


| Basic Information | |
|---|---|
| Family ID | F024335 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 206 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MAEERTLGLARAQDYTAEEPSKEELQRRMGEARDSISNTVTEIKE |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 206 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.51 % |
| % of genes near scaffold ends (potentially truncated) | 98.54 % |
| % of genes from short scaffolds (< 2000 bps) | 96.60 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.388 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.816 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.835 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.51% β-sheet: 0.00% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 206 Family Scaffolds |
|---|---|---|
| PF07332 | Phage_holin_3_6 | 95.63 |
| PF00440 | TetR_N | 1.46 |
| PF03938 | OmpH | 0.49 |
| PF12700 | HlyD_2 | 0.49 |
| PF00873 | ACR_tran | 0.49 |
| PF00529 | CusB_dom_1 | 0.49 |
| PF05957 | DUF883 | 0.49 |
| PF16576 | HlyD_D23 | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 206 Family Scaffolds |
|---|---|---|---|
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.36 % |
| Unclassified | root | N/A | 28.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459021|G14TP7Y01BX1XK | Not Available | 547 | Open in IMG/M |
| 2170459021|G14TP7Y02F95Z0 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 2199352025|deepsgr__Contig_67430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
| 3300000550|F24TB_10632438 | Not Available | 663 | Open in IMG/M |
| 3300000550|F24TB_10891523 | Not Available | 616 | Open in IMG/M |
| 3300001139|JGI10220J13317_11637161 | Not Available | 666 | Open in IMG/M |
| 3300002155|JGI24033J26618_1049788 | Not Available | 599 | Open in IMG/M |
| 3300002239|JGI24034J26672_10023171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300003267|soilL1_10040607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium JGI 0001001-H03 | 5929 | Open in IMG/M |
| 3300003319|soilL2_10010337 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300004780|Ga0062378_10024400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1184 | Open in IMG/M |
| 3300004800|Ga0058861_11371052 | Not Available | 663 | Open in IMG/M |
| 3300005293|Ga0065715_10254903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1155 | Open in IMG/M |
| 3300005295|Ga0065707_10628174 | Not Available | 675 | Open in IMG/M |
| 3300005330|Ga0070690_100760757 | Not Available | 748 | Open in IMG/M |
| 3300005331|Ga0070670_100190784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1780 | Open in IMG/M |
| 3300005331|Ga0070670_100845114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300005332|Ga0066388_101680143 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300005343|Ga0070687_100089405 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300005345|Ga0070692_10354478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300005353|Ga0070669_101061488 | Not Available | 697 | Open in IMG/M |
| 3300005440|Ga0070705_100258230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1227 | Open in IMG/M |
| 3300005441|Ga0070700_100375150 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300005441|Ga0070700_100544039 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300005444|Ga0070694_100467915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 998 | Open in IMG/M |
| 3300005536|Ga0070697_101522987 | Not Available | 598 | Open in IMG/M |
| 3300005539|Ga0068853_100330299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1415 | Open in IMG/M |
| 3300005578|Ga0068854_100784747 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005578|Ga0068854_101279421 | Not Available | 660 | Open in IMG/M |
| 3300005615|Ga0070702_100261461 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
| 3300005615|Ga0070702_100262008 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300005615|Ga0070702_100458516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300005617|Ga0068859_100663998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300005618|Ga0068864_100806857 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300005618|Ga0068864_100897730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300005618|Ga0068864_101160807 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005841|Ga0068863_100140286 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300005843|Ga0068860_100113523 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300005843|Ga0068860_101135984 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300005887|Ga0075292_1039041 | Not Available | 668 | Open in IMG/M |
| 3300006046|Ga0066652_100759257 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300006237|Ga0097621_101119514 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300006237|Ga0097621_102138923 | Not Available | 535 | Open in IMG/M |
| 3300006800|Ga0066660_10297906 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300006806|Ga0079220_10392092 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300006852|Ga0075433_10259199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1542 | Open in IMG/M |
| 3300006852|Ga0075433_11057844 | Not Available | 706 | Open in IMG/M |
| 3300006852|Ga0075433_11140130 | Not Available | 677 | Open in IMG/M |
