Basic Information | |
---|---|
Family ID | F024052 |
Family Type | Metagenome |
Number of Sequences | 207 |
Average Sequence Length | 43 residues |
Representative Sequence | MSQTDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS |
Number of Associated Samples | 158 |
Number of Associated Scaffolds | 207 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 87.92 % |
% of genes near scaffold ends (potentially truncated) | 20.29 % |
% of genes from short scaffolds (< 2000 bps) | 80.19 % |
Associated GOLD sequencing projects | 142 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.720 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.145 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.705 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (29.952 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.61% β-sheet: 0.00% Coil/Unstructured: 76.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 207 Family Scaffolds |
---|---|---|
PF03401 | TctC | 16.43 |
PF00903 | Glyoxalase | 8.70 |
PF01042 | Ribonuc_L-PSP | 5.80 |
PF04909 | Amidohydro_2 | 3.38 |
PF01712 | dNK | 2.90 |
PF01177 | Asp_Glu_race | 2.42 |
PF01070 | FMN_dh | 2.42 |
PF02548 | Pantoate_transf | 1.93 |
PF03070 | TENA_THI-4 | 1.93 |
PF02464 | CinA | 1.93 |
PF01124 | MAPEG | 1.45 |
PF04392 | ABC_sub_bind | 0.97 |
PF01975 | SurE | 0.97 |
PF00072 | Response_reg | 0.48 |
PF07331 | TctB | 0.48 |
PF13519 | VWA_2 | 0.48 |
PF13592 | HTH_33 | 0.48 |
PF13462 | Thioredoxin_4 | 0.48 |
PF09130 | DUF1932 | 0.48 |
PF00557 | Peptidase_M24 | 0.48 |
PF02371 | Transposase_20 | 0.48 |
PF14518 | Haem_oxygenas_2 | 0.48 |
PF02826 | 2-Hacid_dh_C | 0.48 |
PF01909 | NTP_transf_2 | 0.48 |
PF03446 | NAD_binding_2 | 0.48 |
PF13414 | TPR_11 | 0.48 |
PF02776 | TPP_enzyme_N | 0.48 |
PF01551 | Peptidase_M23 | 0.48 |
PF00296 | Bac_luciferase | 0.48 |
PF03030 | H_PPase | 0.48 |
PF04679 | DNA_ligase_A_C | 0.48 |
PF13649 | Methyltransf_25 | 0.48 |
PF00933 | Glyco_hydro_3 | 0.48 |
PF07883 | Cupin_2 | 0.48 |
PF02569 | Pantoate_ligase | 0.48 |
PF00171 | Aldedh | 0.48 |
PF13492 | GAF_3 | 0.48 |
PF03450 | CO_deh_flav_C | 0.48 |
COG ID | Name | Functional Category | % Frequency in 207 Family Scaffolds |
---|---|---|---|
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 16.43 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 5.80 |
COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 2.90 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 2.42 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 2.42 |
COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 1.93 |
COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 1.93 |
COG0496 | Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE | Replication, recombination and repair [L] | 0.97 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.97 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.48 |
COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.48 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.48 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.48 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.48 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.48 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.48 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.48 |
COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.48 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.72 % |
Unclassified | root | N/A | 6.28 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_9070640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1458 | Open in IMG/M |
2140918013|NODE_1594_length_1379_cov_11.755620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1411 | Open in IMG/M |
2140918013|NODE_8251_length_1184_cov_7.368243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1216 | Open in IMG/M |
2170459016|G1P06HT01CHEDL | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
2228664022|INPgaii200_c1209947 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300000559|F14TC_100114237 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1113 | Open in IMG/M |
3300000789|JGI1027J11758_13040554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
3300003911|JGI25405J52794_10002566 | All Organisms → cellular organisms → Bacteria | 3138 | Open in IMG/M |
3300003987|Ga0055471_10004737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2589 | Open in IMG/M |
3300003992|Ga0055470_10009079 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
3300003995|Ga0055438_10084413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 876 | Open in IMG/M |
3300003996|Ga0055467_10004504 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
3300003997|Ga0055466_10021878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1393 | Open in IMG/M |
3300003999|Ga0055469_10276452 | Not Available | 540 | Open in IMG/M |
3300004013|Ga0055465_10198931 | Not Available | 657 | Open in IMG/M |
3300004052|Ga0055490_10187757 | Not Available | 621 | Open in IMG/M |
3300004052|Ga0055490_10235522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
3300004114|Ga0062593_100227385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1516 | Open in IMG/M |
3300004114|Ga0062593_102314972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
3300004145|Ga0055489_10057371 | Not Available | 1056 | Open in IMG/M |
3300004156|Ga0062589_101190511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
3300004463|Ga0063356_100308937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1966 | Open in IMG/M |
3300004463|Ga0063356_102615631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
3300004463|Ga0063356_102737468 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300004463|Ga0063356_105031839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
