Ga0209378_1153720All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300026538|Ga0209056_10034973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4683Open in IMG/M
3300027076|Ga0208860_1028285All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300027172|Ga0208098_1015555All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300027383|Ga0209213_1024257All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300027603|Ga0209331_1148772All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300027641|Ga0208827_1009831All Organisms → cellular organisms → Bacteria3667Open in IMG/M
3300027645|Ga0209117_1052082All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300027737|Ga0209038_10076934All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300027738|Ga0208989_10067860Not Available1224Open in IMG/M
3300027767|Ga0209655_10158046All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300027795|Ga0209139_10075890All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300027812|Ga0209656_10217847Not Available917Open in IMG/M
3300027846|Ga0209180_10116452All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300027854|Ga0209517_10401562Not Available770Open in IMG/M
3300027855|Ga0209693_10159455All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300027874|Ga0209465_10534853All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300027879|Ga0209169_10365985All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300027882|Ga0209590_10880985All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300027889|Ga0209380_10187885All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300027889|Ga0209380_10351427All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300027889|Ga0209380_10852442All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300027895|Ga0209624_10583722Not Available742Open in IMG/M
3300027905|Ga0209415_10765257All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300028381|Ga0268264_10458109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1237Open in IMG/M
3300028574|Ga0302153_10195671All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300028639|Ga0302168_1023888All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300028740|Ga0302294_10011281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2106Open in IMG/M
3300028857|Ga0302289_1147563All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300028873|Ga0302197_10339248Not Available672Open in IMG/M
3300030053|Ga0302177_10585718All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300030677|Ga0302317_10342137Not Available665Open in IMG/M
3300031057|Ga0170834_107161228All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031231|Ga0170824_100323709Not Available771Open in IMG/M
3300031241|Ga0265325_10315226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae696Open in IMG/M
3300031446|Ga0170820_12920643All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300031521|Ga0311364_11652514All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300031718|Ga0307474_11212019Not Available597Open in IMG/M