| 3300006904|Ga0075424_100546790 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300006954|Ga0079219_10788397 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300006954|Ga0079219_10994081 | Not Available | 694 | Open in IMG/M |
| 3300006954|Ga0079219_11974109 | Not Available | 554 | Open in IMG/M |
| 3300007004|Ga0079218_10675388 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300009089|Ga0099828_11598631 | Not Available | 574 | Open in IMG/M |
| 3300009100|Ga0075418_10583958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1202 | Open in IMG/M |
| 3300009101|Ga0105247_10650923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 787 | Open in IMG/M |
| 3300009147|Ga0114129_10977565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1067 | Open in IMG/M |
| 3300009148|Ga0105243_10542645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1109 | Open in IMG/M |
| 3300009148|Ga0105243_11697433 | Not Available | 660 | Open in IMG/M |
| 3300009174|Ga0105241_11368470 | Not Available | 676 | Open in IMG/M |
| 3300009176|Ga0105242_10959950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 859 | Open in IMG/M |
| 3300009176|Ga0105242_11296342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 752 | Open in IMG/M |
| 3300010047|Ga0126382_10097073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1892 | Open in IMG/M |
| 3300010110|Ga0126316_1117361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1065 | Open in IMG/M |
| 3300010146|Ga0126320_1074405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 845 | Open in IMG/M |
| 3300010147|Ga0126319_1416068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1095 | Open in IMG/M |
| 3300010147|Ga0126319_1637679 | Not Available | 592 | Open in IMG/M |
| 3300010360|Ga0126372_12345088 | Not Available | 584 | Open in IMG/M |
| 3300010371|Ga0134125_11924514 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010403|Ga0134123_10348017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1337 | Open in IMG/M |
| 3300010874|Ga0136264_10256583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 612 | Open in IMG/M |
| 3300011119|Ga0105246_12086340 | Not Available | 549 | Open in IMG/M |
| 3300011269|Ga0137392_11309394 | Not Available | 584 | Open in IMG/M |
| 3300011271|Ga0137393_11320491 | Not Available | 610 | Open in IMG/M |
| 3300011332|Ga0126317_10386752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
| 3300012212|Ga0150985_111637351 | Not Available | 637 | Open in IMG/M |
| 3300012351|Ga0137386_10754752 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012358|Ga0137368_10427373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 865 | Open in IMG/M |
| 3300012469|Ga0150984_102843476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 978 | Open in IMG/M |
| 3300012479|Ga0157348_1001454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1074 | Open in IMG/M |
| 3300012681|Ga0136613_10393805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 758 | Open in IMG/M |
| 3300012891|Ga0157305_10167287 | Not Available | 605 | Open in IMG/M |
| 3300012904|Ga0157282_10261660 | Not Available | 591 | Open in IMG/M |
| 3300012912|Ga0157306_10430111 | Not Available | 524 | Open in IMG/M |
| 3300012922|Ga0137394_10135434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 2091 | Open in IMG/M |
| 3300012927|Ga0137416_10430410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1124 | Open in IMG/M |
| 3300012955|Ga0164298_10015391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3121 | Open in IMG/M |
| 3300012957|Ga0164303_10414806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 836 | Open in IMG/M |
| 3300012989|Ga0164305_11200991 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300013102|Ga0157371_11198879 | Not Available | 585 | Open in IMG/M |
| 3300013297|Ga0157378_10112412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2498 | Open in IMG/M |
| 3300013306|Ga0163162_11249891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300013306|Ga0163162_12587041 | Not Available | 584 | Open in IMG/M |
| 3300013307|Ga0157372_10902219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1025 | Open in IMG/M |
| 3300013307|Ga0157372_11666838 | Not Available | 734 | Open in IMG/M |
| 3300014326|Ga0157380_10041639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3586 | Open in IMG/M |
| 3300014745|Ga0157377_11292632 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300014877|Ga0180074_1019627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1310 | Open in IMG/M |
| 3300015374|Ga0132255_104878475 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300017792|Ga0163161_11774421 | Not Available | 548 | Open in IMG/M |
| 3300018028|Ga0184608_10170975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 944 | Open in IMG/M |
| 3300018066|Ga0184617_1174727 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300018422|Ga0190265_10515821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1309 | Open in IMG/M |
| 3300018429|Ga0190272_10299724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1245 | Open in IMG/M |
| 3300018429|Ga0190272_12160325 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300018432|Ga0190275_13140727 | Not Available | 534 | Open in IMG/M |