3300004463|Ga0063356_105205327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
3300004480|Ga0062592_102228038 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300004643|Ga0062591_100255663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
3300005289|Ga0065704_10289015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 907 | Open in IMG/M |
3300005295|Ga0065707_10002536 | All Organisms → cellular organisms → Bacteria | 6967 | Open in IMG/M |
3300005295|Ga0065707_10982561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
3300005332|Ga0066388_100075827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM2793 | 3701 | Open in IMG/M |
3300005332|Ga0066388_102681106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
3300005332|Ga0066388_102803213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 890 | Open in IMG/M |
3300005332|Ga0066388_103483996 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300005332|Ga0066388_104467644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 712 | Open in IMG/M |
3300005332|Ga0066388_104558852 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
3300005336|Ga0070680_101061539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
3300005339|Ga0070660_101852506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300005445|Ga0070708_101255072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
3300005457|Ga0070662_101170734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
3300005468|Ga0070707_100125669 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
3300005555|Ga0066692_10568965 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300005559|Ga0066700_10366560 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300005713|Ga0066905_101774913 | Not Available | 568 | Open in IMG/M |
3300005713|Ga0066905_101809753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300005764|Ga0066903_103999635 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 790 | Open in IMG/M |
3300005764|Ga0066903_105965025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
3300005937|Ga0081455_10088282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2520 | Open in IMG/M |
3300005981|Ga0081538_10116914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1292 | Open in IMG/M |
3300005981|Ga0081538_10195952 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300006049|Ga0075417_10002501 | All Organisms → cellular organisms → Bacteria | 5551 | Open in IMG/M |
3300006844|Ga0075428_102690786 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300006845|Ga0075421_100022900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7866 | Open in IMG/M |
3300006845|Ga0075421_101522902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
3300006845|Ga0075421_102694232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300006845|Ga0075421_102740557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300006846|Ga0075430_100534054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
3300006847|Ga0075431_100653727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
3300006852|Ga0075433_10404957 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1203 | Open in IMG/M |
3300006853|Ga0075420_100293529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1411 | Open in IMG/M |
3300006865|Ga0073934_10122795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1912 | Open in IMG/M |
3300006876|Ga0079217_10174792 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300006876|Ga0079217_11201275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
3300006894|Ga0079215_10037042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1796 | Open in IMG/M |
3300006918|Ga0079216_10145611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
3300006969|Ga0075419_10330548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
3300007004|Ga0079218_10565520 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300007004|Ga0079218_12437769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
3300009078|Ga0105106_10089860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2260 | Open in IMG/M |
3300009081|Ga0105098_10090740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1307 | Open in IMG/M |
3300009087|Ga0105107_10284782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1153 | Open in IMG/M |
3300009100|Ga0075418_12394547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
3300009137|Ga0066709_101195374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1119 | Open in IMG/M |
3300009157|Ga0105092_10013103 | All Organisms → cellular organisms → Bacteria | 4354 | Open in IMG/M |
3300009157|Ga0105092_10015772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3968 | Open in IMG/M |
3300009157|Ga0105092_10219881 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300009157|Ga0105092_10283411 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 933 | Open in IMG/M |
3300009157|Ga0105092_10871550 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009162|Ga0075423_10698537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
3300009610|Ga0105340_1114209 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300009610|Ga0105340_1145512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
3300009610|Ga0105340_1398410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
3300009807|Ga0105061_1000289 | All Organisms → cellular organisms → Bacteria | 4174 | Open in IMG/M |
3300009811|Ga0105084_1001443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2714 | Open in IMG/M |
3300009815|Ga0105070_1010832 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
3300009821|Ga0105064_1039045 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300010037|Ga0126304_10948088 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300010043|Ga0126380_11635154 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300010047|Ga0126382_10339079 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1146 | Open in IMG/M |