3300031718|Ga0307474_11659807All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031720|Ga0307469_11935044All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300031823|Ga0307478_11501075All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300031912|Ga0306921_10461577All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1479Open in IMG/M
3300031954|Ga0306926_10129069All Organisms → cellular organisms → Bacteria3123Open in IMG/M
3300031954|Ga0306926_10359412All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1800Open in IMG/M
3300031962|Ga0307479_10812555Not Available910Open in IMG/M
3300031962|Ga0307479_11641528All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300032160|Ga0311301_10187265All Organisms → cellular organisms → Bacteria3594Open in IMG/M
3300032174|Ga0307470_10003177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6274Open in IMG/M
3300032174|Ga0307470_10311472All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300032174|Ga0307470_10750449All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300032180|Ga0307471_100781121All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300032205|Ga0307472_100708375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium906Open in IMG/M
3300032261|Ga0306920_100583519All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas1655Open in IMG/M
3300032770|Ga0335085_12293583Not Available540Open in IMG/M
3300032782|Ga0335082_10122179Not Available2554Open in IMG/M
3300032783|Ga0335079_11608168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300032805|Ga0335078_12379321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli → Fimbriimonas ginsengisoli Gsoil 348551Open in IMG/M
3300032898|Ga0335072_11618962Not Available545Open in IMG/M
3300032955|Ga0335076_10999220All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300033289|Ga0310914_10478665All Organisms → cellular organisms → Bacteria1127Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.34%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.34%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.88%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.40%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.91%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.91%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.46%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.97%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.97%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.97%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.49%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.49%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.49%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.49%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.49%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.49%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.49%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.49%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.49%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.49%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.49%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.49%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300004101Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011411Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaGHost-AssociatedOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022872Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25EnvironmentalOpen in IMG/M