| 3300018920|Ga0190273_11030392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 682 | Open in IMG/M |
| 3300019254|Ga0184641_1324225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300019254|Ga0184641_1334117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 776 | Open in IMG/M |
| 3300019255|Ga0184643_1319774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 718 | Open in IMG/M |
| 3300019269|Ga0184644_1009015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 799 | Open in IMG/M |
| 3300019269|Ga0184644_1080527 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300019279|Ga0184642_1039369 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300019279|Ga0184642_1528810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 939 | Open in IMG/M |
| 3300019377|Ga0190264_10277752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 995 | Open in IMG/M |
| 3300019767|Ga0190267_10656900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 664 | Open in IMG/M |
| 3300019767|Ga0190267_11241664 | Not Available | 550 | Open in IMG/M |
| 3300019883|Ga0193725_1043499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1166 | Open in IMG/M |
| 3300020080|Ga0206350_10891477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 977 | Open in IMG/M |
| 3300020610|Ga0154015_1277701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 949 | Open in IMG/M |
| 3300021078|Ga0210381_10348864 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021418|Ga0193695_1040911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1004 | Open in IMG/M |
| 3300021951|Ga0222624_1160772 | Not Available | 557 | Open in IMG/M |
| 3300021951|Ga0222624_1614949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 808 | Open in IMG/M |
| 3300025901|Ga0207688_10248823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1076 | Open in IMG/M |
| 3300025901|Ga0207688_10934748 | Not Available | 549 | Open in IMG/M |
| 3300025914|Ga0207671_11003005 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300025918|Ga0207662_11155414 | Not Available | 550 | Open in IMG/M |
| 3300025918|Ga0207662_11190804 | Not Available | 542 | Open in IMG/M |
| 3300025922|Ga0207646_11473058 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300025923|Ga0207681_10746580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 815 | Open in IMG/M |
| 3300025926|Ga0207659_11219628 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300025934|Ga0207686_10632096 | Not Available | 845 | Open in IMG/M |
| 3300025934|Ga0207686_10753254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 778 | Open in IMG/M |
| 3300025934|Ga0207686_11370138 | Not Available | 582 | Open in IMG/M |
| 3300025936|Ga0207670_10282215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1295 | Open in IMG/M |
| 3300025936|Ga0207670_11555023 | Not Available | 562 | Open in IMG/M |
| 3300025936|Ga0207670_11681015 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300025938|Ga0207704_10592483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 906 | Open in IMG/M |
| 3300025938|Ga0207704_11779225 | Not Available | 530 | Open in IMG/M |
| 3300025942|Ga0207689_10247582 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300025945|Ga0207679_10342621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1300 | Open in IMG/M |
| 3300025960|Ga0207651_10803252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 834 | Open in IMG/M |
| 3300025960|Ga0207651_11675864 | Not Available | 573 | Open in IMG/M |
| 3300025986|Ga0207658_11078647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 733 | Open in IMG/M |
| 3300025993|Ga0208415_1032716 | Not Available | 514 | Open in IMG/M |
| 3300026035|Ga0207703_10629005 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1017 | Open in IMG/M |
| 3300026041|Ga0207639_10695797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 943 | Open in IMG/M |
| 3300026075|Ga0207708_10782390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 820 | Open in IMG/M |
| 3300026089|Ga0207648_10553095 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300026095|Ga0207676_10629214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1033 | Open in IMG/M |
| 3300026095|Ga0207676_10688945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 989 | Open in IMG/M |
| 3300026095|Ga0207676_10802842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300026095|Ga0207676_11490402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 673 | Open in IMG/M |
| 3300026116|Ga0207674_11655347 | Not Available | 608 | Open in IMG/M |
| 3300026312|Ga0209153_1145991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 887 | Open in IMG/M |
| 3300026497|Ga0257164_1029547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 818 | Open in IMG/M |
| 3300026538|Ga0209056_10669783 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026770|Ga0207537_102641 | Not Available | 646 | Open in IMG/M |
| 3300027717|Ga0209998_10198071 | Not Available | 524 | Open in IMG/M |
| 3300028381|Ga0268264_10708702 | Not Available | 1000 | Open in IMG/M |
| 3300028381|Ga0268264_11120469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 796 | Open in IMG/M |
| 3300028381|Ga0268264_12394417 | Not Available | 534 | Open in IMG/M |
| 3300028536|Ga0137415_10290356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1440 | Open in IMG/M |