3300010047|Ga0126382_10895949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
3300010359|Ga0126376_12122016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
3300010359|Ga0126376_12297964 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 585 | Open in IMG/M |
3300010376|Ga0126381_102225799 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300010376|Ga0126381_103683850 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300010398|Ga0126383_12116500 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300010399|Ga0134127_10152183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2102 | Open in IMG/M |
3300010400|Ga0134122_10630778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 995 | Open in IMG/M |
3300011405|Ga0137340_1022087 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1169 | Open in IMG/M |
3300011414|Ga0137442_1106478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 613 | Open in IMG/M |
3300011430|Ga0137423_1051835 | Not Available | 1223 | Open in IMG/M |
3300011437|Ga0137429_1129489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
3300011438|Ga0137451_1186542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 657 | Open in IMG/M |
3300012143|Ga0137354_1034024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
3300012146|Ga0137322_1064352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300012204|Ga0137374_11090311 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012208|Ga0137376_10094856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2521 | Open in IMG/M |
3300012353|Ga0137367_10232593 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1328 | Open in IMG/M |
3300012361|Ga0137360_10012566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5442 | Open in IMG/M |
3300012941|Ga0162652_100074792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
3300012944|Ga0137410_10262697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1356 | Open in IMG/M |
3300012957|Ga0164303_11152660 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300014268|Ga0075309_1018281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1485 | Open in IMG/M |
3300014320|Ga0075342_1193074 | Not Available | 572 | Open in IMG/M |
3300014865|Ga0180078_1082469 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300014877|Ga0180074_1006907 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
3300014883|Ga0180086_1153168 | Not Available | 600 | Open in IMG/M |
3300014884|Ga0180104_1030667 | Not Available | 1379 | Open in IMG/M |
3300014884|Ga0180104_1045926 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300014885|Ga0180063_1144932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
3300015252|Ga0180075_1095361 | Not Available | 529 | Open in IMG/M |
3300015255|Ga0180077_1011904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1466 | Open in IMG/M |
3300015372|Ga0132256_100050088 | All Organisms → cellular organisms → Bacteria | 3878 | Open in IMG/M |
3300015373|Ga0132257_100005125 | All Organisms → cellular organisms → Bacteria | 12501 | Open in IMG/M |
3300015374|Ga0132255_100107330 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
3300015374|Ga0132255_105541261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
3300016357|Ga0182032_10139545 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300018052|Ga0184638_1011171 | All Organisms → cellular organisms → Bacteria | 3043 | Open in IMG/M |
3300018053|Ga0184626_10002951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6273 | Open in IMG/M |
3300018053|Ga0184626_10123015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1102 | Open in IMG/M |
3300018053|Ga0184626_10408299 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300018056|Ga0184623_10057538 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300018059|Ga0184615_10106548 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300018072|Ga0184635_10010380 | All Organisms → cellular organisms → Bacteria | 3232 | Open in IMG/M |
3300018075|Ga0184632_10006689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 4800 | Open in IMG/M |
3300018075|Ga0184632_10177966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 938 | Open in IMG/M |
3300018075|Ga0184632_10412056 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300018081|Ga0184625_10189514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
3300018084|Ga0184629_10131379 | Not Available | 1256 | Open in IMG/M |
3300018422|Ga0190265_10029915 | All Organisms → cellular organisms → Bacteria | 4505 | Open in IMG/M |
3300018422|Ga0190265_10032799 | All Organisms → cellular organisms → Bacteria | 4342 | Open in IMG/M |
3300018422|Ga0190265_10365767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1532 | Open in IMG/M |
3300018422|Ga0190265_10373342 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300018422|Ga0190265_11757414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
3300018422|Ga0190265_11955367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 692 | Open in IMG/M |
3300018422|Ga0190265_12670035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
3300018422|Ga0190265_12673188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300018422|Ga0190265_13600755 | Not Available | 517 | Open in IMG/M |
3300018429|Ga0190272_11537613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
3300018432|Ga0190275_12477359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300018432|Ga0190275_13329103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300018433|Ga0066667_10739500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
3300019377|Ga0190264_10328186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300019789|Ga0137408_1152603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1718 | Open in IMG/M |
