NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F024052

Metagenome Family F024052

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024052
Family Type Metagenome
Number of Sequences 207
Average Sequence Length 43 residues
Representative Sequence MSQTDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS
Number of Associated Samples 158
Number of Associated Scaffolds 207

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.92 %
% of genes near scaffold ends (potentially truncated) 20.29 %
% of genes from short scaffolds (< 2000 bps) 80.19 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.720 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.145 % of family members)
Environment Ontology (ENVO) Unclassified
(22.705 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(29.952 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.61%    β-sheet: 0.00%    Coil/Unstructured: 76.39%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 207 Family Scaffolds
PF03401TctC 16.43
PF00903Glyoxalase 8.70
PF01042Ribonuc_L-PSP 5.80
PF04909Amidohydro_2 3.38
PF01712dNK 2.90
PF01177Asp_Glu_race 2.42
PF01070FMN_dh 2.42
PF02548Pantoate_transf 1.93
PF03070TENA_THI-4 1.93
PF02464CinA 1.93
PF01124MAPEG 1.45
PF04392ABC_sub_bind 0.97
PF01975SurE 0.97
PF00072Response_reg 0.48
PF07331TctB 0.48
PF13519VWA_2 0.48
PF13592HTH_33 0.48
PF13462Thioredoxin_4 0.48
PF09130DUF1932 0.48
PF00557Peptidase_M24 0.48
PF02371Transposase_20 0.48
PF14518Haem_oxygenas_2 0.48
PF028262-Hacid_dh_C 0.48
PF01909NTP_transf_2 0.48
PF03446NAD_binding_2 0.48
PF13414TPR_11 0.48
PF02776TPP_enzyme_N 0.48
PF01551Peptidase_M23 0.48
PF00296Bac_luciferase 0.48
PF03030H_PPase 0.48
PF04679DNA_ligase_A_C 0.48
PF13649Methyltransf_25 0.48
PF00933Glyco_hydro_3 0.48
PF07883Cupin_2 0.48
PF02569Pantoate_ligase 0.48
PF00171Aldedh 0.48
PF13492GAF_3 0.48
PF03450CO_deh_flav_C 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 207 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 16.43
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 5.80
COG1428Deoxyadenosine/deoxycytidine kinaseNucleotide transport and metabolism [F] 2.90
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 2.42
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 2.42
COG0413Ketopantoate hydroxymethyltransferaseCoenzyme transport and metabolism [H] 1.93
COG1546Nicotinamide mononucleotide (NMN) deamidase PncCCoenzyme transport and metabolism [H] 1.93
COG0496Broad specificity polyphosphatase and 5'/3'-nucleotidase SurEReplication, recombination and repair [L] 0.97
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.97
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.48
COG0414Panthothenate synthetaseCoenzyme transport and metabolism [H] 0.48
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.48
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.48
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.48
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.48
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.48
COG3547TransposaseMobilome: prophages, transposons [X] 0.48
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 0.48
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.72 %
UnclassifiedrootN/A6.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_9070640All Organisms → cellular organisms → Bacteria → Proteobacteria1458Open in IMG/M
2140918013|NODE_1594_length_1379_cov_11.755620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1411Open in IMG/M
2140918013|NODE_8251_length_1184_cov_7.368243All Organisms → cellular organisms → Bacteria → Proteobacteria1216Open in IMG/M
2170459016|G1P06HT01CHEDLAll Organisms → cellular organisms → Bacteria → Proteobacteria675Open in IMG/M
2228664022|INPgaii200_c1209947All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300000559|F14TC_100114237All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1113Open in IMG/M
3300000789|JGI1027J11758_13040554All Organisms → cellular organisms → Bacteria → Proteobacteria1042Open in IMG/M
3300003911|JGI25405J52794_10002566All Organisms → cellular organisms → Bacteria3138Open in IMG/M
3300003987|Ga0055471_10004737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2589Open in IMG/M
3300003992|Ga0055470_10009079All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300003995|Ga0055438_10084413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium876Open in IMG/M
3300003996|Ga0055467_10004504All Organisms → cellular organisms → Bacteria2408Open in IMG/M
3300003997|Ga0055466_10021878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1393Open in IMG/M
3300003999|Ga0055469_10276452Not Available540Open in IMG/M
3300004013|Ga0055465_10198931Not Available657Open in IMG/M
3300004052|Ga0055490_10187757Not Available621Open in IMG/M
3300004052|Ga0055490_10235522All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300004114|Ga0062593_100227385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1516Open in IMG/M
3300004114|Ga0062593_102314972All Organisms → cellular organisms → Bacteria → Proteobacteria604Open in IMG/M
3300004145|Ga0055489_10057371Not Available1056Open in IMG/M
3300004156|Ga0062589_101190511All Organisms → cellular organisms → Bacteria → Proteobacteria728Open in IMG/M
3300004463|Ga0063356_100308937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1966Open in IMG/M
3300004463|Ga0063356_102615631All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300004463|Ga0063356_102737468All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300004463|Ga0063356_105031839All Organisms → cellular organisms → Bacteria → Proteobacteria568Open in IMG/M