| 3300030785|Ga0102757_11385362 | Not Available | 616 | Open in IMG/M |
| 3300030785|Ga0102757_11457545 | Not Available | 710 | Open in IMG/M |
| 3300030866|Ga0102744_1014782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1103 | Open in IMG/M |
| 3300030902|Ga0308202_1047981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 776 | Open in IMG/M |
| 3300030903|Ga0308206_1025568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1035 | Open in IMG/M |
| 3300030903|Ga0308206_1052070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 815 | Open in IMG/M |
| 3300030960|Ga0102745_1009361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 998 | Open in IMG/M |
| 3300030989|Ga0308196_1051986 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300030993|Ga0308190_1036559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 893 | Open in IMG/M |
| 3300030993|Ga0308190_1060162 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300030993|Ga0308190_1080173 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300030993|Ga0308190_1112695 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300030993|Ga0308190_1187891 | Not Available | 514 | Open in IMG/M |
| 3300031058|Ga0308189_10181143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 748 | Open in IMG/M |
| 3300031091|Ga0308201_10164589 | Not Available | 706 | Open in IMG/M |
| 3300031092|Ga0308204_10129347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300031093|Ga0308197_10076461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 936 | Open in IMG/M |
| 3300031093|Ga0308197_10318443 | Not Available | 580 | Open in IMG/M |
| 3300031093|Ga0308197_10358515 | Not Available | 557 | Open in IMG/M |
| 3300031094|Ga0308199_1149127 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031096|Ga0308193_1010346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1069 | Open in IMG/M |
| 3300031097|Ga0308188_1005670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 972 | Open in IMG/M |
| 3300031114|Ga0308187_10072209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1009 | Open in IMG/M |
| 3300031114|Ga0308187_10077568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 984 | Open in IMG/M |
| 3300031114|Ga0308187_10109490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 870 | Open in IMG/M |
| 3300031114|Ga0308187_10167500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 746 | Open in IMG/M |
| 3300031114|Ga0308187_10386129 | Not Available | 549 | Open in IMG/M |
| 3300031114|Ga0308187_10496465 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031123|Ga0308195_1013587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 925 | Open in IMG/M |
| 3300031123|Ga0308195_1027982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 729 | Open in IMG/M |
| 3300031422|Ga0308186_1004670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1052 | Open in IMG/M |
| 3300031547|Ga0310887_10302425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300031547|Ga0310887_10313801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 898 | Open in IMG/M |
| 3300031820|Ga0307473_10330686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 972 | Open in IMG/M |
| 3300031824|Ga0307413_10898826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 752 | Open in IMG/M |
| 3300031847|Ga0310907_10285674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 825 | Open in IMG/M |
| 3300031858|Ga0310892_11182135 | Not Available | 545 | Open in IMG/M |
| 3300032002|Ga0307416_102987231 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300033412|Ga0310810_10473487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1258 | Open in IMG/M |
| 3300033412|Ga0310810_11028402 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300033475|Ga0310811_10962119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 756 | Open in IMG/M |
| 3300033475|Ga0310811_11079792 | Not Available | 685 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.34% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.88% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.91% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.97% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.97% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.49% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.49% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.49% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.49% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.49% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.49% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010110 | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010874 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012479 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610 | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026770 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030866 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030960 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4NP_00688160 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MAEERALGLARAQDYPAEGEPSKEELQRRMGQARDSITNTVTEIKETVANQ |
| 4NP_03334070 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MAEERNLGLARAREADVEDPSKEALQRRMEEARDSITNTVTEIKDN |