3300019886|Ga0193727_1041027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1535 | Open in IMG/M |
3300021081|Ga0210379_10210429 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia | 839 | Open in IMG/M |
3300021344|Ga0193719_10402770 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300025324|Ga0209640_10000238 | All Organisms → cellular organisms → Bacteria | 40956 | Open in IMG/M |
3300025559|Ga0210087_1000942 | All Organisms → cellular organisms → Bacteria | 6427 | Open in IMG/M |
3300025792|Ga0210143_1079449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300025917|Ga0207660_10694454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
3300025922|Ga0207646_10621899 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300025933|Ga0207706_10770328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
3300026037|Ga0208655_1007213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 879 | Open in IMG/M |
3300026090|Ga0208912_1030120 | Not Available | 786 | Open in IMG/M |
3300026535|Ga0256867_10021958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2721 | Open in IMG/M |
3300027056|Ga0209879_1026818 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300027209|Ga0209875_1002908 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
3300027209|Ga0209875_1004611 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
3300027561|Ga0209887_1067213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 751 | Open in IMG/M |
3300027577|Ga0209874_1000158 | All Organisms → cellular organisms → Bacteria | 17885 | Open in IMG/M |
3300027617|Ga0210002_1014818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
3300027637|Ga0209818_1029429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1243 | Open in IMG/M |
3300027646|Ga0209466_1009422 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
3300027647|Ga0214468_1187983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300027650|Ga0256866_1158291 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300027654|Ga0209799_1021705 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1408 | Open in IMG/M |
3300027691|Ga0209485_1072139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
3300027695|Ga0209966_1015986 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300027722|Ga0209819_10001123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8145 | Open in IMG/M |
3300027722|Ga0209819_10101734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1003 | Open in IMG/M |
3300027873|Ga0209814_10007159 | All Organisms → cellular organisms → Bacteria | 4321 | Open in IMG/M |
3300027886|Ga0209486_10584442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
3300027909|Ga0209382_10460227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1407 | Open in IMG/M |
3300027909|Ga0209382_12201934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300027957|Ga0209857_1000054 | All Organisms → cellular organisms → Bacteria | 22488 | Open in IMG/M |
3300027991|Ga0247683_1021518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 576 | Open in IMG/M |
3300028889|Ga0247827_11076803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
3300030606|Ga0299906_10029907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4357 | Open in IMG/M |
3300030606|Ga0299906_10834739 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300030619|Ga0268386_10612381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
3300031229|Ga0299913_10736225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
3300031720|Ga0307469_11022644 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300031731|Ga0307405_10264307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
3300031820|Ga0307473_11196437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
3300031824|Ga0307413_10516457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
3300031890|Ga0306925_10405944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1460 | Open in IMG/M |
3300031910|Ga0306923_11561477 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300032004|Ga0307414_10948770 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300032005|Ga0307411_11729733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300032012|Ga0310902_11131781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
3300032076|Ga0306924_10937944 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300032829|Ga0335070_10170171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2195 | Open in IMG/M |
3300033417|Ga0214471_10135121 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
3300033551|Ga0247830_10077993 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
3300034115|Ga0364945_0145370 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300034148|Ga0364927_0004000 | All Organisms → cellular organisms → Bacteria | 2761 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.14% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.73% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.80% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.80% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.83% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.35% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.38% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.38% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.93% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.97% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.97% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.97% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.97% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.48% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.48% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.48% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.48% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.48% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300012143 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2 | Environmental | Open in IMG/M |