3300004463|Ga0063356_105205327All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300004480|Ga0062592_102228038All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300004643|Ga0062591_100255663All Organisms → cellular organisms → Bacteria → Proteobacteria1340Open in IMG/M
3300005289|Ga0065704_10289015All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium907Open in IMG/M
3300005295|Ga0065707_10002536All Organisms → cellular organisms → Bacteria6967Open in IMG/M
3300005295|Ga0065707_10982561All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300005332|Ga0066388_100075827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM27933701Open in IMG/M
3300005332|Ga0066388_102681106All Organisms → cellular organisms → Bacteria → Proteobacteria909Open in IMG/M
3300005332|Ga0066388_102803213All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium890Open in IMG/M
3300005332|Ga0066388_103483996All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300005332|Ga0066388_104467644All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium712Open in IMG/M
3300005332|Ga0066388_104558852All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium705Open in IMG/M
3300005336|Ga0070680_101061539All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300005339|Ga0070660_101852506All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300005445|Ga0070708_101255072All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium692Open in IMG/M
3300005457|Ga0070662_101170734All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300005468|Ga0070707_100125669All Organisms → cellular organisms → Bacteria2492Open in IMG/M
3300005555|Ga0066692_10568965All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300005559|Ga0066700_10366560All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300005713|Ga0066905_101774913Not Available568Open in IMG/M
3300005713|Ga0066905_101809753All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300005764|Ga0066903_103999635All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium790Open in IMG/M
3300005764|Ga0066903_105965025All Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
3300005937|Ga0081455_10088282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2520Open in IMG/M
3300005981|Ga0081538_10116914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1292Open in IMG/M
3300005981|Ga0081538_10195952All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300006049|Ga0075417_10002501All Organisms → cellular organisms → Bacteria5551Open in IMG/M
3300006844|Ga0075428_102690786All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006845|Ga0075421_100022900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7866Open in IMG/M
3300006845|Ga0075421_101522902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium731Open in IMG/M
3300006845|Ga0075421_102694232All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300006845|Ga0075421_102740557All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300006846|Ga0075430_100534054All Organisms → cellular organisms → Bacteria → Proteobacteria967Open in IMG/M
3300006847|Ga0075431_100653727All Organisms → cellular organisms → Bacteria → Proteobacteria1031Open in IMG/M
3300006852|Ga0075433_10404957All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1203Open in IMG/M
3300006853|Ga0075420_100293529All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1411Open in IMG/M
3300006865|Ga0073934_10122795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1912Open in IMG/M
3300006876|Ga0079217_10174792All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300006876|Ga0079217_11201275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300006894|Ga0079215_10037042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1796Open in IMG/M
3300006918|Ga0079216_10145611All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300006969|Ga0075419_10330548All Organisms → cellular organisms → Bacteria → Proteobacteria1033Open in IMG/M
3300007004|Ga0079218_10565520All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300007004|Ga0079218_12437769All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300009078|Ga0105106_10089860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2260Open in IMG/M
3300009081|Ga0105098_10090740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1307Open in IMG/M
3300009087|Ga0105107_10284782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1153Open in IMG/M
3300009100|Ga0075418_12394547All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300009137|Ga0066709_101195374All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1119Open in IMG/M
3300009157|Ga0105092_10013103All Organisms → cellular organisms → Bacteria4354Open in IMG/M
3300009157|Ga0105092_10015772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3968Open in IMG/M
3300009157|Ga0105092_10219881All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300009157|Ga0105092_10283411All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium933Open in IMG/M
3300009157|Ga0105092_10871550All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300009162|Ga0075423_10698537All Organisms → cellular organisms → Bacteria → Proteobacteria1071Open in IMG/M
3300009610|Ga0105340_1114209All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300009610|Ga0105340_1145512All Organisms → cellular organisms → Bacteria → Proteobacteria975Open in IMG/M
3300009610|Ga0105340_1398410All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium613Open in IMG/M