| deepsgr_00893080 | 2199352025 | Soil | MAEERTLGLARAHEEQSVEPSKEELQRRLDEARDSISNTVIEIKETVANQVQAV |
| F24TB_106324382 | 3300000550 | Soil | MAEERTLGLARAHEEKVEEPSKEDLQRRLDEARDSISHTVIEIKETVANQVQAVK |
| F24TB_108915232 | 3300000550 | Soil | MAEERTLGLARAPEQSTEDLSKEELQRRMGVARDSISSTVSEIKETVAHQ |
| JGI10220J13317_116371612 | 3300001139 | Soil | MAEERTLGLARAQEQTSEEPSKEELQRRMGEARDSITNTVSEIKETVAN |
| JGI24033J26618_10497881 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAQDYTAEEPSKEELQRRMGEARDSISNTVTEIKE |
| JGI24034J26672_100231713 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLXRVQESXPEDVSKEELQRRMDEARYSISHT |
| soilL1_100406079 | 3300003267 | Sugarcane Root And Bulk Soil | MAEERTLGLARVQDQPSEEPSKEELQRRLDHTRDSISQTVTEIKETV |
| soilL2_100103374 | 3300003319 | Sugarcane Root And Bulk Soil | MAEERTLGLARAEEYTTEEPSKEELQRRLGQARDSITTTVSEIKETVA |
| Ga0062378_100244001 | 3300004780 | Wetland Sediment | MAEEGTLGLVRAREREAEAEEPSKEALQRRMEQARDLITHTVTEIKENVTQQ |
| Ga0058861_113710522 | 3300004800 | Host-Associated | MAEERTLGLARAQEQSGEEPSKQELQRRLDEARDSISHTVTEIKESVASQVQAVKETLDWRE |
| Ga0065715_102549033 | 3300005293 | Miscanthus Rhizosphere | MAEERTLGLARAQDYSTEGEPSKEELQRRLGEARDSITNTVTEIKET |
| Ga0065707_106281742 | 3300005295 | Switchgrass Rhizosphere | MAEERTLGLARAQETSADDLSKEELQRQMDRARDSISNTVTEI |
| Ga0070690_1007607573 | 3300005330 | Switchgrass Rhizosphere | MAEEGTLGLARAHDEGGEELSKEQLQRELDQARDSISNTVTEIRET |
| Ga0070670_1001907844 | 3300005331 | Switchgrass Rhizosphere | MAEERTLGLARAYEETAEEPSKQELQRRLDEARDSISHTVTEIKESVASQ |
| Ga0070670_1008451141 | 3300005331 | Switchgrass Rhizosphere | MAEERTLGLARASDTPAEEPSKEELQRRMDRARDSISHTVTE |
| Ga0066388_1016801433 | 3300005332 | Tropical Forest Soil | MAEERTLGLARAQATSSAEDPSKEELQRRMNQARDSISNTVTEIKETVANQV |
| Ga0070687_1000894051 | 3300005343 | Switchgrass Rhizosphere | MAEERTLGLARSQSEYAEEPSKEELQRRLEKSRDSISSTVTEIKET |
| Ga0070692_103544783 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAQDLTTEEPSKEELQRRMGEARDSITNTV |
| Ga0070669_1010614881 | 3300005353 | Switchgrass Rhizosphere | MAEERTLGLARAEERTAGEPSKEELQRRLGEARDSISSTVTEIKE |
| Ga0070705_1002582304 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLSVAREPNGEDASKEALQRRMEQARDSISNTVTEIKENVTQQ |
| Ga0070700_1003751503 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAYDKEELGNDELSKEALQARMDEARDSISQTVTEIKDNVT |
| Ga0070700_1005440393 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAQDYTAEEPSKEDLQRRMGEARDSISNTVTEIKETVA |
| Ga0070694_1004679153 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARARETEGEDDSKAALQRRMDEARDSISNTVTEIKDNVAQQYESVKD |
| Ga0070697_1015229872 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAQETSSAEDPSKEELQRRMNQARDSISNTVTEIKETVANQV |
| Ga0068853_1003302994 | 3300005539 | Corn Rhizosphere | MAEERTLGLARSQSEYAEEPSKEELQRRLEKSRDSISSTVTEIKE |
| Ga0068854_1007847473 | 3300005578 | Corn Rhizosphere | MAEERNLGLARARETSNEDASKEALQRRMEEARDSISNTVTEIKDNVA |
| Ga0068854_1012794213 | 3300005578 | Corn Rhizosphere | MAEERTLGLARAEERTAGEPSKEELQRRLGEARDSISSTVTEIKETV |
| Ga0070702_1002614613 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARASETTEEPSKEELQRRMNVARDSITNTVTEIKETVA |
| Ga0070702_1002620083 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAEERTAGEPSKEELQRRLGEARDSISSTVTEIKETVAS |
| Ga0070702_1004585163 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEERTLAFARAREGKDDELSKEELQVRMEETRDSITQTVSDIKE |
| Ga0068859_1006639981 | 3300005617 | Switchgrass Rhizosphere | MAEEGTLGLARAQDEIGEDLSKEQLQRELDQARDSISNTVTEIRETVANQVQAVKDTL |
| Ga0068864_1008068573 | 3300005618 | Switchgrass Rhizosphere | MAEERTLGLARAQDYTAEEPSKEELQRRLGEARDSITNTVTEI |
| Ga0068864_1008977301 | 3300005618 | Switchgrass Rhizosphere | MAEERTLGLARAQETSSAEDPSKEELQRRMNQARDSISNTV |
| Ga0068864_1011608073 | 3300005618 | Switchgrass Rhizosphere | MAEERTLGLARAYDRDDEELSKEALQARMDEARDSISQTVTEIKDNVTQQYENVKDALDWKEHFRA |
| Ga0068863_1001402864 | 3300005841 | Switchgrass Rhizosphere | MAEERTLGLARARDTVETFDEQPSKEELQRRMEEARDSITNTVTEI |
| Ga0068860_1001135231 | 3300005843 | Switchgrass Rhizosphere | MAEERTLGLARAQDLTTEEPSKEELQRRMGEARDSI |
| Ga0068860_1011359841 | 3300005843 | Switchgrass Rhizosphere | MAEERTLGLARAYDKEELGNDELSKEALQARMDEARDSISQTVTEIKDNVTQQYENVKDA |
| Ga0075292_10390411 | 3300005887 | Rice Paddy Soil | MAEERTLGLARAQEHSTSEEPSKEELQRRLGQARDSITNT |
| Ga0066652_1007592573 | 3300006046 | Soil | MAEERTLGLARAQEQTGDEPSKQELQRRLDEARDSISHTVTEIRETVANQVQAVKETLDW |
| Ga0097621_1011195143 | 3300006237 | Miscanthus Rhizosphere | MAEERTLGLARAQDLTAEEPSKEELQRRMGEARDSI |
| Ga0097621_1021389231 | 3300006237 | Miscanthus Rhizosphere | MAEERTLGLARAQEQTAEEPSKQELQRRLDEARDSISH |
| Ga0066660_102979061 | 3300006800 | Soil | MAEEGTLGLARASGDSDDGDEPSKEELQRRMEEARESIT |
| Ga0079220_103920921 | 3300006806 | Agricultural Soil | MAEERTLGLARAQDQTGEEPSKQELQRRLDEARDSISHTVTEIKE |
| Ga0075433_102591991 | 3300006852 | Populus Rhizosphere | MAEERNLGIARAPQRSGEEESIEQLQKRMELARDSISHTVTEIKE |
| Ga0075433_110578443 | 3300006852 | Populus Rhizosphere | MAEERTLGLARAQEQTAEEPSKEELQRRLDHTRDSITHTVTEIKETVAN |
| Ga0075433_111401302 | 3300006852 | Populus Rhizosphere | MAEERTLGLARAQDYSTEGEPSKEELQRRLGEARDSITNTVTEI |
| Ga0075424_1005467903 | 3300006904 | Populus Rhizosphere | MAEERTLGLARAQETSSAEDPSKEELQRRMNQARDSISNTVTEIKETVANQVQAVK |
| Ga0079219_107883971 | 3300006954 | Agricultural Soil | MAEERTLGLARAQDHSTEGEPSKEELQRRLGQARDSITNTVTEIKETVANQVQA |