3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026037 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026090 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027991 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_00374060 | 2088090015 | Soil | MSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS |
Iowa-Corn-GraphCirc_03519950 | 2140918013 | Soil | MSQTDWAKIYAAMDMRVALKYQQLPKGEQIGKSPPQKTQTRAS |
Iowa-Corn-GraphCirc_01123950 | 2140918013 | Soil | MSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSQTKSA |
2ZMR_03304350 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MSQTDWAKIYAAMDKRLGLKYEQLPKGEQIGKWPQSETSQMKTS |
INPgaii200_12099472 | 2228664022 | Soil | MSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQTGNQQIKSS |
F14TC_1001142371 | 3300000559 | Soil | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKIS* |
JGI1027J11758_130405542 | 3300000789 | Soil | MSXPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS* |
JGI25405J52794_100025662 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS* |
Ga0055471_100047373 | 3300003987 | Natural And Restored Wetlands | MNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS* |
Ga0055470_100090791 | 3300003992 | Natural And Restored Wetlands | SMNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS* |
Ga0055438_100844132 | 3300003995 | Natural And Restored Wetlands | MSQIDWAKIYAAMDLRIVLKYEQLPEGEQVGKRPQAKNQPVKSS* |
Ga0055467_100045044 | 3300003996 | Natural And Restored Wetlands | IKSMNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS* |
Ga0055466_100218782 | 3300003997 | Natural And Restored Wetlands | MKQIDWAKIYASMDKRVTLKYQQLPSGEQVGKAQPQPTPAEKSF* |
Ga0055469_102764521 | 3300003999 | Natural And Restored Wetlands | MKAMDWAKIYAAMDKRIEVKYKQLPTGEQIGKKAYSGSSPAKKP* |
Ga0055465_101989311 | 3300004013 | Natural And Restored Wetlands | MDQNDWAKKYAAMDKRIEWKYEQLPVGEQVGKRPEAVDASERSSVTKDSAR* |
Ga0055490_101877571 | 3300004052 | Natural And Restored Wetlands | SQTDWAKLYSQMDKRIVVKYEQLPKGEQIGKRPPTGNQQAKPPARPATS* |
Ga0055490_102355222 | 3300004052 | Natural And Restored Wetlands | MSQTDWAKKYAAMDKRIVLKYERLPRGEQIGKRPPAGKAQERAS* |
Ga0062593_1002273852 | 3300004114 | Soil | MSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSRTKSA* |
Ga0062593_1023149722 | 3300004114 | Soil | MSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS* |
Ga0055489_100573712 | 3300004145 | Natural And Restored Wetlands | MSQTDWAKIYGEMDKRIIVKYEQLPQGEQVGKRPHPGAQQTKNS* |
Ga0062589_1011905112 | 3300004156 | Soil | MSQTDWAKIYAAMDMRVALKYQQLPKGEQIGKSPPQKTQTRAS* |
Ga0063356_1003089372 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSQTDWAKIYAAMDKRVELKYQHLPKGEQFGKPPVPNGQSRSS* |
Ga0063356_1026156312 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGNQGEKMP* |
Ga0063356_1027374681 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GSMSQTDWAKTYATMDKRIILKYEQLPRGEQIGKPAQTGTQDKGKS* |
Ga0063356_1050318391 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSQTDWAKIYAAMDKRLELKYEQLPKGEQIGKRPQPKTSQTKIS* |
Ga0063356_1052053272 | 3300004463 | Arabidopsis Thaliana Rhizosphere | QTDWAKIYAAMDKRIELKYEQLPRGEQIGRRPPQKNRPRPS* |
Ga0062592_1022280381 | 3300004480 | Soil | SQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS* |
Ga0062591_1002556631 | 3300004643 | Soil | MSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKR |
Ga0065704_102890152 | 3300005289 | Switchgrass Rhizosphere | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAEKQQAKSS* |
Ga0065707_100025366 | 3300005295 | Switchgrass Rhizosphere | MSQIDWAKIYAAMDKRVELKYQQLPKGEQIGKRSPEKNQPRPS* |
Ga0065707_109825611 | 3300005295 | Switchgrass Rhizosphere | GHLNIEGERAMSQTDWAKIYAAMDKRIELKYQQLPKGEQIGKRPAQKNQPRPA* |
Ga0066388_1000758272 | 3300005332 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQAKAS* |
Ga0066388_1026811062 | 3300005332 | Tropical Forest Soil | MNQIDWAKIYAEMDKRIVVKYEQLPNGEQIGKRTQAGNCQAKNS* |
Ga0066388_1028032132 | 3300005332 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPNGEQIGKRPPTGKPQVKSS* |
Ga0066388_1034839963 | 3300005332 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*AIIFATTKGEF |
Ga0066388_1044676441 | 3300005332 | Tropical Forest Soil | LQMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETEQVKAS* |
Ga0066388_1045588521 | 3300005332 | Tropical Forest Soil | PREVLQMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPPAETQQAKAS* |
Ga0070680_1010615392 | 3300005336 | Corn Rhizosphere | MSQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS* |
Ga0070660_1018525062 | 3300005339 | Corn Rhizosphere | MSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPNAGSQHEKKS* |
Ga0070708_1012550722 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQAGNQQIKSS* |
Ga0070662_1011707342 | 3300005457 | Corn Rhizosphere | MSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS* |
Ga0070707_1001256691 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKPDWAKIYAEMDNRIIVKYEQLPNGEQIGKRPQAGNNK* |
Ga0066692_105689652 | 3300005555 | Soil | MSQTDWAKIYAEMDKRIIVKYEHLPNGEQLGKRPQAGSQQIKSS* |
Ga0066700_103665602 | 3300005559 | Soil | MNQTDWAKIYAEMDKRIIVKYEHLPNGEQLGKRPQAGSQQIKSS* |
Ga0066905_1017749131 | 3300005713 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQVKAS* |
Ga0066905_1018097531 | 3300005713 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQ |
Ga0066903_1039996351 | 3300005764 | Tropical Forest Soil | AKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS* |
Ga0066903_1059650252 | 3300005764 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGEQPEKNS* |