3300009807|Ga0105061_1000289All Organisms → cellular organisms → Bacteria4174Open in IMG/M
3300009811|Ga0105084_1001443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2714Open in IMG/M
3300009815|Ga0105070_1010832All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300009821|Ga0105064_1039045All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300010037|Ga0126304_10948088All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300010043|Ga0126380_11635154All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010047|Ga0126382_10339079All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1146Open in IMG/M
3300010047|Ga0126382_10895949All Organisms → cellular organisms → Bacteria → Proteobacteria767Open in IMG/M
3300010359|Ga0126376_12122016All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium606Open in IMG/M
3300010359|Ga0126376_12297964All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium585Open in IMG/M
3300010376|Ga0126381_102225799All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300010376|Ga0126381_103683850All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300010398|Ga0126383_12116500All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300010399|Ga0134127_10152183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2102Open in IMG/M
3300010400|Ga0134122_10630778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium995Open in IMG/M
3300011405|Ga0137340_1022087All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1169Open in IMG/M
3300011414|Ga0137442_1106478All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria613Open in IMG/M
3300011430|Ga0137423_1051835Not Available1223Open in IMG/M
3300011437|Ga0137429_1129489All Organisms → cellular organisms → Bacteria → Proteobacteria777Open in IMG/M
3300011438|Ga0137451_1186542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria657Open in IMG/M
3300012143|Ga0137354_1034024All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300012146|Ga0137322_1064352All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300012204|Ga0137374_11090311All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012208|Ga0137376_10094856All Organisms → cellular organisms → Bacteria → Proteobacteria2521Open in IMG/M
3300012353|Ga0137367_10232593All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1328Open in IMG/M
3300012361|Ga0137360_10012566All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5442Open in IMG/M
3300012941|Ga0162652_100074792All Organisms → cellular organisms → Bacteria → Proteobacteria582Open in IMG/M
3300012944|Ga0137410_10262697All Organisms → cellular organisms → Bacteria → Proteobacteria1356Open in IMG/M
3300012957|Ga0164303_11152660All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300014268|Ga0075309_1018281All Organisms → cellular organisms → Bacteria → Proteobacteria1485Open in IMG/M
3300014320|Ga0075342_1193074Not Available572Open in IMG/M
3300014865|Ga0180078_1082469All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300014877|Ga0180074_1006907All Organisms → cellular organisms → Bacteria2018Open in IMG/M
3300014883|Ga0180086_1153168Not Available600Open in IMG/M
3300014884|Ga0180104_1030667Not Available1379Open in IMG/M
3300014884|Ga0180104_1045926All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300014885|Ga0180063_1144932All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium748Open in IMG/M
3300015252|Ga0180075_1095361Not Available529Open in IMG/M
3300015255|Ga0180077_1011904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1466Open in IMG/M
3300015372|Ga0132256_100050088All Organisms → cellular organisms → Bacteria3878Open in IMG/M
3300015373|Ga0132257_100005125All Organisms → cellular organisms → Bacteria12501Open in IMG/M
3300015374|Ga0132255_100107330All Organisms → cellular organisms → Bacteria3807Open in IMG/M
3300015374|Ga0132255_105541261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300016357|Ga0182032_10139545All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300018052|Ga0184638_1011171All Organisms → cellular organisms → Bacteria3043Open in IMG/M
3300018053|Ga0184626_10002951All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6273Open in IMG/M
3300018053|Ga0184626_10123015All Organisms → cellular organisms → Bacteria → Proteobacteria1102Open in IMG/M
3300018053|Ga0184626_10408299All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300018056|Ga0184623_10057538All Organisms → cellular organisms → Bacteria1780Open in IMG/M
3300018059|Ga0184615_10106548All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300018072|Ga0184635_10010380All Organisms → cellular organisms → Bacteria3232Open in IMG/M
3300018075|Ga0184632_10006689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales4800Open in IMG/M
3300018075|Ga0184632_10177966All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium938Open in IMG/M
3300018075|Ga0184632_10412056All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300018081|Ga0184625_10189514All Organisms → cellular organisms → Bacteria → Proteobacteria1078Open in IMG/M
3300018084|Ga0184629_10131379Not Available1256Open in IMG/M
3300018422|Ga0190265_10029915All Organisms → cellular organisms → Bacteria4505Open in IMG/M
3300018422|Ga0190265_10032799All Organisms → cellular organisms → Bacteria4342Open in IMG/M
3300018422|Ga0190265_10365767All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1532Open in IMG/M