| Ga0079219_109940813 | 3300006954 | Agricultural Soil | MAEERTLGLARAQEQTGGEEPSKQELQRRLDEARDSISHTVTEIKES |
| Ga0079219_119741091 | 3300006954 | Agricultural Soil | MAEERTLGLARAREQTGEEPSKQELQRRLDEARDSISHTVTEIKES |
| Ga0079218_106753883 | 3300007004 | Agricultural Soil | MAEERTLGLARAQEQEWSSEEPSKEELQRRLDETRD |
| Ga0099828_115986311 | 3300009089 | Vadose Zone Soil | MAEERTLGQAHARAVTEDEPSKEELQRRMEEARDSISHIVT |
| Ga0075418_105839583 | 3300009100 | Populus Rhizosphere | MAEERTLGLARAQEQEWSSEEPSKEELQRRLENTRDSISQTVTEI |
| Ga0105247_106509231 | 3300009101 | Switchgrass Rhizosphere | MAEEGTLGLARAQDEIGEDLSKEQLQRELDQARDSISNTVTEIR |
| Ga0114129_109775653 | 3300009147 | Populus Rhizosphere | MAEERTLGLARTQEQEWSSEEPSKEELQRRLENTRDSISQTVTEIKETVANQV |
| Ga0105243_105426451 | 3300009148 | Miscanthus Rhizosphere | MAEERTLGLARARETSTETWGEEPSKEELQRRMEEARDSITNTVTEIK |
| Ga0105243_116974332 | 3300009148 | Miscanthus Rhizosphere | MAEEGTLGLARAQDEIGEDLSKEQLQRELDQARDSISNTVTEIRE |
| Ga0105241_113684701 | 3300009174 | Corn Rhizosphere | MAEEGTLGLARAQDEIGEDLSKEQLQRELDQARDSISNTVTEIRETVANQVQAV |
| Ga0105242_109599501 | 3300009176 | Miscanthus Rhizosphere | MAEERTLGLARARETSGDEASKEELQRRMDEARDSITNT |
| Ga0105242_112963423 | 3300009176 | Miscanthus Rhizosphere | MAEERTLGLARAQDQTAEEPSKEELQRRLGEARDSISNTVTEIKETVANQV |
| Ga0126382_100970734 | 3300010047 | Tropical Forest Soil | MARAQDYKTGEPSKEELQRRLGEARDSISNTVTEIKETVAHQVKAV |
| Ga0126316_11173611 | 3300010110 | Soil | MAEERTLGIARARETSTEAWGDEPSKEELQRRMEVARDSITNTVTEIKENVAQQVENVKD |
| Ga0126320_10744051 | 3300010146 | Soil | MAEERTLGLARAQEHSAEEPSKEELQRRLGEARDSITNTVSE |
| Ga0126319_14160683 | 3300010147 | Soil | MVEEGTLGLARAHDTSGDEPSKEELQRRMDEARDSISQTVTEIK |
| Ga0126319_16376792 | 3300010147 | Soil | MAEERTLGLARASERIGDDESKEDLQRRLDLARNSISHTVSEIKETV |
| Ga0126372_123450881 | 3300010360 | Tropical Forest Soil | MAEEQTLGLARAQEQTGSEPSKQELQRRLDEARDSISHTVTEIKESVANQVQAVKQT |
| Ga0134125_119245141 | 3300010371 | Terrestrial Soil | MAEERNLGLARARETSDDDPSKEALQRRMEEARDSITNTVTEIKDNVA |
| Ga0134123_103480173 | 3300010403 | Terrestrial Soil | MAEERTLGLARARETEGEDDSKAALQRRMDEARDSISNTVTEIKDNVAQQYESVKDALDW |
| Ga0136264_102565831 | 3300010874 | Soil | MAEELTLGQTRAYDGDDEEPSKEELQRRMEEARESITQTVTEIKETVKN |
| Ga0105246_120863402 | 3300011119 | Miscanthus Rhizosphere | MAEERTLGLARAHEELSAEPSKEELQRRMDEARDSISNTVIEIKETVA |
| Ga0137392_113093942 | 3300011269 | Vadose Zone Soil | MAEERTLGLARARETGDEDASKEALQRRMEEARDSIT |
| Ga0137393_113204912 | 3300011271 | Vadose Zone Soil | MAEERTLGQAHARAVTEDEPSKEELQRRMEEARDSISHIVTELNDTVVNK |
| Ga0126317_103867523 | 3300011332 | Soil | MAEERTLGLARVQDQPAEEPSKEELQRRLDHTRDSISQTVTEIKETVA |
| Ga0150985_1116373511 | 3300012212 | Avena Fatua Rhizosphere | MAEEGTLGIGRARDREATDEGPSKEELQRRMEQARDSE |
| Ga0137386_107547522 | 3300012351 | Vadose Zone Soil | MAEERNLGLARASQRTGEDESKEELQRRMDLALDTISHTVTEIKESVAQQYKAVKDT |
| Ga0137368_104273733 | 3300012358 | Vadose Zone Soil | MAEERTLGLARAREAGDEEPSKEDLQRRMEETRDSITNTVTEIKESVA |
| Ga0150984_1028434761 | 3300012469 | Avena Fatua Rhizosphere | MAEERTLGLVRTHDQSSEDLSKEDLQRRLDDALGSITNTVTEIKETVANQVQA |
| Ga0157348_10014541 | 3300012479 | Unplanted Soil | MAEERTLGLARAHEELSAEPSKEELQRRLDAARDSISHTVIEIKETVANQV |
| Ga0136613_103938051 | 3300012681 | Polar Desert Sand | MAEERTLGLARAPEVREDVREEDLSKNELQLRMDEARDSITQTVTEIKETVVQQYETVKEALD |
| Ga0157305_101672871 | 3300012891 | Soil | MAEERTLGLARAYDKDEPGTDELSKEALQARMDEARDSISQTVTEIKDNVTQQYEN |
| Ga0157282_102616602 | 3300012904 | Soil | MAEERTLGLARARDYSDDEPSKEELQRRMDEARDSISNTVTEI |
| Ga0157306_104301111 | 3300012912 | Soil | MAEERTLGLARAQDYTAEEPSKEELQRRMDEARDSIT |
| Ga0137394_101354341 | 3300012922 | Vadose Zone Soil | MAEERTLGLARAPEHPAEELSKEELQRRMEEARDS |
| Ga0137416_104304103 | 3300012927 | Vadose Zone Soil | MAEERTLGIARAREDYGEDTSKEVLQRRMEEARDSITNTVTEIKENVA |
| Ga0164298_100153911 | 3300012955 | Soil | MAEERTLGLARARETSGESWGEEPSKEALQRRMEEARDSISNTVTEIKENVAQQVESVKD |
| Ga0164303_104148063 | 3300012957 | Soil | MAEERTLGLARARETSGESWGEEPSKEALQRRMEEA |
| Ga0164305_112009911 | 3300012989 | Soil | MAEERNLGLARARETEDADPSKAALQRRMEEARDSITNTVTEIKDNV |
| Ga0157371_111988791 | 3300013102 | Corn Rhizosphere | MAEERTLGLARAQNEYAEEPSKEELQRRLEKSRDSISSTVTEIKETVANQ |
| Ga0157378_101124121 | 3300013297 | Miscanthus Rhizosphere | MAEERTLGLGVAREAIGEDDSKEVLQRRMEQARDSISNTVTEIKENVTQQYETVKD |
| Ga0163162_112498913 | 3300013306 | Switchgrass Rhizosphere | MAEERTLGLARVQESAPEDVSKEELQRRMDEARYS |
| Ga0163162_125870412 | 3300013306 | Switchgrass Rhizosphere | MAEERTLGLARAEEYTTEEPSKEELQRRLGQARDSITSTVSEIKE |
| Ga0157372_109022193 | 3300013307 | Corn Rhizosphere | MAEERTLGLARAPEQTSEEPSKEELQRRMGQARDSITNTVSEIKETVAN |
| Ga0157372_116668382 | 3300013307 | Corn Rhizosphere | MAEERTLGLARAQDRPSEEPSKEELQRRLDETRDSISQTVTEIKENVANQVKAV |
| Ga0157380_100416391 | 3300014326 | Switchgrass Rhizosphere | MAEERTLGLARAYDKEELGNDELSKEALQARMDEARDSI |
| Ga0157377_112926322 | 3300014745 | Miscanthus Rhizosphere | MAEERTLGIAPARETPNETWGDEPSKEELQRRMEQARDSITNTVTEIKENVAQQVE |
| Ga0180074_10196271 | 3300014877 | Soil | MAEERTLGLARARETSTETWGEEPSKEELQRRMEEARDSITNTVTEIKENVAQQVET |
| Ga0132255_1048784752 | 3300015374 | Arabidopsis Rhizosphere | MAEERTLGLARAPQQSTEDISKEELQRRMDVARDSISNTVSEIKETVANQ |
| Ga0163161_117744211 | 3300017792 | Switchgrass Rhizosphere | MAEERTLGLARVQEPSVEPSKEELQRRLDHTRDSISQTVTEIKET |