Ga0081455_100882821 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSATDWAKIYAKMDKRIVVKYEQLPNGEQVGKRPQAGQQAKKP* |
Ga0081538_101169143 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSQTDWAKIYAEMDKRIIVKYEQLPKGEQIGNRTQAETNK* |
Ga0081538_101959522 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSETDWAKIYAEMDKRIIVKYEQLPNGEQVGKRPQPRKGS* |
Ga0075417_100025018 | 3300006049 | Populus Rhizosphere | MSETDWAKIYAKMDERIVVKYEHLPKGEQIGKRPQAGNQQAKIS* |
Ga0075428_1026907861 | 3300006844 | Populus Rhizosphere | GLMSQTDWAKAYAAMDERIILKYEQLPRGEQISKALQAGSKDEKKS* |
Ga0075421_1000229005 | 3300006845 | Populus Rhizosphere | MSQTDWAKIYAAMGMRVALKYQQLPKGEQIGKSPPQKTQTRAS* |
Ga0075421_1015229021 | 3300006845 | Populus Rhizosphere | MSQTDWAKIYAAMDKRVILKYAQLPKGEQIGKRPAQQTQTKPS* |
Ga0075421_1026942322 | 3300006845 | Populus Rhizosphere | MSQTDWAKIYAAMDKRVVLKYAQLPKGEQIGKRPAQENAQAKAS* |
Ga0075421_1027405571 | 3300006845 | Populus Rhizosphere | MSQTDWAKAYAAMDERIILKYEQLPRGEQIGKALQAGSKDEKKS* |
Ga0075430_1005340542 | 3300006846 | Populus Rhizosphere | MSQIDWAKAYAAMDARIILKYERLPRGEQIGKAPQAGSQDEKKS* |
Ga0075431_1006537272 | 3300006847 | Populus Rhizosphere | MSQTDWAKAYAAMDVRIILKYEQLPRGEQIGKAPRAGSKDEKKS* |
Ga0075433_104049572 | 3300006852 | Populus Rhizosphere | MSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS* |
Ga0075420_1002935292 | 3300006853 | Populus Rhizosphere | MSETDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQAGNQQAKIS* |
Ga0073934_101227953 | 3300006865 | Hot Spring Sediment | MSQTDWAKLYAAMDARITLKYQQLPKGEQIGKRPQQQSKAS* |
Ga0079217_101747922 | 3300006876 | Agricultural Soil | MSQTDWAKAYAAMDERIILKYERLPRGEQIGKAPQAGSQDEKKS* |
Ga0079217_112012752 | 3300006876 | Agricultural Soil | MSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKQDLL* |
Ga0079215_100370423 | 3300006894 | Agricultural Soil | MSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKARPSLRNLWV* |
Ga0079216_101456112 | 3300006918 | Agricultural Soil | MSQTDWAKIYAVMDKRVELKYAQLPKGEQIGARPAQVKAQVKNLSG* |
Ga0075419_103305482 | 3300006969 | Populus Rhizosphere | MSQIDWAKAYAAMDARIILKYERLPRGEQIGKALQAGSKDEKKS* |
Ga0079218_105655203 | 3300007004 | Agricultural Soil | MTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGHEGEKMP* |
Ga0079218_124377692 | 3300007004 | Agricultural Soil | MSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPAQVKAQVKKS* |
Ga0105106_100898601 | 3300009078 | Freshwater Sediment | MSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEQKAF* |
Ga0105098_100907402 | 3300009081 | Freshwater Sediment | MSQTDWAKIYAEMDKRILVKYEQLPKGEQVGKPSPSEKNS* |
Ga0105107_102847822 | 3300009087 | Freshwater Sediment | MSQTDWAKIYAAMDKRLDLKYEQLPKGEQIGKRPQPKTSQTKIS* |
Ga0075418_123945472 | 3300009100 | Populus Rhizosphere | MSETDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQA |
Ga0066709_1011953741 | 3300009137 | Grasslands Soil | REVLQMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS* |
Ga0105092_100131035 | 3300009157 | Freshwater Sediment | MSQIDWAKIYAKMDKRILVKYEQLPNGEQIGKRPQTGNQQAKSS* |
Ga0105092_100157724 | 3300009157 | Freshwater Sediment | MSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKRPEKESKSA* |
Ga0105092_102198813 | 3300009157 | Freshwater Sediment | MSATDWAKIYAEMDKRIIVKYEQLPNGEQAGKRPQAGQQAKKP* |
Ga0105092_102834112 | 3300009157 | Freshwater Sediment | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPPAEKQQAKSS* |
Ga0105092_108715501 | 3300009157 | Freshwater Sediment | MSQTDWAKIYAAMDKRIAVKYEQLPNGEQIGKRPQAENQQAKSS* |
Ga0075423_106985371 | 3300009162 | Populus Rhizosphere | MSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAGNQQAKIS* |
Ga0105340_11142092 | 3300009610 | Soil | MSQTDWAKTYAAMDNRIVLKYEQLPNGEQIGKRPQPESQPAKIPEGE* |
Ga0105340_11455122 | 3300009610 | Soil | MSQTDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS* |
Ga0105340_13984102 | 3300009610 | Soil | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGKQQAKSS* |
Ga0105061_10002895 | 3300009807 | Groundwater Sand | MSERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS* |
Ga0105084_10014433 | 3300009811 | Groundwater Sand | MCQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES* |
Ga0105070_10108322 | 3300009815 | Groundwater Sand | MRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES* |
Ga0105064_10390452 | 3300009821 | Groundwater Sand | MSERDWAKIYALMDKRIVVKYEQLPNGEQIGKRPQAGNQPAKSS* |
Ga0126304_109480882 | 3300010037 | Serpentine Soil | MSQTDWAKTYAAMDKRIILKYEQLPRGEQVGNGPQSGSQEEKKSS* |
Ga0126380_116351542 | 3300010043 | Tropical Forest Soil | MSQIDWAKVYAEMDKRIVVKYEQLPKGEQIGKRPPAGNQPASPS* |
Ga0126382_103390791 | 3300010047 | Tropical Forest Soil | IYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS* |
Ga0126382_108959491 | 3300010047 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLANGEQIGKRPPAGNEPVKAS* |
Ga0126376_121220161 | 3300010359 | Tropical Forest Soil | IDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS* |
Ga0126376_122979642 | 3300010359 | Tropical Forest Soil | MSQLDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQAKAS* |
Ga0126381_1022257992 | 3300010376 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPPAGNQQANPS* |
Ga0126381_1036838501 | 3300010376 | Tropical Forest Soil | MSQIDWAKIYAKMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS* |
Ga0126383_121165002 | 3300010398 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAEPQQVKDS* |
Ga0134127_101521832 | 3300010399 | Terrestrial Soil | MNQTDWAKIYAAMDKRIELKYEQLPKGEQIGRRPPQKNQPRPS* |
Ga0134122_106307782 | 3300010400 | Terrestrial Soil | SQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS* |
Ga0137340_10220872 | 3300011405 | Soil | MSQTDWAKIYAAMDKRIVVKYQQLPKGEQIGKRPPPGNQQGKNS* |
Ga0137442_11064782 | 3300011414 | Soil | MSQVDWAKKYAVMDKRLMLKYEQLPKGEQIGKKPTP |