3300018422|Ga0190265_10373342All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300018422|Ga0190265_11757414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300018422|Ga0190265_11955367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium692Open in IMG/M
3300018422|Ga0190265_12670035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300018422|Ga0190265_12673188All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300018422|Ga0190265_13600755Not Available517Open in IMG/M
3300018429|Ga0190272_11537613All Organisms → cellular organisms → Bacteria → Proteobacteria678Open in IMG/M
3300018432|Ga0190275_12477359All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300018432|Ga0190275_13329103All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300018433|Ga0066667_10739500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium829Open in IMG/M
3300019377|Ga0190264_10328186All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300019789|Ga0137408_1152603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1718Open in IMG/M
3300019886|Ga0193727_1041027All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1535Open in IMG/M
3300021081|Ga0210379_10210429All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Kryptonia839Open in IMG/M
3300021344|Ga0193719_10402770All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300025324|Ga0209640_10000238All Organisms → cellular organisms → Bacteria40956Open in IMG/M
3300025559|Ga0210087_1000942All Organisms → cellular organisms → Bacteria6427Open in IMG/M
3300025792|Ga0210143_1079449All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300025917|Ga0207660_10694454All Organisms → cellular organisms → Bacteria → Proteobacteria830Open in IMG/M
3300025922|Ga0207646_10621899All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300025933|Ga0207706_10770328All Organisms → cellular organisms → Bacteria → Proteobacteria819Open in IMG/M
3300026037|Ga0208655_1007213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria879Open in IMG/M
3300026090|Ga0208912_1030120Not Available786Open in IMG/M
3300026535|Ga0256867_10021958All Organisms → cellular organisms → Bacteria → Proteobacteria2721Open in IMG/M
3300027056|Ga0209879_1026818All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300027209|Ga0209875_1002908All Organisms → cellular organisms → Bacteria2141Open in IMG/M
3300027209|Ga0209875_1004611All Organisms → cellular organisms → Bacteria1681Open in IMG/M
3300027561|Ga0209887_1067213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300027577|Ga0209874_1000158All Organisms → cellular organisms → Bacteria17885Open in IMG/M
3300027617|Ga0210002_1014818All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300027637|Ga0209818_1029429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1243Open in IMG/M
3300027646|Ga0209466_1009422All Organisms → cellular organisms → Bacteria2068Open in IMG/M
3300027647|Ga0214468_1187983All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300027650|Ga0256866_1158291All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300027654|Ga0209799_1021705All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1408Open in IMG/M
3300027691|Ga0209485_1072139All Organisms → cellular organisms → Bacteria → Proteobacteria927Open in IMG/M
3300027695|Ga0209966_1015986All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300027722|Ga0209819_10001123All Organisms → cellular organisms → Bacteria → Proteobacteria8145Open in IMG/M
3300027722|Ga0209819_10101734All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1003Open in IMG/M
3300027873|Ga0209814_10007159All Organisms → cellular organisms → Bacteria4321Open in IMG/M
3300027886|Ga0209486_10584442All Organisms → cellular organisms → Bacteria → Proteobacteria706Open in IMG/M
3300027909|Ga0209382_10460227All Organisms → cellular organisms → Bacteria → Proteobacteria1407Open in IMG/M
3300027909|Ga0209382_12201934All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300027957|Ga0209857_1000054All Organisms → cellular organisms → Bacteria22488Open in IMG/M
3300027991|Ga0247683_1021518All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria576Open in IMG/M
3300028889|Ga0247827_11076803All Organisms → cellular organisms → Bacteria → Proteobacteria551Open in IMG/M
3300030606|Ga0299906_10029907All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4357Open in IMG/M
3300030606|Ga0299906_10834739All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300030619|Ga0268386_10612381All Organisms → cellular organisms → Bacteria → Proteobacteria725Open in IMG/M
3300031229|Ga0299913_10736225All Organisms → cellular organisms → Bacteria → Proteobacteria962Open in IMG/M
3300031720|Ga0307469_11022644All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300031731|Ga0307405_10264307All Organisms → cellular organisms → Bacteria → Proteobacteria1287Open in IMG/M
3300031820|Ga0307473_11196437All Organisms → cellular organisms → Bacteria → Proteobacteria564Open in IMG/M
3300031824|Ga0307413_10516457All Organisms → cellular organisms → Bacteria → Proteobacteria962Open in IMG/M
3300031890|Ga0306925_10405944All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1460Open in IMG/M
3300031910|Ga0306923_11561477All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300032004|Ga0307414_10948770All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300032005|Ga0307411_11729733All Organisms → cellular organisms → Bacteria → Proteobacteria579Open in IMG/M
3300032012|Ga0310902_11131781All Organisms → cellular organisms → Bacteria → Proteobacteria549Open in IMG/M