3300023255Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14EnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025427Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027076Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes)EnvironmentalOpen in IMG/M
3300027172Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028639Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_2EnvironmentalOpen in IMG/M
3300028740Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3EnvironmentalOpen in IMG/M
3300028857Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_006844102124908043SoilVKWRALEESAQNTDTRALREIFAERKALIDRYVPEET
JGIcombinedJ26739_10007091013300002245Forest SoilMKWRSLEESVSESDLRPLRDIFAERKELIAKYVPAETQAIQARAV
JGIcombinedJ26739_10028663523300002245Forest SoilMMKWRSVEESALGADTRPLRDIFAQRKELIAKYVPPET
JGIcombinedJ26739_10166189123300002245Forest SoilMKWRSLEESAPTTDIRSLRQIFAERKELIAKYVPP
JGI26339J46600_1004282913300003218Bog Forest SoilMKWRWHEESGLSLDRRPLREIFAERKELIAKYVPPETEAI
Ga0058896_137379723300004101Forest SoilMKWRSLEESSPDTDTRLLREIYVERKELIAKYVPAETQAV
Ga0062386_10069591023300004152Bog Forest SoilMKWRSLQESDSFSDLRPLREILAERKELIAKYVPADVQAVHARAIA
Ga0066676_1041867013300005186SoilMKWRSLEESGPSQDMRPLREQFAERKALIAKYVPPETQAI
Ga0070669_10120544013300005353Switchgrass RhizosphereMKWRSLEESAENTDLRSLREIYAERKLLIDRYVPDEVRGIHARVVG
Ga0070714_10004957253300005435Agricultural SoilMKWRSLEESHPSSDVRPLREIFAERKELIAKYVPAETQAIHAQ
Ga0070714_10229303613300005435Agricultural SoilMKWRSLEEKDSGLDFRPLREIYAERKELIAKYVPAEAQAVHAAAV
Ga0070705_10042323313300005440Corn, Switchgrass And Miscanthus RhizosphereMKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPPDIQGVHARVI
Ga0066699_1091810423300005561SoilMKWRSLEETSAVPETRSLREVLAERKELIAKYVPAEIQAVHAR
Ga0066705_1003652353300005569SoilMKWRSLEESTTGADTRTLGEVFAERKELIAKYVPAE
Ga0066705_1089084123300005569SoilMKWRSLEETSAVPETRSLREVLAERKELIAKYVPAE
Ga0066706_1027353013300005598SoilMKWRSLEESGPSQDMRPLREQFAERKALIAKYVPPETQAIH
Ga0066903_10868119913300005764Tropical Forest SoilMKWRSLEESSTGVDTRSLREQFAERKALIARYVLPEVEA
Ga0068858_10139900723300005842Switchgrass RhizosphereMKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPPDIQ
Ga0070766_1076647723300005921SoilMKWRSLEKSTPGTDTRSLRDILSERKELIVRYVPPDIQAVHARVI
Ga0066787_1009005123300005950SoilMKWRSLEESGPSTDIRPLREIFAERKGLIAKYVPPDTQAIH
Ga0075029_10047733023300006052WatershedsMKWRSLQESGSSTDTRSLREIFAERKELIAKYVPADVQAV
Ga0075029_10095882123300006052WatershedsMKWRSLDESDATADTRPLREIFAERKELIAKYVPAETQA
Ga0075017_10014760223300006059WatershedsMKWRSLQESGSSTDTRSLREIFAERKELIAKYVPADVQ
Ga0075017_10054678523300006059WatershedsMKWRSLQESGSYDDTRPLRQIFAERKELIAKYVPADVQAIH
