NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F024039

Metagenome / Metatranscriptome Family F024039

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024039
Family Type Metagenome / Metatranscriptome
Number of Sequences 207
Average Sequence Length 45 residues
Representative Sequence NMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER
Number of Associated Samples 145
Number of Associated Scaffolds 207

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.49 %
% of genes near scaffold ends (potentially truncated) 93.72 %
% of genes from short scaffolds (< 2000 bps) 82.13 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (61.353 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(47.826 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(63.285 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.93%    β-sheet: 0.00%    Coil/Unstructured: 55.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 207 Family Scaffolds
PF13384HTH_23 22.22
PF04488Gly_transf_sug 7.25
PF12804NTP_transf_3 5.80
PF00535Glycos_transf_2 5.31
PF01755Glyco_transf_25 4.83
PF08241Methyltransf_11 4.83
PF01583APS_kinase 4.35
PF13489Methyltransf_23 2.42
PF13578Methyltransf_24 2.42
PF01135PCMT 2.42
PF13542HTH_Tnp_ISL3 2.42
PF05050Methyltransf_21 1.93
PF12705PDDEXK_1 1.45
PF09834DUF2061 0.97
PF01467CTP_transf_like 0.97
PF01370Epimerase 0.97
PF00106adh_short 0.48
PF02627CMD 0.48
PF00107ADH_zinc_N 0.48
PF13620CarboxypepD_reg 0.48
PF05575V_cholerae_RfbT 0.48
PF06067DUF932 0.48
PF136402OG-FeII_Oxy_3 0.48
PF05219DREV 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 207 Family Scaffolds
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 7.25
COG3306Glycosyltransferase involved in LPS biosynthesis, GR25 familyCell wall/membrane/envelope biogenesis [M] 4.83
COG0529Adenylylsulfate kinase or related kinaseInorganic ion transport and metabolism [P] 4.35
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 2.42
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 2.42
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 2.42
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 2.42
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.48
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.51 %
UnclassifiedrootN/A14.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035265000|ErSWdraf_F5BXKTZ02GIQG1All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300000756|JGI12421J11937_10013743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3071Open in IMG/M
3300001850|RCM37_1086755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1797Open in IMG/M
3300001850|RCM37_1172423All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300001851|RCM31_10100690All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300002375|B570J29617_1008317Not Available601Open in IMG/M
3300002408|B570J29032_109497592All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300002835|B570J40625_101704380Not Available512Open in IMG/M
3300003499|JGI25930J51415_1080496All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300004054|Ga0063232_10117010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300004125|Ga0066182_10114952All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300004240|Ga0007787_10407307All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005517|Ga0070374_10526407All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005517|Ga0070374_10545874All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005584|Ga0049082_10030276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1891Open in IMG/M
3300005584|Ga0049082_10189160Not Available707Open in IMG/M
3300005584|Ga0049082_10190085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage705Open in IMG/M
3300005662|Ga0078894_10371211All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300005662|Ga0078894_10513045All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300005662|Ga0078894_10894015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage771Open in IMG/M
3300005662|Ga0078894_11494701All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300005805|Ga0079957_1075542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1927Open in IMG/M
3300005805|Ga0079957_1080029All Organisms → cellular organisms → Bacteria → Proteobacteria1850Open in IMG/M
3300005805|Ga0079957_1150147All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300005805|Ga0079957_1224392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage889Open in IMG/M
3300005940|Ga0073913_10025574All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300007171|Ga0102977_1031345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1670Open in IMG/M
3300007177|Ga0102978_1047539All Organisms → Viruses → Predicted Viral4921Open in IMG/M
3300007177|Ga0102978_1058735Not Available2184Open in IMG/M
3300007177|Ga0102978_1086843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1085Open in IMG/M
3300007212|Ga0103958_1212339All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300007544|Ga0102861_1173680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300007546|Ga0102874_1080211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1038Open in IMG/M
3300007549|Ga0102879_1077716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1044Open in IMG/M
3300007559|Ga0102828_1189362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300007606|Ga0102923_1067408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1125Open in IMG/M
3300007634|Ga0102901_1084899All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage909Open in IMG/M
3300007637|Ga0102906_1139111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300007639|Ga0102865_1081019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage969Open in IMG/M