3300032076|Ga0306924_10937944All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300032829|Ga0335070_10170171All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2195Open in IMG/M
3300033417|Ga0214471_10135121All Organisms → cellular organisms → Bacteria2032Open in IMG/M
3300033551|Ga0247830_10077993All Organisms → cellular organisms → Bacteria2271Open in IMG/M
3300034115|Ga0364945_0145370All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300034148|Ga0364927_0004000All Organisms → cellular organisms → Bacteria2761Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.14%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.73%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.83%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand4.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.38%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.45%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.97%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.97%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.97%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.48%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.48%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.48%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.48%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.48%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.48%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015252Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10DEnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026037Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026090Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027647Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeqEnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027957Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027991Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_003740602088090015SoilMSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS
Iowa-Corn-GraphCirc_035199502140918013SoilMSQTDWAKIYAAMDMRVALKYQQLPKGEQIGKSPPQKTQTRAS
Iowa-Corn-GraphCirc_011239502140918013SoilMSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSQTKSA
2ZMR_033043502170459016Switchgrass, Maize And Mischanthus LitterMSQTDWAKIYAAMDKRLGLKYEQLPKGEQIGKWPQSETSQMKTS
INPgaii200_120994722228664022SoilMSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQTGNQQIKSS
F14TC_10011423713300000559SoilMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKIS*
JGI1027J11758_1304055423300000789SoilMSXPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS*
JGI25405J52794_1000256623300003911Tabebuia Heterophylla RhizosphereMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0055471_1000473733300003987Natural And Restored WetlandsMNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS*
Ga0055470_1000907913300003992Natural And Restored WetlandsSMNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS*
Ga0055438_1008441323300003995Natural And Restored WetlandsMSQIDWAKIYAAMDLRIVLKYEQLPEGEQVGKRPQAKNQPVKSS*
Ga0055467_1000450443300003996Natural And Restored WetlandsIKSMNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS*
Ga0055466_1002187823300003997Natural And Restored WetlandsMKQIDWAKIYASMDKRVTLKYQQLPSGEQVGKAQPQPTPAEKSF*
Ga0055469_1027645213300003999Natural And Restored WetlandsMKAMDWAKIYAAMDKRIEVKYKQLPTGEQIGKKAYSGSSPAKKP*
Ga0055465_1019893113300004013Natural And Restored WetlandsMDQNDWAKKYAAMDKRIEWKYEQLPVGEQVGKRPEAVDASERSSVTKDSAR*
Ga0055490_1018775713300004052Natural And Restored WetlandsSQTDWAKLYSQMDKRIVVKYEQLPKGEQIGKRPPTGNQQAKPPARPATS*
Ga0055490_1023552223300004052Natural And Restored WetlandsMSQTDWAKKYAAMDKRIVLKYERLPRGEQIGKRPPAGKAQERAS*
Ga0062593_10022738523300004114SoilMSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSRTKSA*
Ga0062593_10231497223300004114SoilMSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS*
Ga0055489_1005737123300004145Natural And Restored WetlandsMSQTDWAKIYGEMDKRIIVKYEQLPQGEQVGKRPHPGAQQTKNS*
Ga0062589_10119051123300004156SoilMSQTDWAKIYAAMDMRVALKYQQLPKGEQIGKSPPQKTQTRAS*
Ga0063356_10030893723300004463Arabidopsis Thaliana RhizosphereMSQTDWAKIYAAMDKRVELKYQHLPKGEQFGKPPVPNGQSRSS*
Ga0063356_10261563123300004463Arabidopsis Thaliana RhizosphereMTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGNQGEKMP*
Ga0063356_10273746813300004463Arabidopsis Thaliana RhizosphereGSMSQTDWAKTYATMDKRIILKYEQLPRGEQIGKPAQTGTQDKGKS*
Ga0063356_10503183913300004463Arabidopsis Thaliana RhizosphereMSQTDWAKIYAAMDKRLELKYEQLPKGEQIGKRPQPKTSQTKIS*
Ga0063356_10520532723300004463Arabidopsis Thaliana RhizosphereQTDWAKIYAAMDKRIELKYEQLPRGEQIGRRPPQKNRPRPS*
Ga0062592_10222803813300004480SoilSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKRTS*
Ga0062591_10025566313300004643SoilMSQSDWAKTYATMDKRIILKYEQLPRGEQIGKAPQAGNQDKR
Ga0065704_1028901523300005289Switchgrass RhizosphereMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAEKQQAKSS*
Ga0065707_1000253663300005295Switchgrass RhizosphereMSQIDWAKIYAAMDKRVELKYQQLPKGEQIGKRSPEKNQPRPS*
Ga0065707_1098256113300005295Switchgrass RhizosphereGHLNIEGERAMSQTDWAKIYAAMDKRIELKYQQLPKGEQIGKRPAQKNQPRPA*
Ga0066388_10007582723300005332Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQAKAS*
Ga0066388_10268110623300005332Tropical Forest SoilMNQIDWAKIYAEMDKRIVVKYEQLPNGEQIGKRTQAGNCQAKNS*
Ga0066388_10280321323300005332Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPNGEQIGKRPPTGKPQVKSS*
Ga0066388_10348399633300005332Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*AIIFATTKGEF
Ga0066388_10446764413300005332Tropical Forest SoilLQMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETEQVKAS*