Ga0137423_10518352 | 3300011430 | Soil | MSQTDWAKLYAAMDKRITLKYEQLPKGEQIGKGPEKERKNA* |
Ga0137429_11294891 | 3300011437 | Soil | MSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGEAPGTRK |
Ga0137451_11865422 | 3300011438 | Soil | MSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKQPELLQQNSNKPSQA* |
Ga0137354_10340241 | 3300012143 | Soil | MSQTDWAKIYAAMDKRIVVKYQQLPKGEQIGKRPPPGNQQGKN |
Ga0137322_10643521 | 3300012146 | Soil | MSQTDWAKIYAAMDKRIELKYEQLPKGEQIGKRQPQKNQPRPA* |
Ga0137374_110903111 | 3300012204 | Vadose Zone Soil | MSQTDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQAGNQQAKSS* |
Ga0137376_100948562 | 3300012208 | Vadose Zone Soil | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS* |
Ga0137367_102325932 | 3300012353 | Vadose Zone Soil | MSQTDWAKIYAKMDERIVVKYEQLPKGEQIGRRPQAGNRQAKSS* |
Ga0137360_100125662 | 3300012361 | Vadose Zone Soil | MSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQTGNQQIKSS* |
Ga0162652_1000747922 | 3300012941 | Soil | MSQPDWAKIYAKMDKRIVVKYEQLPRGEQIGKRPQAETQQAKSS* |
Ga0137410_102626973 | 3300012944 | Vadose Zone Soil | MSETDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS* |
Ga0164303_111526601 | 3300012957 | Soil | QPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS* |
Ga0075309_10182812 | 3300014268 | Natural And Restored Wetlands | MSQIDWAKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP* |
Ga0075342_11930741 | 3300014320 | Natural And Restored Wetlands | MSRTDWAKLYSQMDKRIVVKYEQLPKGEQIGKRPPTGNQQAKPPARPATS* |
Ga0180078_10824691 | 3300014865 | Soil | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGTQQAKSS* |
Ga0180074_10069071 | 3300014877 | Soil | MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKDV* |
Ga0180086_11531681 | 3300014883 | Soil | MTQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQSEKESKSS* |
Ga0180104_10306671 | 3300014884 | Soil | MSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKRPEKERKPA* |
Ga0180104_10459263 | 3300014884 | Soil | MSQSDWAKLYAAVDKRIILKYQQLPKGEQIGKRPEKESKSA* |
Ga0180063_11449322 | 3300014885 | Soil | MSQTDWSKKYAEMDKRIVLKYERLPNGEQIGKRPQTGKAEEKAS* |
Ga0180075_10953611 | 3300015252 | Soil | MRRGGLLVSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQPEKERKDV* |
Ga0180077_10119043 | 3300015255 | Soil | MSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKQLEKESKSS* |
Ga0132256_1000500885 | 3300015372 | Arabidopsis Rhizosphere | QSDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPVAGHQQTKSS* |
Ga0132257_1000051257 | 3300015373 | Arabidopsis Rhizosphere | MSQSDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPVAGHQQTKSS* |
Ga0132255_1001073301 | 3300015374 | Arabidopsis Rhizosphere | MSQTDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPQA |
Ga0132255_1055412612 | 3300015374 | Arabidopsis Rhizosphere | MSQTDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPQAGYQQAKNS* |
Ga0182032_101395451 | 3300016357 | Soil | MNKPDWAKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS |
Ga0184638_10111711 | 3300018052 | Groundwater Sediment | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS |
Ga0184626_100029516 | 3300018053 | Groundwater Sediment | MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKPA |
Ga0184626_101230152 | 3300018053 | Groundwater Sediment | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAKNQQAKSS |
Ga0184626_104082992 | 3300018053 | Groundwater Sediment | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAENQQAKSS |
Ga0184623_100575382 | 3300018056 | Groundwater Sediment | MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESKSS |
Ga0184615_101065482 | 3300018059 | Groundwater Sediment | MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKDV |
Ga0184635_100103805 | 3300018072 | Groundwater Sediment | MSEPDWAKIYAEMDKRILVKYEQLPNGEQIGKRPQAGNQRAKSS |
Ga0184632_100066893 | 3300018075 | Groundwater Sediment | MSLRDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKPA |
Ga0184632_101779662 | 3300018075 | Groundwater Sediment | VHSTKEVLPMSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS |
Ga0184632_104120562 | 3300018075 | Groundwater Sediment | VHSTKEVLPMSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGKRP |
Ga0184625_101895142 | 3300018081 | Groundwater Sediment | MSQTDWAKIYAGMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS |
Ga0184629_101313792 | 3300018084 | Groundwater Sediment | MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQPQKERKPA |
Ga0190265_100299152 | 3300018422 | Soil | MSEIDWAKTYAKMDKRIILKYEQLPQGEQIGKVLQAGSQEAKKS |
Ga0190265_100327994 | 3300018422 | Soil | MSQTDWAKTYAVMDERIILKYEELPKGEQIGKAPPAGSQDEKKS |
Ga0190265_103657672 | 3300018422 | Soil | MSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKARPSLRNLWV |
Ga0190265_103733423 | 3300018422 | Soil | MSQTDWAKTYAKMDKRIILKYEQLPKGEQIGKASQAGSQEAKKS |
Ga0190265_117574142 | 3300018422 | Soil | MMSQTDWAKIYAAMDKRVALKYQQLPKGEQIGKRPAQQTQTKPS |
Ga0190265_119553672 | 3300018422 | Soil | MSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEEKAS |
Ga0190265_126700352 | 3300018422 | Soil | MNQTDWAKIYAAMDKRVVIKYQQLPKGEQIGKRPAQQTQTKPS |
Ga0190265_126731881 | 3300018422 | Soil | MSQTDWAKTYAVMDKRITLKYEQLAKGEQIGEAPQTGSQDEKKS |
Ga0190265_136007552 | 3300018422 | Soil | MSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQPGKAGEKAS |
Ga0190272_115376132 | 3300018429 | Soil | MNQTDWAKIYAAMDKRVVMKYQQLPKGEQIGKRPAQQTQTKPS |
Ga0190275_124773591 | 3300018432 | Soil | MTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGNQGEKMP |
Ga0190275_133291032 | 3300018432 | Soil | MSQTDWAKTYAKMDKRIILKYEQLPKGEQIGKASQAGS |
Ga0066667_107395001 | 3300018433 | Grasslands Soil | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAEKQQAKSS |
Ga0190264_103281862 | 3300019377 | Soil | MSQTDWAKTYAAMDKRIILKYQQLPRGEQIGKTSQAGPEAKKT |