| Ga0184608_101709751 | 3300018028 | Groundwater Sediment | MAEERTLGLARAREASGETWGEERSKEELQRRMEEARDSISNTVTEIKENVAQQVEN |
| Ga0184617_11747272 | 3300018066 | Groundwater Sediment | MAEERTLGLARARETSTETWSEEPSKEELQRRMEEARDSITNTVTEIKENVAQQVE |
| Ga0190265_105158211 | 3300018422 | Soil | MAEERTLGLARAHELTAEEPSKEELQRRLGEARDSISNTVT |
| Ga0190272_102997241 | 3300018429 | Soil | MAEERTLGLARAREPYGEEASKEELQRRMEEARDSITNTV |
| Ga0190272_121603252 | 3300018429 | Soil | MAEERTLGLARAQEQTTEEPSKEELQRRLGEARDSITNTVTEIKETVAN |
| Ga0190275_131407272 | 3300018432 | Soil | MAEERNLGLARARDTWDEEPSKEELQRRMEEARDSITNTVSEIKENVALQ |
| Ga0190273_110303923 | 3300018920 | Soil | MAEERTVGLARAYDKEDEDLSKEALQARMEEARDSITQTV |
| Ga0184641_13242252 | 3300019254 | Groundwater Sediment | MAEERTLGLARARDLSDEDLSKEELQLRMEEARDSITQTVTEIK |
| Ga0184641_13341173 | 3300019254 | Groundwater Sediment | MAEERTLGLARARDTVETVDEQPSKEELQRRMEEARDSI |
| Ga0184643_13197742 | 3300019255 | Groundwater Sediment | MAEERTLGIARARAVDGEDGSREALQRRMELARDSISNTVTEIKENVAQQVETVKTHSIGVNTSRKRRSPGA |
| Ga0184644_10090151 | 3300019269 | Groundwater Sediment | MAEERTLGLARAREVADEDLSKEELQLRMEEARDSITQTVTEIK |
| Ga0184644_10805271 | 3300019269 | Groundwater Sediment | MAEERTLGLSIAREANGEDDSKEALQRRMEQARDSISNTVTEIKENVTQQYET |
| Ga0184642_10393692 | 3300019279 | Groundwater Sediment | MAEERNLGLARARETGEDDPSKEALQRRMEEARDSITNTV |
| Ga0184642_15288103 | 3300019279 | Groundwater Sediment | MAEERTLGLARAREGYDGEESKEALQRRMEEARDSISSTVTEIKENVAQ |
| Ga0190264_102777521 | 3300019377 | Soil | MAEERTLGLARALDTVETVDEPSKEELQRRMEEARD |
| Ga0190267_106569001 | 3300019767 | Soil | MAEERTLGLARARETEDEDLSKADLQRRMEEARDS |
| Ga0190267_112416641 | 3300019767 | Soil | MAEERNLGLARARETGDEDPSKADLQRRMEEARDSITNTVSE |
| Ga0193725_10434991 | 3300019883 | Soil | MAEERTLGLARAREAGDEEPSKEELQRRMDEARDSITNTVTEIKEN |
| Ga0206350_108914771 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAQDYSTEGEPSKEELQRRLGEARDSISNTVTEIK |
| Ga0154015_12777013 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGIARARDTVETFDEQPSKEELQRRMEEARDSITN |
| Ga0210381_103488642 | 3300021078 | Groundwater Sediment | MAEERNLGLARARETSNEDASKEALQRRMEEARDSITNTVTEIKDNVAQQ |
| Ga0193695_10409113 | 3300021418 | Soil | MAEERTLGLARAYDREAETEDPSKEALQRRMEQARDSITNTVTEIKENVAQQYES |
| Ga0222624_11607721 | 3300021951 | Groundwater Sediment | MAEERTLGLARVRDDVDEEPSKEELQRRLDETRDSISQTVTEIRETV |
| Ga0222624_16149493 | 3300021951 | Groundwater Sediment | MAEEGTLGLAREPAAERMEPSKEELQRRMEQARDSISQT |
| Ga0207688_102488233 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARVQESAPEDVSKEELQRRMDEARYSISHTV |
| Ga0207688_109347481 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAQDYTAEEPSKEALQRRAEEARDSISSTVTEIKE |
| Ga0207671_110030052 | 3300025914 | Corn Rhizosphere | MAEERTLGLARAQDYSTEGEPSKEELQRRLGEARD |
| Ga0207662_111554141 | 3300025918 | Switchgrass Rhizosphere | MAEERTLGLARSQSEYAEEPSKEELQRRLEKSRDSISSTVTEIKETVAN |
| Ga0207662_111908041 | 3300025918 | Switchgrass Rhizosphere | MAEERTLGLARAEERTSGEPSKEELQRRLGEARDSISSTVTEIKET |
| Ga0207646_114730581 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARARETLTETLGEEPSKEELQRRMEEAR |
| Ga0207681_107465803 | 3300025923 | Switchgrass Rhizosphere | MAEERTLGLARVQESAPEDVSKEELQRRMDEARYSI |
| Ga0207659_112196281 | 3300025926 | Miscanthus Rhizosphere | MAEERTLGIARARDTVETFDEQPSKEELQRRMEEARDSITNT |
| Ga0207686_106320961 | 3300025934 | Miscanthus Rhizosphere | MAEERTLGLARARETSGDEASKEELQRRMDEARDSIT |
| Ga0207686_107532541 | 3300025934 | Miscanthus Rhizosphere | MAEERTLGIAPARETPNETWGDEPSKEELQRRMEQARDSITNTVTE |
| Ga0207686_113701382 | 3300025934 | Miscanthus Rhizosphere | MAEERTLGLARAHEELSAEPSKEELQRRMDEARDSISNTVIEIKETVANQV |
| Ga0207670_102822151 | 3300025936 | Switchgrass Rhizosphere | MAEERTLGLARAQDLTTEEPSKEELQRRLGEARDSITNTVS |
| Ga0207670_115550231 | 3300025936 | Switchgrass Rhizosphere | MAEERTLGLARVQEPSVEPSKEELQRRLDHTRDSI |
| Ga0207670_116810152 | 3300025936 | Switchgrass Rhizosphere | MAEERTLGLARAYDKEELGNDELSKEALQARMDEARDSISQTVTEIKDNVTQQYE |
| Ga0207704_105924833 | 3300025938 | Miscanthus Rhizosphere | MAEERTLGLARAPQQSNEDLSKEELQRRMDVARDSISNTVSEIKETVANQVQ |
| Ga0207704_117792252 | 3300025938 | Miscanthus Rhizosphere | MAEERTLGIARARDTVETVDDQPSKEELQRRMEEARDSIT |
| Ga0207689_102475823 | 3300025942 | Miscanthus Rhizosphere | MAEERTLGLARAPEQTSEEPSKEELQRRMGQARDSITNTVSEIK |
| Ga0207679_103426211 | 3300025945 | Corn Rhizosphere | MAEEGTLGLARAQEEGGEELSKEQLQRELDEARDSISNTVTEIRETVANQVQA |
| Ga0207651_108032523 | 3300025960 | Switchgrass Rhizosphere | MAEERTLGLARAQDYTAEEPSKEELQRRMGEARDSI |
| Ga0207651_116758642 | 3300025960 | Switchgrass Rhizosphere | MAEEGTLGLARAQDEIGEDLSKEQLQRELDQARDSISNT |
| Ga0207658_110786473 | 3300025986 | Switchgrass Rhizosphere | MAEERTLGLARASDTTAEDPSKEELQRRMDQARDSISHTVTEI |
| Ga0208415_10327162 | 3300025993 | Rice Paddy Soil | MAEERTLGLARAQEHSTSEEPSKEELQRRLGQARD |
| Ga0207703_106290051 | 3300026035 | Switchgrass Rhizosphere | MAEERTLGLARAPQQSNEDLSKEELQRRMDVARDSISNTVSEIKETV |
| Ga0207639_106957973 | 3300026041 | Corn Rhizosphere | MAEERTLGLARAQDYTSEEPSKEELQRRLGEARDSITNTVTE |
| Ga0207708_107823903 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTLGLARAYDKEELGNDELSKEALQARMDEARDSISQTVTEIKDNVTQ |
| Ga0207648_105530953 | 3300026089 | Miscanthus Rhizosphere | MAEERTLGLARAYDKEELGNDELSKEALQARMDEARDSISQTVTEIKDNVTQQYENVKDALDW |