Ga0075017_10114388423300006059WatershedsMKWRSLEESGPATDFRLLREIYAERKELIAKYVPAETQAVHAQAV
Ga0075017_10130332413300006059WatershedsMKWRSLAESTPGTDARSLRDIYAERKELIARYVPRET
Ga0075015_10080607523300006102WatershedsMKWRSLDEAVPPEDTRSLHDQFAERKAVIAKYVLPE
Ga0075030_10115841513300006162WatershedsMKWRSLEESGPATDVRPLREIYAARKELIAKYVPAETQNIHAQ
Ga0070712_10025444023300006175Corn, Switchgrass And Miscanthus RhizosphereMKWRSLEDSTPGTDTRSLQDIFAEREALVAKYVPPDIQGVHAR
Ga0070765_10090329923300006176SoilMKWRSLEESTARADVRPLREIYAERKELIAKYVPAETQAVHA
Ga0070765_10226890213300006176SoilMKWRSLEEASPDTDIRPLRDIFAERKELIAKYVPAE
Ga0068871_10104981623300006358Miscanthus RhizosphereMKWRSLEESTAEADLRPLKEIFAERKELIAKYVPAETQAI
Ga0066660_1096960113300006800SoilMMKWRSREESSTRTDTRSLREQFAERKALISQYVPSETQAVHERV
Ga0066660_1129153123300006800SoilMKWRSLEESTFAAETRSLSEIFVERKQLIAQYVPAE
Ga0075433_1018729243300006852Populus RhizosphereMKWRSLEESAWQPQSRTLREVYDERKQLIAQYVPAEIQAV
Ga0075425_10263418813300006854Populus RhizosphereMKWRSLEESAVAADNRPLRDQLAERKQLIEKYVPEA
Ga0075434_10191165213300006871Populus RhizosphereMKWRSLEESSQEETRTLRQIYAERKELIAKYVPADIQAIHARVV
Ga0073928_1083272933300006893Iron-Sulfur Acid SpringMKWRSLGDSNPGLDSRPLHAILTERKELIAKYVPR
Ga0099827_1087300823300009090Vadose Zone SoilMKWRSLEESTPGADLRPLREQFAERKDLIAKYVPPE
Ga0105240_1164834023300009093Corn RhizosphereMKWRSLEESTPGTDTRSLRDIYAERKELIARYVPSETQAVH
Ga0066709_10027978633300009137Grasslands SoilMRWRSLDETTLAVDTRSLRDQFAERKELVAKYVPAEI
Ga0099792_1040489823300009143Vadose Zone SoilMKWRSLAEAGSYTDERPLAEVFAERKDLIAKYVPADVQAVHARTVA
Ga0075423_1110526723300009162Populus RhizosphereMKWRSLDEASQSSDLRPLLDIFAERKELIAKYVPQ
Ga0075423_1194187413300009162Populus RhizosphereMKWRSLEESGEYSDTRPLREIFAERKALIAQYVPPATQAIHEKVVS
Ga0116125_109700933300009628PeatlandMKWRSLQESKPLSETRPLREIFAQRRESIAQYVPAE
Ga0116121_123666313300009644PeatlandMKWRSLEESSPETDIRPLREIFAERKEMIAKYVPAETQAI
Ga0116217_1092928523300009700Peatlands SoilMKWRSLEESGPTTDLRPLREIYAERKELIAKYVPAET
Ga0134070_1008926813300010301Grasslands SoilMKWRSLEESNPGIDTRTLREQLAERKELIAKYVPLDAQAVHV
Ga0126370_1022062633300010358Tropical Forest SoilVKWRSLEEPAVGIDTRPLRDQFAERKQLIAKYVPAEVQAIH
Ga0126370_1229065813300010358Tropical Forest SoilMKWRSLQESGPYSDTRPLKQIFAERQQTIVRYVPAD
Ga0126372_1137890933300010360Tropical Forest SoilMTWRSLEESAVAADNRPLRDQLAERKQLIEKYVPEPVR
Ga0126372_1311077113300010360Tropical Forest SoilMKWRSLEESPIQLETRTLREIYAERKELIAKYVPAEIQAV
Ga0126378_1103383213300010361Tropical Forest SoilMKWRSLDEETAGQATRSLREIYAERKELIAKYVPPGVLSVHRGVV
Ga0126378_1210289113300010361Tropical Forest SoilMTMKWRSLEESAPATDIRPLRDIYAERKELIAKYVPAETQ
Ga0126379_1031940733300010366Tropical Forest SoilMKWRSLEESAPGADARSLREQFAERKELIARYVPRETQTVHER
Ga0136449_10010451683300010379Peatlands SoilVKWRSLDEAAPVEDTRSLHEQFAERKELIGKYVPPETQAI
Ga0136449_10225001333300010379Peatlands SoilMKWRSLEEQSPETDVRALREIFAERTELIAKYVAAET
Ga0126383_1141334113300010398Tropical Forest SoilMKWRSLEESSPATDIRPLHEIYAERKESIAKYAPAATQKVHAQAVA
Ga0126383_1255569823300010398Tropical Forest SoilMKWRSIEESSPPTDLRPLREIYAERKELIAKYVPPDTQAVHAHAVA
Ga0137776_103243013300010937SedimentMKWRSLSESNPSVDFRPLREIYAERKELIAKYVPAETQA*