Ga0066388_10455885213300005332Tropical Forest SoilPREVLQMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPPAETQQAKAS*
Ga0070680_10106153923300005336Corn RhizosphereMSQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS*
Ga0070660_10185250623300005339Corn RhizosphereMSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPNAGSQHEKKS*
Ga0070708_10125507223300005445Corn, Switchgrass And Miscanthus RhizosphereMSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQAGNQQIKSS*
Ga0070662_10117073423300005457Corn RhizosphereMSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS*
Ga0070707_10012566913300005468Corn, Switchgrass And Miscanthus RhizosphereMIKPDWAKIYAEMDNRIIVKYEQLPNGEQIGKRPQAGNNK*
Ga0066692_1056896523300005555SoilMSQTDWAKIYAEMDKRIIVKYEHLPNGEQLGKRPQAGSQQIKSS*
Ga0066700_1036656023300005559SoilMNQTDWAKIYAEMDKRIIVKYEHLPNGEQLGKRPQAGSQQIKSS*
Ga0066905_10177491313300005713Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQVKAS*
Ga0066905_10180975313300005713Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQ
Ga0066903_10399963513300005764Tropical Forest SoilAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0066903_10596502523300005764Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGEQPEKNS*
Ga0081455_1008828213300005937Tabebuia Heterophylla RhizosphereMSATDWAKIYAKMDKRIVVKYEQLPNGEQVGKRPQAGQQAKKP*
Ga0081538_1011691433300005981Tabebuia Heterophylla RhizosphereMSQTDWAKIYAEMDKRIIVKYEQLPKGEQIGNRTQAETNK*
Ga0081538_1019595223300005981Tabebuia Heterophylla RhizosphereMSETDWAKIYAEMDKRIIVKYEQLPNGEQVGKRPQPRKGS*
Ga0075417_1000250183300006049Populus RhizosphereMSETDWAKIYAKMDERIVVKYEHLPKGEQIGKRPQAGNQQAKIS*
Ga0075428_10269078613300006844Populus RhizosphereGLMSQTDWAKAYAAMDERIILKYEQLPRGEQISKALQAGSKDEKKS*
Ga0075421_10002290053300006845Populus RhizosphereMSQTDWAKIYAAMGMRVALKYQQLPKGEQIGKSPPQKTQTRAS*
Ga0075421_10152290213300006845Populus RhizosphereMSQTDWAKIYAAMDKRVILKYAQLPKGEQIGKRPAQQTQTKPS*
Ga0075421_10269423223300006845Populus RhizosphereMSQTDWAKIYAAMDKRVVLKYAQLPKGEQIGKRPAQENAQAKAS*
Ga0075421_10274055713300006845Populus RhizosphereMSQTDWAKAYAAMDERIILKYEQLPRGEQIGKALQAGSKDEKKS*
Ga0075430_10053405423300006846Populus RhizosphereMSQIDWAKAYAAMDARIILKYERLPRGEQIGKAPQAGSQDEKKS*
Ga0075431_10065372723300006847Populus RhizosphereMSQTDWAKAYAAMDVRIILKYEQLPRGEQIGKAPRAGSKDEKKS*
Ga0075433_1040495723300006852Populus RhizosphereMSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS*
Ga0075420_10029352923300006853Populus RhizosphereMSETDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQAGNQQAKIS*
Ga0073934_1012279533300006865Hot Spring SedimentMSQTDWAKLYAAMDARITLKYQQLPKGEQIGKRPQQQSKAS*
Ga0079217_1017479223300006876Agricultural SoilMSQTDWAKAYAAMDERIILKYERLPRGEQIGKAPQAGSQDEKKS*
Ga0079217_1120127523300006876Agricultural SoilMSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKQDLL*
Ga0079215_1003704233300006894Agricultural SoilMSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKARPSLRNLWV*
Ga0079216_1014561123300006918Agricultural SoilMSQTDWAKIYAVMDKRVELKYAQLPKGEQIGARPAQVKAQVKNLSG*
Ga0075419_1033054823300006969Populus RhizosphereMSQIDWAKAYAAMDARIILKYERLPRGEQIGKALQAGSKDEKKS*
Ga0079218_1056552033300007004Agricultural SoilMTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGHEGEKMP*
Ga0079218_1243776923300007004Agricultural SoilMSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPAQVKAQVKKS*
Ga0105106_1008986013300009078Freshwater SedimentMSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEQKAF*
Ga0105098_1009074023300009081Freshwater SedimentMSQTDWAKIYAEMDKRILVKYEQLPKGEQVGKPSPSEKNS*
Ga0105107_1028478223300009087Freshwater SedimentMSQTDWAKIYAAMDKRLDLKYEQLPKGEQIGKRPQPKTSQTKIS*
Ga0075418_1239454723300009100Populus RhizosphereMSETDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQA
Ga0066709_10119537413300009137Grasslands SoilREVLQMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS*
Ga0105092_1001310353300009157Freshwater SedimentMSQIDWAKIYAKMDKRILVKYEQLPNGEQIGKRPQTGNQQAKSS*
Ga0105092_1001577243300009157Freshwater SedimentMSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKRPEKESKSA*
Ga0105092_1021988133300009157Freshwater SedimentMSATDWAKIYAEMDKRIIVKYEQLPNGEQAGKRPQAGQQAKKP*
Ga0105092_1028341123300009157Freshwater SedimentMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPPAEKQQAKSS*
Ga0105092_1087155013300009157Freshwater SedimentMSQTDWAKIYAAMDKRIAVKYEQLPNGEQIGKRPQAENQQAKSS*
Ga0075423_1069853713300009162Populus RhizosphereMSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAGNQQAKIS*
Ga0105340_111420923300009610SoilMSQTDWAKTYAAMDNRIVLKYEQLPNGEQIGKRPQPESQPAKIPEGE*
Ga0105340_114551223300009610SoilMSQTDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS*
Ga0105340_139841023300009610SoilMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGKQQAKSS*
Ga0105061_100028953300009807Groundwater SandMSERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS*
Ga0105084_100144333300009811Groundwater SandMCQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES*
Ga0105070_101083223300009815Groundwater SandMRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES*
Ga0105064_103904523300009821Groundwater SandMSERDWAKIYALMDKRIVVKYEQLPNGEQIGKRPQAGNQPAKSS*
Ga0126304_1094808823300010037Serpentine SoilMSQTDWAKTYAAMDKRIILKYEQLPRGEQVGNGPQSGSQEEKKSS*
Ga0126380_1163515423300010043Tropical Forest SoilMSQIDWAKVYAEMDKRIVVKYEQLPKGEQIGKRPPAGNQPASPS*
Ga0126382_1033907913300010047Tropical Forest SoilIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0126382_1089594913300010047Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLANGEQIGKRPPAGNEPVKAS*