3300007649|Ga0102912_1071416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1004Open in IMG/M
3300008108|Ga0114341_10360215All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300008108|Ga0114341_10403534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300008110|Ga0114343_1042771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1800Open in IMG/M
3300008110|Ga0114343_1052856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1901Open in IMG/M
3300008110|Ga0114343_1076204All Organisms → Viruses → Predicted Viral1216Open in IMG/M
3300008110|Ga0114343_1176907Not Available647Open in IMG/M
3300008110|Ga0114343_1224745All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300008111|Ga0114344_1009208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7702Open in IMG/M
3300008111|Ga0114344_1022394All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2554Open in IMG/M
3300008113|Ga0114346_1105977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1277Open in IMG/M
3300008113|Ga0114346_1163713All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300008117|Ga0114351_1156051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1249Open in IMG/M
3300008117|Ga0114351_1321150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage717Open in IMG/M
3300008119|Ga0114354_1168540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage795Open in IMG/M
3300008120|Ga0114355_1086715Not Available1272Open in IMG/M
3300008120|Ga0114355_1171103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300008120|Ga0114355_1225829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300008261|Ga0114336_1093373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1430Open in IMG/M
3300008261|Ga0114336_1174572Not Available927Open in IMG/M
3300008264|Ga0114353_1052494All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2313Open in IMG/M
3300008953|Ga0104241_1014097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300008962|Ga0104242_1087404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300009026|Ga0102829_1269463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300009155|Ga0114968_10609981Not Available577Open in IMG/M
3300009159|Ga0114978_10584389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300009161|Ga0114966_10155879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1482Open in IMG/M
3300009161|Ga0114966_10265787All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1052Open in IMG/M
3300009161|Ga0114966_10481605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage710Open in IMG/M
3300009164|Ga0114975_10331093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300009181|Ga0114969_10354926All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage850Open in IMG/M
3300009183|Ga0114974_10068106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2340Open in IMG/M
3300009183|Ga0114974_10112835All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1736Open in IMG/M
3300009183|Ga0114974_10737669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300009184|Ga0114976_10415690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage702Open in IMG/M
3300009419|Ga0114982_1155509All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300010312|Ga0102883_1138549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300010354|Ga0129333_10017197Not Available6877Open in IMG/M
3300010354|Ga0129333_10101519All Organisms → Viruses → Predicted Viral2658Open in IMG/M
3300010354|Ga0129333_10470045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1106Open in IMG/M
3300010354|Ga0129333_10470047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1106Open in IMG/M
3300010354|Ga0129333_10588735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage967Open in IMG/M
3300010354|Ga0129333_10671127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage893Open in IMG/M
3300010370|Ga0129336_10283125Not Available925Open in IMG/M
3300010370|Ga0129336_10633828Not Available569Open in IMG/M
3300010388|Ga0136551_1053897All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300010885|Ga0133913_13457646Not Available1032Open in IMG/M
3300011268|Ga0151620_1162184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300011268|Ga0151620_1209260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300012000|Ga0119951_1013050All Organisms → cellular organisms → Bacteria3275Open in IMG/M
3300012667|Ga0157208_10002177All Organisms → cellular organisms → Bacteria3928Open in IMG/M
3300012970|Ga0129338_1583156All Organisms → cellular organisms → Bacteria3003Open in IMG/M
3300013004|Ga0164293_10056501All Organisms → cellular organisms → Bacteria3142Open in IMG/M
3300013004|Ga0164293_10097953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2257Open in IMG/M
3300013005|Ga0164292_10471860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales826Open in IMG/M
(restricted) 3300013126|Ga0172367_10111361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1899Open in IMG/M
(restricted) 3300013126|Ga0172367_10344517All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6862Open in IMG/M
(restricted) 3300013132|Ga0172372_10150897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1839Open in IMG/M
(restricted) 3300013132|Ga0172372_10179523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1631Open in IMG/M
3300014050|Ga0119952_1037326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1420Open in IMG/M
3300017761|Ga0181356_1077265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1110Open in IMG/M
3300017788|Ga0169931_10040924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5210Open in IMG/M