Ga0137391_1120824913300011270Vadose Zone SoilMKWPSLEESTPGTETRSLHEIFAERKELIAKYVPPETQ
Ga0137391_1127413223300011270Vadose Zone SoilMKWRSLEEHAPAQDTRTLREQFAERKALIAKYVPPETQA
Ga0153933_107709913300011411Attine Ant Fungus GardensMKWRSLEESDPETEARPLREIFAERKELIAKYVPAETQVI
Ga0137389_1131378713300012096Vadose Zone SoilMKWRSLQESAGATDVRPLREVFAERKGLIARYVPPDVQA
Ga0137388_1082472813300012189Vadose Zone SoilMKWRSLEESTAPTDLRSLRDILAERKELIAKYVPTET
Ga0137383_1118926623300012199Vadose Zone SoilMKWRSLEESDSQQESRSLQDILAERKALIAKYVPAEIQDVHS
Ga0137379_1174676823300012209Vadose Zone SoilMKWRSLEESGSYSDTRPLRQIFAERKETIARYVPADVRAIH
Ga0137384_1158568623300012357Vadose Zone SoilMKWRSLDESAAQTETRPLCEIYAERKELIAKYVPA
Ga0137360_1142681313300012361Vadose Zone SoilMKWRSLEESSPGIDTRSLREIYAERKVLIAKYVPAETQA
Ga0137390_1065515333300012363Vadose Zone SoilMKWRSLEEHAPAQDTRTLREQFAERKALIAKYVPSET
Ga0137396_1056434713300012918Vadose Zone SoilMKWHSLEESSQETDTRSLREIFAERKGLIAKYVPPET
Ga0137396_1079378613300012918Vadose Zone SoilMKWRSLEESSPRTDTRSLREVFAERKKLIARYVSP
Ga0137359_1019347013300012923Vadose Zone SoilMKWRSLAETESQTDQRPLREIFAGRKELIAKYVPADVQAVHEGTVATL
Ga0137404_1083475223300012929Vadose Zone SoilMKWRSLQESGVSTDIRPLREIFNERKDLIAKYVPPEAQAI
Ga0137407_1067908913300012930Vadose Zone SoilMKWRSLEESTPRADTRSLQEIFAERQELIAKYVPADIQAVHAR
Ga0137407_1094684223300012930Vadose Zone SoilMKWRSLAESDSQTDQRPLREIFAGRKELIAKYVPADVQAVHE
Ga0137410_1192359813300012944Vadose Zone SoilMKWRSLETNDTDLRPLREIYAERKGLIEKYVPQEIRDVHARVVV
Ga0126369_1199533913300012971Tropical Forest SoilMKWRSLQESQSTSDLRPLRQIFAERKDTIAKYVPPDVQAVHA
Ga0164309_1107605633300012984SoilMKWRSLEESGPSTDLRPLRDIYAERKGLIARYLPA
Ga0157370_1060793823300013104Corn RhizosphereMKWRSLEESAPGTDARLLRDIYAERKELIARYVPPETQAVHAG
Ga0157374_1103843023300013296Miscanthus RhizosphereMKWRSLDEASQSSDLRPLLDIFAERKELIAKYVPQETRDIHARVVA
Ga0157375_1310797813300013308Miscanthus RhizosphereMKWRSLEESGEYNDTRPLREIFAERKKLIAQYVPPATQAIHERVV
Ga0181534_1039577213300014168BogMKWRSLEESGSYDDTRPLRQIFAERKATIAKYVPADV
Ga0137420_128023223300015054Vadose Zone SoilMMKWRSVEESALGTDSRPLRDILAQRKELIAKYVPPET
Ga0137403_1007856023300015264Vadose Zone SoilMKWRSLSKSTPGLDTRPLQEIFAQKKERIAQYVQPETQAGTDEPA*
Ga0132257_10364022223300015373Arabidopsis RhizosphereMKWRSLEESAPGTEARPLRDIYAERKELIARYVPPETQAVHA
Ga0181511_120605433300016702PeatlandMKWRSLQESGSYSDLRPLREIFAERKDAIAKYVPADVQAVHA
Ga0181505_1069734213300016750PeatlandMKWRSLEESGPATDLRPLREIFTERKELIAKYVPPET
Ga0187820_107302423300017924Freshwater SedimentMKWRSLEESVPATDQRPLREVFAERRDLIAKYVPPETQ
Ga0187814_1042556023300017932Freshwater SedimentMKWRWHEESGSSLDRRALHDIYAERKELAAKYVPA
Ga0187801_1007058023300017933Freshwater SedimentMKWRSLEESGSYDDSRPLRQIFAERKELIAKYVPADVQAIH
Ga0187819_1040723413300017943Freshwater SedimentMKFRSLEEAAPRTDKRPLREILAERKQLMAKYVPPETL
Ga0187819_1043382513300017943Freshwater SedimentMKWRSLEESNDVDVRPLREIFAERRELIAKYVPAATQAVH
Ga0187879_1009634923300017946PeatlandMKWRSLEESSPETDTRALREIFAERKELIAKYVPVETQA
Ga0187778_1105001013300017961Tropical PeatlandMKWRSLDEAGPATDTRRLHDIYAERKELIAKYVPAETQ