| Ga0207676_106292141 | 3300026095 | Switchgrass Rhizosphere | MAEERTLGLARAEERTSGEPSKEELQRRLGEARDSISSTVTDR |
| Ga0207676_106889453 | 3300026095 | Switchgrass Rhizosphere | MAEERTLGLARAQDLTTEEPSKEELQRRLGEARDSITNTV |
| Ga0207676_108028423 | 3300026095 | Switchgrass Rhizosphere | MAEERTLGLARAQETSSAEDPSKEELQRRMNQARDSISNT |
| Ga0207676_114904021 | 3300026095 | Switchgrass Rhizosphere | MAEERTLGLARAYDRDDEELSKEALQARMDEARDSISQTVTEIKDNVTQQYENVKDAL |
| Ga0207674_116553472 | 3300026116 | Corn Rhizosphere | MAEERTLGLARAQDYTAEEPSKEELQRRMGEARDSISNTV |
| Ga0209153_11459911 | 3300026312 | Soil | MAEEGTLGVARASDESNEPSKEELQRRMEEARHEITQA |
| Ga0257164_10295471 | 3300026497 | Soil | MAEERTLGLARAREAGDEEPSKEELQRRMDEARDSITNTVTESRASSMRRW |
| Ga0209056_106697832 | 3300026538 | Soil | MAEERTLGLARAPEPGRDELSKEELQRRMEEARESISHTVTEI |
| Ga0207537_1026412 | 3300026770 | Soil | MAEERTLGLARSQSEYAEEPSKEELQRRLEKSRDSISSTV |
| Ga0209998_101980712 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MAEERTLGLARAYDKDNEELSKEALQARMDEARDSISQTV |
| Ga0268264_107087023 | 3300028381 | Switchgrass Rhizosphere | MAEERTLGLARASETTEEPSKEELQRRMNVARDSITNTVTEIKETVANQV |
| Ga0268264_111204691 | 3300028381 | Switchgrass Rhizosphere | MAEERTLGLARAHEELSAEPSKEELQRRMDEARDSISNT |
| Ga0268264_123944172 | 3300028381 | Switchgrass Rhizosphere | MAEERTLGLARSQSEYAEEPSKEELQRRLEKSRDSISSTVTEIKETVANQV |
| Ga0137415_102903561 | 3300028536 | Vadose Zone Soil | MAEERTLGIARAREDYGEDTSKEVLQRRMEEARDS |
| Ga0102757_113853621 | 3300030785 | Soil | MAEERTLGLARAQELTAEEPSKQELQRRLDEARDS |
| Ga0102757_114575453 | 3300030785 | Soil | MAEERTLGLARAQDLTTDEEPSKEELQRRLGQARDSITNTVTEIKETVANQVQ |
| Ga0102744_10147823 | 3300030866 | Soil | MAEEGTLGQARASGVRDEEEPSKEELQRRMEEARE |
| Ga0308202_10479813 | 3300030902 | Soil | MAEERTLGLARAPEIAADEPSKEELQIRMEEARDSISQTV |
| Ga0308206_10255681 | 3300030903 | Soil | MAEERTLGIARAPEYSTEDLSKEQLQRRMDEARDSISNTVTEIKETVANQ |
| Ga0308206_10520701 | 3300030903 | Soil | MAEERTLGLARARETSTETWGEELSKEELQRRMEEARDSITNTVTE |
| Ga0102745_10093611 | 3300030960 | Soil | MAEERTLGLARAQEQTSEEPSKEELQRRLGEARDSITST |
| Ga0308196_10519862 | 3300030989 | Soil | MAEERTLGLSRAREVDVEDASKEELQRRMEQARDS |
| Ga0308190_10365591 | 3300030993 | Soil | MAEERNLGLARARETGETGEDPSKEALQRRMEQARDSITNTVTEIKETV |
| Ga0308190_10601623 | 3300030993 | Soil | MAEERTLGLARARETSNETRGEEPSKEELQRRMEQARDSITNTVTEIKENVA |
| Ga0308190_10801731 | 3300030993 | Soil | MAEERTLGLGRAREVDGEDGSKEVLQRRMEQARDSITNTVTEIKENVSQQYET |
| Ga0308190_11126951 | 3300030993 | Soil | MAEERTLGLARARDTSDTSEELPSKEELQRRMEEARDS |
| Ga0308190_11878912 | 3300030993 | Soil | MAEERTLGLARAYDREAESEDPSKEALQRRMEQAR |
| Ga0308189_101811433 | 3300031058 | Soil | MAEERTLGLARARDTAEPSEELPSKEALQRRMEEARDSITNTVTEIKENV |
| Ga0308201_101645891 | 3300031091 | Soil | MAEERTLGLARARDTSEPSEEQPSKEELQRRMEEARDSITNTVTE |
| Ga0308204_101293473 | 3300031092 | Soil | MAEERTLGVARAREVAEEGLSKEELQLRMEEARDSITQTVTEIK |
| Ga0308197_100764613 | 3300031093 | Soil | MAEERNLGLARARETSNEDASKEALQRRMEEARDSITNTVTEI |
| Ga0308197_103184432 | 3300031093 | Soil | MAEERALGLARAREVADEDLSKEELQLRMEEARDSITQTVTEIK |
| Ga0308197_103585151 | 3300031093 | Soil | MAEERTLGLARASEPVSEELSKEELQRRMDDARDSISHTV |
| Ga0308199_11491272 | 3300031094 | Soil | MAEEGTLGLARAHDTHGDELSKEELQRRMDEARDSITQT |
| Ga0308193_10103463 | 3300031096 | Soil | MAEERTLGLARARDTVETLDEQPSKEELQRRMEEARDSITNTVTEIKDNVAQH |
| Ga0308188_10056703 | 3300031097 | Soil | MAEERTLGLARAREVDDQEPSKEELQRRMEEARYSITN |
| Ga0308187_100722093 | 3300031114 | Soil | MAEERTLGLARAREDYGEDASKAELQRRMEEARDSITNTV |
| Ga0308187_100775681 | 3300031114 | Soil | MAEERNLGLARARETSNEDASKEALQRRMEEARDS |
| Ga0308187_101094901 | 3300031114 | Soil | MAEERTLGLARARETANETWGEQPSKEELQRRMEEARDSITNTV |
| Ga0308187_101675003 | 3300031114 | Soil | MAEERTLGLARARDTVETFDEQPSKEELQRRMEEA |
| Ga0308187_103861292 | 3300031114 | Soil | MAEERTLGLARAQEHVAEEPSKEELQRRLGEARDSISNTV |
| Ga0308187_104964652 | 3300031114 | Soil | MAEERTLGLARARDVDGEDASKEALQRRMELARDSISNTVTE |
| Ga0308195_10135873 | 3300031123 | Soil | MAEERTLGLARAYERDVETEEPSKEALQRRMEQARDSITNT |
| Ga0308195_10279823 | 3300031123 | Soil | MAEERTLGLSVAREPSGENDSKEALQRRMEQARDSISNTVTEIKEN |
| Ga0308186_10046701 | 3300031422 | Soil | MAEERTLGLARARDTVETVDEQPSKEELQRRMEEA |
| Ga0310887_103024253 | 3300031547 | Soil | MAEERTLGLARVQEPSVEPSKEELQRRLDHTRDSISQTVTEIKETV |
| Ga0310887_103138013 | 3300031547 | Soil | MAEERTLGLARAYDKDELGNDDLSKEALQARMDEARDSIS |
| Ga0307473_103306861 | 3300031820 | Hardwood Forest Soil | MAEERTLGLARARETSSETWSEEPSKEELQRRMEEARDSITNTV |
| Ga0307413_108988263 | 3300031824 | Rhizosphere | MAEERTLGLARAHETTTEEPSKEELQRRLGEARDSISNTVTEIKETVANQ |
| Ga0310907_102856743 | 3300031847 | Soil | MAEERTLGLARAPEQSTEDLSKEELQRRMGVARDSISSTVSEIKE |
| Ga0310892_111821351 | 3300031858 | Soil | MAEERTLGLARAQDLTTEEPSKEELQRRLGEARDS |
| Ga0307416_1029872312 | 3300032002 | Rhizosphere | MAEERNLGLARARDLGDDDDASKEALQRRMDQARDSITNTVSE |
| Ga0310810_104734873 | 3300033412 | Soil | MAEERTLGLARAQDLTTEEPSKEELQRRLGQARDSITNTVSE |
| Ga0310810_110284021 | 3300033412 | Soil | MAEERTLGLARAQDTAEDPSKEELQRRMDQARDSI |
| Ga0310811_109621191 | 3300033475 | Soil | MAEERALGLARAQDYPAEGEPSKEELQRRMGQARDSITNTVTEIKE |
| Ga0310811_110797921 | 3300033475 | Soil | MAEERTLGLARAQDYSTEGEPSKEELQRRLGEARDSISN |
| ⦗Top⦘ |