Ga0137408_11526032 | 3300019789 | Vadose Zone Soil | MSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS |
Ga0193727_10410272 | 3300019886 | Soil | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQVGKRPQAGNQQAKSS |
Ga0210379_102104292 | 3300021081 | Groundwater Sediment | MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQLEKESKSS |
Ga0193719_104027701 | 3300021344 | Soil | FLAPGPREVLLMSQTDWAKIYAKMDKRIVVKYEQLPKGEQVGKRPQAGNQQAKSS |
Ga0209640_1000023831 | 3300025324 | Soil | MSQIDWVKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP |
Ga0210087_10009422 | 3300025559 | Natural And Restored Wetlands | MNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS |
Ga0210143_10794491 | 3300025792 | Natural And Restored Wetlands | MIQTDWAKTYAAMDKRIELKYEQLPKGEQIGKQPQQQTSQTKSS |
Ga0207660_106944542 | 3300025917 | Corn Rhizosphere | MSQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS |
Ga0207646_106218991 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKPDWAKIYAEMDNRIIVKYEQLPNGEQIGKRPQAGNNK |
Ga0207706_107703282 | 3300025933 | Corn Rhizosphere | MSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS |
Ga0208655_10072132 | 3300026037 | Natural And Restored Wetlands | MGQTDWAKLYAAMDKRIDLKYRQLPEGEQVGKRPEKEEKASESSRS |
Ga0208912_10301201 | 3300026090 | Natural And Restored Wetlands | MSPTDWAKTYAAMDNRIELKYQQLPKGEQTGKRPPPPEKR |
Ga0256867_100219583 | 3300026535 | Soil | MMSQTDWAKIYAAMDKRIELKYEQLPKGEQIGKRAETERPQGKD |
Ga0209879_10268182 | 3300027056 | Groundwater Sand | MSERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS |
Ga0209875_10029084 | 3300027209 | Groundwater Sand | ERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS |
Ga0209875_10046112 | 3300027209 | Groundwater Sand | MRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES |
Ga0209887_10672132 | 3300027561 | Groundwater Sand | MRQTDWAKTYVAMDNRIVLKYEQLPDGEQIGKRPQPES |
Ga0209874_100015816 | 3300027577 | Groundwater Sand | MRQTDWAKTNAAMDNRIVFKYEQLPDGEQIRKRPQPES |
Ga0210002_10148183 | 3300027617 | Arabidopsis Thaliana Rhizosphere | MSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRE |
Ga0209818_10294292 | 3300027637 | Agricultural Soil | MSQTDWAKIYAAMDKRVGLKYAQLRKGEQIGKRPPQQTKQDLL |
Ga0209466_10094222 | 3300027646 | Tropical Forest Soil | MSQIDWAKIYAKMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS |
Ga0214468_11879831 | 3300027647 | Soil | MSDSDWARIYAQMDKRIVLKYEQLPTGEQIGKRPQAAKEQNQKA |
Ga0256866_11582912 | 3300027650 | Soil | VSQTDWAKIYAEMDKRILLKYEQMPKGEQIGKRFQAEGEEAKRS |
Ga0209799_10217052 | 3300027654 | Tropical Forest Soil | MSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS |
Ga0209485_10721391 | 3300027691 | Agricultural Soil | MSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPAQVKAQVKKS |
Ga0209966_10159861 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSRTKSA |
Ga0209819_100011239 | 3300027722 | Freshwater Sediment | MSQTDWAKIYAEMDKRILVKYEQLPKGEQVGKPSPSEKNS |
Ga0209819_101017341 | 3300027722 | Freshwater Sediment | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPPAEKQQAKSS |
Ga0209814_100071594 | 3300027873 | Populus Rhizosphere | MSETDWAKIYAKMDERIVVKYEHLPKGEQIGKRPQAGNQQAKIS |
Ga0209486_105844421 | 3300027886 | Agricultural Soil | MSQTDWAKAYAAMDERIILKYERLPRGEQIGKAPQAGNQDEKKS |
Ga0209382_104602273 | 3300027909 | Populus Rhizosphere | MSQTDWAKAYAAMDVRIILKYEQLPRGEQIGKAPQAGSKDEKKS |
Ga0209382_122019341 | 3300027909 | Populus Rhizosphere | MSQTDWAKIYAAMDKRVVLKYAQLPKGEQIGKRPAQENAQAKAS |
Ga0209857_10000541 | 3300027957 | Groundwater Sand | MRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQP |
Ga0247683_10215181 | 3300027991 | Soil | MSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKQPT |
Ga0247827_110768032 | 3300028889 | Soil | MSQTDWAKVYAAMDERIILKYEQLPRGEQIGKALLAGSKDEKKT |
Ga0299906_100299073 | 3300030606 | Soil | MSQIDWAKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP |
Ga0299906_108347392 | 3300030606 | Soil | DWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESKSS |
Ga0268386_106123811 | 3300030619 | Soil | MSESDWARIYAQMDKRIVLKYEQLPMGEQNGKRPQAAK |
Ga0299913_107362252 | 3300031229 | Soil | MNQMDWARIYAAMDKRIELKYQQLPQGEQIGKREQPPASQTKSA |
Ga0307469_110226442 | 3300031720 | Hardwood Forest Soil | MSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAEKQQAKSS |
Ga0307405_102643072 | 3300031731 | Rhizosphere | MSQTDWAKTYAAMDGRIILKYEQLPRGEQIGKPPPAGSQGKGKP |
Ga0307473_111964372 | 3300031820 | Hardwood Forest Soil | MSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQ |
Ga0307413_105164572 | 3300031824 | Rhizosphere | MSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQTGSQNENKS |
Ga0306925_104059443 | 3300031890 | Soil | MNKPDWAKIYAEIYKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS |
Ga0306923_115614772 | 3300031910 | Soil | MNKPDWAKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNDQVRNS |
Ga0307414_109487702 | 3300032004 | Rhizosphere | MSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQAGSQDEKKS |
Ga0307411_117297331 | 3300032005 | Rhizosphere | MSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQAGSQNENKS |
Ga0310902_111317812 | 3300032012 | Soil | MSQTDWSKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS |
Ga0306924_109379442 | 3300032076 | Soil | MNKPDWVKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS |
Ga0335070_101701712 | 3300032829 | Soil | MTENFAMSQTDWVKKYAGMDSRITLKYEQLPQGEQIGKRPEVNTCQVKKS |
Ga0214471_101351211 | 3300033417 | Soil | MSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESK |
Ga0247830_100779933 | 3300033551 | Soil | MSQTDWAKVYAAMDERIILKYEQLPRGEQIGKALQAGSKDEKKT |
Ga0364945_0145370_409_543 | 3300034115 | Sediment | MSQTDWAKIYAEMDKRIVVKYEQLPKGEQVGKRPQAGNQHAKSS |
Ga0364927_0004000_2097_2243 | 3300034148 | Sediment | MRRGGFFMSQTDWAKLYAAMDKRIILKYQQLPKGEQTGKRPEKESKSS |
⦗Top⦘ |