Ga0187781_1002786143300017972Tropical PeatlandMKWRSLNESSAGVDPRTLREQFAERKALIAKYVTPETQAVHARAIRE
Ga0187777_1092088423300017974Tropical PeatlandMKWRSLDESNTAVDPRTLREQFAERKALIAQYVLPEVQAVHARVIRE
Ga0187782_1060343713300017975Tropical PeatlandMKWRSLDESSRGPDPRPLREQFSERKALVAKYVPPEVQAVH
Ga0187816_1002024733300017995Freshwater SedimentMKWRSLEESGPATDLRPLREIYAERKDLIAKYVPAETQAVHA
Ga0187816_1020930813300017995Freshwater SedimentMKWRSLQESGSYSDVRPLREIFAERKELIAKYVPADV
Ga0187805_1054259723300018007Freshwater SedimentMKWRSLDESDATADTRPLREVFAERRELIAKYVPAET
Ga0187867_1046329913300018033PeatlandMKWRSLQESGSYSDMRPLREIFAERKELIAKYVPAD
Ga0187883_1015779313300018037PeatlandMKWRSLRESGCYNDFRPLREIFAERKDAIAKYVPAD
Ga0187890_1041743123300018044PeatlandMKWRSLEESSPETDIRPLREIFAERKEMIAKYVPAETQAIH
Ga0187784_1151434813300018062Tropical PeatlandMKWRWHENSDVILDRRPLREIYAERKEMIARYVPAETLAVHAQAI
Ga0187772_1100043013300018085Tropical PeatlandMKWRSLEESALGLDTRPLREILAERKETIAKYVPAETQ
Ga0182031_130214423300019787BogMKWRSLSESGSYSDMRPLREIFAERKEAVAKYVPVDVQAVHVRAVAGL
Ga0193723_110675623300019879SoilMKWRSLEESTPGTDSRSLGEIFAERKELIAKYVPR
Ga0193728_118763923300019890SoilMKWRSLEETGRGTDSRSLRELYAERRHLIAKYVPAEIQAIHARAV
Ga0193731_101581113300020001SoilMKWRSLDETTLAADNRSLREQFAERKELIAKYVPE
Ga0193735_107825323300020006SoilMMKWRSVEESALGTDTRPLRDVLAQRKELIAKYVP
Ga0210403_1010790223300020580SoilMKWRSLEESSPALDTRPLRQIFAERKELIAKYVPPETQAIHAR
Ga0210403_1058149823300020580SoilMKWRSLDESVATEDTRSLHQQFAERKELIAKYVLPETQ
Ga0210399_1024261523300020581SoilMKWRSLEESTPGTDTRTLREIFAARKELIAKYVPAEAQTVH
Ga0210399_1085701723300020581SoilMKWRSLEESAHGTDTRPLREIFAERKKKIAEYVPAE
Ga0210399_1156974013300020581SoilMKWRSLEESTPETDIRRLSEILAERKELIAKYVPSETQAV
Ga0210404_1003465113300021088SoilMKWRSLEESSPGIDTRPLREIYAERKELIAKYVPAETQAVHAQAV
Ga0210400_1025012623300021170SoilMWHDMSTMKWRSLEESGPTTDTRSLREIFAERKELIAKYVP
Ga0210388_1050051013300021181SoilMKWRSLEESAPTTDIRPLHEIFAERKELIAKYVRPETQ
Ga0210388_1061520113300021181SoilMKWRSLEESTPDTLERPLREIFAERKQLIAKYVPAEAQAI
Ga0210388_1128713733300021181SoilMKWRSLQESDESTDARPLHEIYAERKELIDKYVPA
Ga0210393_1100090713300021401SoilMKWRSLDESAPSTDTRPLREIFAERKELIAQYVPAAAREVHAR
Ga0210384_1114111423300021432SoilMKWRSLDESAAQVDLRTLREQFAERKRLIAKYALPETQ
Ga0210409_1050030113300021559SoilMKWRSLEESATGSEVRPLREILAERKELIAKYVPV
Ga0126371_1264982013300021560Tropical Forest SoilMKWRSLDEQTSGQTTRSLRQIYAERKELIAKYVLPELQSVHAGVVSELKRS
Ga0242660_104085613300022531SoilMKWRSLEESGPASDVRPLRDIYAERKELIAKYVPAETQ
Ga0242677_103652223300022713SoilMKWRSLEESAPSLDTRPLREIFAERKELIAKYVRPET
Ga0224526_102075423300022872SoilMKWRSLSESGSYSDMRPLREIFAERKEAVAKYVPVDVQAVHVRAV
Ga0224547_103387113300023255SoilMKWRSLQEAGENTDLRPLREILAERKDAITKYVPAE
Ga0224565_103416313300024176Plant LitterMKWRSLEESGPDTDARPLREIFTERKGLIAKYVPLE
Ga0179589_1042538913300024288Vadose Zone SoilMKWRSLAKSTPGLDTRPLQEIFAQKKERIAQYVQPET
Ga0208077_103788513300025427Arctic Peat SoilMKWRSLQESGAYSDMRPLREIFAERKEAIAKYVPADVQAVHARAVD
Ga0208714_106035113300025527Arctic Peat SoilMKWRSLPESGSYSDMRPLREIFAERKDLIAKYVPADVQAVHARAV
Ga0207699_1135981123300025906Corn, Switchgrass And Miscanthus RhizosphereMKWRSLEESSSETDARPLLEIFAERKELIAKYVPAEAQAIHAQ