Ga0126376_1212201613300010359Tropical Forest SoilIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0126376_1229796423300010359Tropical Forest SoilMSQLDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAETQQAKAS*
Ga0126381_10222579923300010376Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPPAGNQQANPS*
Ga0126381_10368385013300010376Tropical Forest SoilMSQIDWAKIYAKMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS*
Ga0126383_1211650023300010398Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRPQAEPQQVKDS*
Ga0134127_1015218323300010399Terrestrial SoilMNQTDWAKIYAAMDKRIELKYEQLPKGEQIGRRPPQKNQPRPS*
Ga0134122_1063077823300010400Terrestrial SoilSQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS*
Ga0137340_102208723300011405SoilMSQTDWAKIYAAMDKRIVVKYQQLPKGEQIGKRPPPGNQQGKNS*
Ga0137442_110647823300011414SoilMSQVDWAKKYAVMDKRLMLKYEQLPKGEQIGKKPTP
Ga0137423_105183523300011430SoilMSQTDWAKLYAAMDKRITLKYEQLPKGEQIGKGPEKERKNA*
Ga0137429_112948913300011437SoilMSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGEAPGTRK
Ga0137451_118654223300011438SoilMSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKQPELLQQNSNKPSQA*
Ga0137354_103402413300012143SoilMSQTDWAKIYAAMDKRIVVKYQQLPKGEQIGKRPPPGNQQGKN
Ga0137322_106435213300012146SoilMSQTDWAKIYAAMDKRIELKYEQLPKGEQIGKRQPQKNQPRPA*
Ga0137374_1109031113300012204Vadose Zone SoilMSQTDWAKIYAKMDERIVVKYEQLPKGEQIGKRPQAGNQQAKSS*
Ga0137376_1009485623300012208Vadose Zone SoilMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS*
Ga0137367_1023259323300012353Vadose Zone SoilMSQTDWAKIYAKMDERIVVKYEQLPKGEQIGRRPQAGNRQAKSS*
Ga0137360_1001256623300012361Vadose Zone SoilMSQTDWAKIYAEMDKRIIVKYEQLPNGEQLGKRPQTGNQQIKSS*
Ga0162652_10007479223300012941SoilMSQPDWAKIYAKMDKRIVVKYEQLPRGEQIGKRPQAETQQAKSS*
Ga0137410_1026269733300012944Vadose Zone SoilMSETDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS*
Ga0164303_1115266013300012957SoilQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS*
Ga0075309_101828123300014268Natural And Restored WetlandsMSQIDWAKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP*
Ga0075342_119307413300014320Natural And Restored WetlandsMSRTDWAKLYSQMDKRIVVKYEQLPKGEQIGKRPPTGNQQAKPPARPATS*
Ga0180078_108246913300014865SoilMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGTQQAKSS*
Ga0180074_100690713300014877SoilMSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKDV*
Ga0180086_115316813300014883SoilMTQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQSEKESKSS*
Ga0180104_103066713300014884SoilMSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKRPEKERKPA*
Ga0180104_104592633300014884SoilMSQSDWAKLYAAVDKRIILKYQQLPKGEQIGKRPEKESKSA*
Ga0180063_114493223300014885SoilMSQTDWSKKYAEMDKRIVLKYERLPNGEQIGKRPQTGKAEEKAS*
Ga0180075_109536113300015252SoilMRRGGLLVSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQPEKERKDV*
Ga0180077_101190433300015255SoilMSQTDWAKLYAAMDKRIILKYQQLPKGEQIGKQLEKESKSS*
Ga0132256_10005008853300015372Arabidopsis RhizosphereQSDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPVAGHQQTKSS*
Ga0132257_10000512573300015373Arabidopsis RhizosphereMSQSDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPVAGHQQTKSS*
Ga0132255_10010733013300015374Arabidopsis RhizosphereMSQTDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPQA
Ga0132255_10554126123300015374Arabidopsis RhizosphereMSQTDWAKIYAAMDKRIVVKYEQLPRGEQVGKRPQAGYQQAKNS*
Ga0182032_1013954513300016357SoilMNKPDWAKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS
Ga0184638_101117113300018052Groundwater SedimentMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS
Ga0184626_1000295163300018053Groundwater SedimentMSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKPA
Ga0184626_1012301523300018053Groundwater SedimentMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAKNQQAKSS
Ga0184626_1040829923300018053Groundwater SedimentMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAENQQAKSS
Ga0184623_1005753823300018056Groundwater SedimentMSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESKSS
Ga0184615_1010654823300018059Groundwater SedimentMSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKDV
Ga0184635_1001038053300018072Groundwater SedimentMSEPDWAKIYAEMDKRILVKYEQLPNGEQIGKRPQAGNQRAKSS
Ga0184632_1000668933300018075Groundwater SedimentMSLRDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKERKPA
Ga0184632_1017796623300018075Groundwater SedimentVHSTKEVLPMSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGRRPQAGNQQAKSS
Ga0184632_1041205623300018075Groundwater SedimentVHSTKEVLPMSQTDWAKIYAAMDKRIVVKYEQLPKGEQIGKRP
Ga0184625_1018951423300018081Groundwater SedimentMSQTDWAKIYAGMDKRIVVKYEQLPKGEQIGKRPQAGNQQAKSS
Ga0184629_1013137923300018084Groundwater SedimentMSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQPQKERKPA
Ga0190265_1002991523300018422SoilMSEIDWAKTYAKMDKRIILKYEQLPQGEQIGKVLQAGSQEAKKS
Ga0190265_1003279943300018422SoilMSQTDWAKTYAVMDERIILKYEELPKGEQIGKAPPAGSQDEKKS
Ga0190265_1036576723300018422SoilMSQTDWAKIYAAMDKRVGLKYAQLPKGEQIGKRPPQQTKARPSLRNLWV
Ga0190265_1037334233300018422SoilMSQTDWAKTYAKMDKRIILKYEQLPKGEQIGKASQAGSQEAKKS
Ga0190265_1175741423300018422SoilMMSQTDWAKIYAAMDKRVALKYQQLPKGEQIGKRPAQQTQTKPS
Ga0190265_1195536723300018422SoilMSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEEKAS
Ga0190265_1267003523300018422SoilMNQTDWAKIYAAMDKRVVIKYQQLPKGEQIGKRPAQQTQTKPS
Ga0190265_1267318813300018422SoilMSQTDWAKTYAVMDKRITLKYEQLAKGEQIGEAPQTGSQDEKKS
Ga0190265_1360075523300018422SoilMSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQPGKAGEKAS
Ga0190272_1153761323300018429SoilMNQTDWAKIYAAMDKRVVMKYQQLPKGEQIGKRPAQQTQTKPS
Ga0190275_1247735913300018432SoilMTQPDWAKTYAAMDMRISLKYEQLPRGEQIGKSPPAGNQGEKMP
Ga0190275_1332910323300018432SoilMSQTDWAKTYAKMDKRIILKYEQLPKGEQIGKASQAGS
Ga0066667_1073950013300018433Grasslands SoilMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGRRPQAEKQQAKSS
Ga0190264_1032818623300019377SoilMSQTDWAKTYAAMDKRIILKYQQLPRGEQIGKTSQAGPEAKKT
Ga0137408_115260323300019789Vadose Zone SoilMSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQAETQQAKSS
Ga0193727_104102723300019886SoilMSQTDWAKIYAKMDKRIVVKYEQLPKGEQVGKRPQAGNQQAKSS
Ga0210379_1021042923300021081Groundwater SedimentMSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKQLEKESKSS
Ga0193719_1040277013300021344SoilFLAPGPREVLLMSQTDWAKIYAKMDKRIVVKYEQLPKGEQVGKRPQAGNQQAKSS
Ga0209640_10000238313300025324SoilMSQIDWVKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP
Ga0210087_100094223300025559Natural And Restored WetlandsMNQTDWAKIYAAMDKRLELKYDQLPKGEQIGKRTQQQTSQTKSS
Ga0210143_107944913300025792Natural And Restored WetlandsMIQTDWAKTYAAMDKRIELKYEQLPKGEQIGKQPQQQTSQTKSS
Ga0207660_1069445423300025917Corn RhizosphereMSQTDWAKIYAAMDKRVELKYQHLPKGEQIGKPPVPNGQSRSS
Ga0207646_1062189913300025922Corn, Switchgrass And Miscanthus RhizosphereMIKPDWAKIYAEMDNRIIVKYEQLPNGEQIGKRPQAGNNK
Ga0207706_1077032823300025933Corn RhizosphereMSQTDWPKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS
Ga0208655_100721323300026037Natural And Restored WetlandsMGQTDWAKLYAAMDKRIDLKYRQLPEGEQVGKRPEKEEKASESSRS
Ga0208912_103012013300026090Natural And Restored WetlandsMSPTDWAKTYAAMDNRIELKYQQLPKGEQTGKRPPPPEKR
Ga0256867_1002195833300026535SoilMMSQTDWAKIYAAMDKRIELKYEQLPKGEQIGKRAETERPQGKD
Ga0209879_102681823300027056Groundwater SandMSERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS
Ga0209875_100290843300027209Groundwater SandERDWAKIYALMDKRIVVKYEQLPKGEQIGKRPQAGNQPAKSS
Ga0209875_100461123300027209Groundwater SandMRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQPES
Ga0209887_106721323300027561Groundwater SandMRQTDWAKTYVAMDNRIVLKYEQLPDGEQIGKRPQPES
Ga0209874_1000158163300027577Groundwater SandMRQTDWAKTNAAMDNRIVFKYEQLPDGEQIRKRPQPES
Ga0210002_101481833300027617Arabidopsis Thaliana RhizosphereMSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRE
Ga0209818_102942923300027637Agricultural SoilMSQTDWAKIYAAMDKRVGLKYAQLRKGEQIGKRPPQQTKQDLL
Ga0209466_100942223300027646Tropical Forest SoilMSQIDWAKIYAKMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS
Ga0214468_118798313300027647SoilMSDSDWARIYAQMDKRIVLKYEQLPTGEQIGKRPQAAKEQNQKA
Ga0256866_115829123300027650SoilVSQTDWAKIYAEMDKRILLKYEQMPKGEQIGKRFQAEGEEAKRS
Ga0209799_102170523300027654Tropical Forest SoilMSQIDWAKIYAEMDKRIVVKYEQLPKGEQIGKRAQAETQQVKAS
Ga0209485_107213913300027691Agricultural SoilMSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPAQVKAQVKKS
Ga0209966_101598613300027695Arabidopsis Thaliana RhizosphereMSQIDWAKVYAAMDKRIELKYDQLPKGEQIGKCTPRETSRTKSA
Ga0209819_1000112393300027722Freshwater SedimentMSQTDWAKIYAEMDKRILVKYEQLPKGEQVGKPSPSEKNS
Ga0209819_1010173413300027722Freshwater SedimentMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPPAEKQQAKSS
Ga0209814_1000715943300027873Populus RhizosphereMSETDWAKIYAKMDERIVVKYEHLPKGEQIGKRPQAGNQQAKIS
Ga0209486_1058444213300027886Agricultural SoilMSQTDWAKAYAAMDERIILKYERLPRGEQIGKAPQAGNQDEKKS
Ga0209382_1046022733300027909Populus RhizosphereMSQTDWAKAYAAMDVRIILKYEQLPRGEQIGKAPQAGSKDEKKS
Ga0209382_1220193413300027909Populus RhizosphereMSQTDWAKIYAAMDKRVVLKYAQLPKGEQIGKRPAQENAQAKAS
Ga0209857_100005413300027957Groundwater SandMRQTDWAKTYAAMDNRIVFKYEQLPDGEQIGKRPQP
Ga0247683_102151813300027991SoilMSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKQPT
Ga0247827_1107680323300028889SoilMSQTDWAKVYAAMDERIILKYEQLPRGEQIGKALLAGSKDEKKT
Ga0299906_1002990733300030606SoilMSQIDWAKTYAAMDKRIELKYQQLPKGEQTGKRPQPEKPQGKP
Ga0299906_1083473923300030606SoilDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESKSS
Ga0268386_1061238113300030619SoilMSESDWARIYAQMDKRIVLKYEQLPMGEQNGKRPQAAK
Ga0299913_1073622523300031229SoilMNQMDWARIYAAMDKRIELKYQQLPQGEQIGKREQPPASQTKSA
Ga0307469_1102264423300031720Hardwood Forest SoilMSQTDWAKIYAKMDKRIVVKYEQLPKGEQIGKRPQAEKQQAKSS
Ga0307405_1026430723300031731RhizosphereMSQTDWAKTYAAMDGRIILKYEQLPRGEQIGKPPPAGSQGKGKP
Ga0307473_1119643723300031820Hardwood Forest SoilMSQPDWAKIYAKMDKRIVVKYEQLPQGEQIGKRPQ
Ga0307413_1051645723300031824RhizosphereMSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQTGSQNENKS
Ga0306925_1040594433300031890SoilMNKPDWAKIYAEIYKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS
Ga0306923_1156147723300031910SoilMNKPDWAKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNDQVRNS
Ga0307414_1094877023300032004RhizosphereMSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQAGSQDEKKS
Ga0307411_1172973313300032005RhizosphereMSQTDWAKTYAAMDKRIILKYEQLPRGEQIGKAPQAGSQNENKS
Ga0310902_1113178123300032012SoilMSQTDWSKIYAAMDKRITLKYEQLPRGEQIGKPPKAGSQHEKKS
Ga0306924_1093794423300032076SoilMNKPDWVKIYAEMDKRIIVKYEQLPNGEQIGKRPQAGNHQVRNS
Ga0335070_1017017123300032829SoilMTENFAMSQTDWVKKYAGMDSRITLKYEQLPQGEQIGKRPEVNTCQVKKS
Ga0214471_1013512113300033417SoilMSQTDWAKLYAAMDKRIILKYEQLPKGEQIGKRPEKESK
Ga0247830_1007799333300033551SoilMSQTDWAKVYAAMDERIILKYEQLPRGEQIGKALQAGSKDEKKT
Ga0364945_0145370_409_5433300034115SedimentMSQTDWAKIYAEMDKRIVVKYEQLPKGEQVGKRPQAGNQHAKSS
Ga0364927_0004000_2097_22433300034148SedimentMRRGGFFMSQTDWAKLYAAMDKRIILKYQQLPKGEQTGKRPEKESKSS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.