Ga0207684_1168472913300025910Corn, Switchgrass And Miscanthus RhizosphereMKWRSLEEQAPAQDARTLREQFAERKALVAKYVPPET
Ga0207693_1008550713300025915Corn, Switchgrass And Miscanthus RhizosphereMKWRSLEDSTPGTDTRSLQDIFAEREALVAKYVPPDIQGVHARVIAELKEK
Ga0207693_1100523713300025915Corn, Switchgrass And Miscanthus RhizosphereMKWRSLEESFPGTDTRRLREIYVERKELIAKYVPAET
Ga0207660_1047879913300025917Corn RhizosphereMKWRSLEESGPSSDVRPLREIFAERKELIAKYVPA
Ga0207694_1027181223300025924Corn RhizosphereMKWRSLQESVPGEDLRPLREQFAERKELIDKYVPEEA
Ga0207687_1133413023300025927Miscanthus RhizosphereMKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPPDI
Ga0207665_1050150623300025939Corn, Switchgrass And Miscanthus RhizosphereMKWRSLEESFPGTDTRRLREIYVERKELIAKYVPAETQ
Ga0207689_1066208413300025942Miscanthus RhizosphereMKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPP
Ga0207679_1100053223300025945Corn RhizosphereMKWRSLQESVPGEDLRPLREQFAERKELIDKYVPEEAR
Ga0207703_1139666023300026035Switchgrass RhizosphereMKWRSLEDSTPGTDTRSLQDIFAERKALVAKYVPPDIQGVHARVIAELKE
Ga0207639_1168962323300026041Corn RhizosphereMKWRSLEESAPGTDARPLRDIYAERKELVARYVPP
Ga0209687_118962823300026322SoilMMKWRSREESSTRTDTRSLREQFAERKALISQYVPSETQAV
Ga0209378_115372013300026528SoilMKWRSLEESNPGIDTRTLREQLAERKELIAKYVPLDAQA
Ga0209056_1003497363300026538SoilMKWRSLEESGPSQDTRPLREQFAERKALIAKYVPPETQAIHAQ
Ga0208860_102828513300027076Forest SoilMKWRSLEESAPGLNTRPLREILAERKELIAKYVPAE
Ga0208098_101555513300027172Forest SoilMKWRSPEEPAAGPDVRPLREIFAECKDLIAKYVPAEIQAVH
Ga0209213_102425713300027383Forest SoilMKWRSLDESRPETDVRPLRDIFAERKGLIAKYVPAETQAIHTRAV
Ga0209331_114877213300027603Forest SoilMKWRSLEESTPGTDTRSLRDILSERKELIVRYVPPDIQAVHARVIR
Ga0208827_100983113300027641Peatlands SoilMKWRSLEESSPGTDLRPLREIFAERKELIAKYVPAETQA
Ga0209117_105208223300027645Forest SoilMKWRSLEESTPGSDTRSLQDIFAERKALIAKYVPPDIQSVHA
Ga0209038_1007693423300027737Bog Forest SoilMKWRSLEEANPETDVRPLREIFAERKALITKYVPAETQ
Ga0208989_1006786023300027738Forest SoilMKWRSLEESSAATDIRPLREIFAERKGLIAKHPPAET
Ga0209655_1015804633300027767Bog Forest SoilMKWRSLTESRPPADVRPLREIFLERKELIDKYVPA
Ga0209139_1007589013300027795Bog Forest SoilMKWRSLDESSPATDIRPLAEIFVERKALIAKYVPAELQVVHAGV
Ga0209656_1021784723300027812Bog Forest SoilMKWRSLEESFPRTEQRALREIYAERKELITKYVPAEI
Ga0209180_1011645233300027846Vadose Zone SoilMKWRSLEESGPSQDMRPLREQFAERKALVAKYVPPETQAIHAQ
Ga0209517_1040156213300027854Peatlands SoilMKWRSLAESGSYSDMRPLREIFAERKDAIAKYVPA
Ga0209693_1015945523300027855SoilMKWRSLTELHPVTEARPLREIFAERKELIANYVPAD
Ga0209465_1053485313300027874Tropical Forest SoilMKWRSLEESGLSTDLRPLREIYAERKELIAKYVPQETQKIHTQ
Ga0209169_1036598513300027879SoilMKWRSLEESTPGTDTRPLGEIFAERKALIAQYVPQEIQAIHE
Ga0209590_1088098513300027882Vadose Zone SoilMKWRSLEESGPSQDMRPLREQFAERKALIAKYAPPETQ
Ga0209380_1018788523300027889SoilMKWRSLEESNPETEIRPLQDIFAERKELIAKYVPAETQVIH
Ga0209380_1035142713300027889SoilMKWRSLEESAPSADIRPLREIFAEREELIAKYVPAETRAV
Ga0209380_1085244213300027889SoilMKWRSLQESDSTIGTRPLREIFAERKESIARYVPADVQ
Ga0209624_1058372213300027895Forest SoilMKWRSLEESIPETETRPLREIFAERKEAIGKYVPAETQA
Ga0209415_1076525723300027905Peatlands SoilMKWRSLEESAPGLDARPLREIFAERKELIAKYVPAETQAIHA
Ga0268264_1045810913300028381Switchgrass RhizosphereMPMKWRSLEESDPGTVIRSLHEIFAERKQLIARYVPPET
Ga0302153_1019567113300028574BogMKWRSLQEAGENTDIRPLRDIFAERKELIAKYVPPETQAVTR
Ga0302168_102388823300028639FenMKWRSLQESGAYSDTRPLRQILAERKELIAEYVPADVQD
Ga0302294_1001128133300028740FenMKWRSLQESGAYSDTRPLRQILAERKELIAEYVPADVQAVHARAV
Ga0302289_114756323300028857FenMKWRSLQESGAYSDTRPLRQIFAERKELIAEYVPADVQA
Ga0302197_1033924813300028873BogMKWRSLSESGAYSDMRPLREIFAERKEAIAKYVPHDVQAVHTRAVA
Ga0302177_1058571813300030053PalsaMKWRSLEESRSEIDLRPLREIFAGRKDLIAKYVPAETQAVHAR
Ga0302317_1034213713300030677PalsaMKWRSLEESAPETEIRPLREIFAERKELIAKYVPAE
Ga0170834_10716122813300031057Forest SoilMKWRSLQESDSYRDVRSLREIFSERKELIARYVPADVQAVHAHAVA
Ga0170824_10032370913300031231Forest SoilMKWRSLQESDSYRDVRSLREIFSERKELIARYVPADVQAVH
Ga0265325_1031522623300031241RhizosphereMSSWADMKWRSLEESSPGLDARPLREIYAERRELIAKY
Ga0170820_1292064313300031446Forest SoilMKWRSLEETSAGPDARPLREIFAERKELISKYVPAETQ
Ga0311364_1165251413300031521FenMKWRSLQESGSYSDMRPLREIFAERKELIAKYVPADVQAVHGRAIAD
Ga0307474_1121201913300031718Hardwood Forest SoilMKWRSLEESTPGTDTRSLREQFAERGELIAQYVPPEIQ
Ga0307474_1165980713300031718Hardwood Forest SoilMKWRSLEESVAGTDMRSLREIFAERKALIAQYVPQE
Ga0307469_1193504423300031720Hardwood Forest SoilMKWRSLEESTTGADTRTLGEVFAERKELIAKYVPAETQA
Ga0307478_1150107513300031823Hardwood Forest SoilMKWRSLQAPAAGPDVRPLREIFSECKDLIAKYVPAEIQA
Ga0306921_1046157713300031912SoilMKWRSLEESGLSTDLRPLREIYAERKELIAKYVPQE
Ga0306926_1012906913300031954SoilMKWRSLEESGLSTDLRPLQEIYAERKELIAKYVPQETQ
Ga0306926_1035941213300031954SoilMKWRSLEESTCANDVRPLREIFAERKELIARYVPAETQAVHE
Ga0307479_1081255523300031962Hardwood Forest SoilMKWRSLQESDSYGDVRSLREIFSERKELIAKYVPADV
Ga0307479_1164152823300031962Hardwood Forest SoilMKWRSLEESTPGTDARSLREIFAERKELIAKYVPPETQAV
Ga0311301_1018726513300032160Peatlands SoilMKWRSLEESSPGLDARPLREIFAERKELIAKYVPP
Ga0307470_1000317713300032174Hardwood Forest SoilMKWRSLEESSPGTDMRPLREIFAERKAKIAQYVPAATQ
Ga0307470_1031147223300032174Hardwood Forest SoilMRWRSLEESARGTDARSLREIFAERKAKIAQYVPAETLAVHAGVT
Ga0307470_1075044913300032174Hardwood Forest SoilMKWRSLAESGTNSDVRTLRELYAERKELIAKYVPTDIQTIHERTV
Ga0307471_10078112113300032180Hardwood Forest SoilMKWRSLEESSPETDLRPLRDIFAERKELLAKYVLAETQ
Ga0307472_10070837523300032205Hardwood Forest SoilMKWRSLEESTPGTDIRSLQDILSERKALIARYVPPDIQGVHTRVIG
Ga0306920_10058351923300032261SoilMKWRSLEESTPGADTRSLREIFAERKQKIAQYAPADTQAVHQ
Ga0335085_1229358313300032770SoilMKWRSLDESTSGADLRPLQEIFAGRKELIAKYVPPETQAVHQR
Ga0335082_1012217943300032782SoilMKWRSLDESTSGADLRPLQEIFAGRKELIAKYVPPETQAVHQRA
Ga0335079_1160816813300032783SoilMKWRSLEESGPSSDLRSLREIYAERKELIAKYVPAET
Ga0335078_1237932123300032805SoilMKWRSLQEAAPSADFRPLREIYAERKELIAKYVPAETQV
Ga0335072_1161896223300032898SoilMKWRSLEESSRDLDLRPLREIFAERKEPIAKYVPAETQAIHAEA
Ga0335076_1099922023300032955SoilMKWRSLEESAPGTDLRSLREIFAERKALIAQYVPEAARTVHA
Ga0310914_1047866523300033289SoilMKWRSLDESRPEAGVRSLREIYAERKQLIAKYVPAEIQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.