3300019784|Ga0181359_1160150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300020074|Ga0194113_10290426All Organisms → Viruses → Predicted Viral1246Open in IMG/M
3300020172|Ga0211729_11290776Not Available1149Open in IMG/M
3300020172|Ga0211729_11293051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300020183|Ga0194115_10475088All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300020200|Ga0194121_10125264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1558Open in IMG/M
3300020205|Ga0211731_10864312Not Available763Open in IMG/M
3300020205|Ga0211731_11151637Not Available11215Open in IMG/M
3300020487|Ga0208200_109679Not Available785Open in IMG/M
3300020498|Ga0208050_1000418All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6970Open in IMG/M
3300020529|Ga0208233_1014075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1100Open in IMG/M
3300020530|Ga0208235_1028948Not Available666Open in IMG/M
3300020543|Ga0208089_1014310All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1212Open in IMG/M
3300020558|Ga0208362_1063937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300020568|Ga0208598_1011214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1414Open in IMG/M
3300020571|Ga0208723_1054405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300021140|Ga0214168_1032040All Organisms → Viruses → Predicted Viral1349Open in IMG/M
3300021141|Ga0214163_1041602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1239Open in IMG/M
3300021424|Ga0194117_10135669All Organisms → Viruses → Predicted Viral1270Open in IMG/M
3300021962|Ga0222713_10129640All Organisms → Viruses → Predicted Viral1768Open in IMG/M
3300021962|Ga0222713_10545779Not Available685Open in IMG/M
3300021962|Ga0222713_10682524All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300022190|Ga0181354_1164977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300022752|Ga0214917_10015390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6644Open in IMG/M
3300024289|Ga0255147_1003421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3726Open in IMG/M
3300024289|Ga0255147_1020949Not Available1370Open in IMG/M
3300024306|Ga0255148_1025452Not Available1116Open in IMG/M
3300024351|Ga0255141_1000053All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes43598Open in IMG/M
3300024352|Ga0255142_1040132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300024357|Ga0255165_1016779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1396Open in IMG/M
3300024496|Ga0255151_1011660All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300024500|Ga0255143_1037685All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage797Open in IMG/M
3300024505|Ga0255150_1039850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage766Open in IMG/M
3300024865|Ga0256340_1002951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Paludibacteraceae → Paludibacter → Paludibacter propionicigenes → Paludibacter propionicigenes WB43841Open in IMG/M
3300024865|Ga0256340_1073477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
3300024866|Ga0255272_1098050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300025848|Ga0208005_1281132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes511Open in IMG/M
3300027128|Ga0255099_1058154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300027131|Ga0255066_1038834All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300027133|Ga0255070_1045074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300027215|Ga0208166_1025813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300027218|Ga0208165_1012998All Organisms → cellular organisms → Bacteria → Proteobacteria1260Open in IMG/M
3300027281|Ga0208440_1032617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1193Open in IMG/M
3300027320|Ga0208923_1025985All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1039Open in IMG/M
3300027467|Ga0255154_1064372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage813Open in IMG/M
3300027503|Ga0255182_1050185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1086Open in IMG/M
3300027531|Ga0208682_1052062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1050Open in IMG/M
3300027541|Ga0255158_1015617All Organisms → Viruses → Predicted Viral1777Open in IMG/M
3300027547|Ga0209864_1015578Not Available870Open in IMG/M
3300027600|Ga0255117_1038777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1005Open in IMG/M
3300027608|Ga0208974_1026769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1759Open in IMG/M
3300027631|Ga0208133_1054983Not Available958Open in IMG/M
3300027656|Ga0209357_1105912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300027659|Ga0208975_1011394All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3041Open in IMG/M
3300027679|Ga0209769_1238212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300027689|Ga0209551_1003383All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5876Open in IMG/M
3300027720|Ga0209617_10366042All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300027754|Ga0209596_1200801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage850Open in IMG/M
3300027756|Ga0209444_10238261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300027759|Ga0209296_1121016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1218Open in IMG/M
3300027763|Ga0209088_10349147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300027772|Ga0209768_10007931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6167Open in IMG/M
3300027797|Ga0209107_10015704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4316Open in IMG/M
3300027797|Ga0209107_10476293Not Available558Open in IMG/M
3300027808|Ga0209354_10213816All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300027816|Ga0209990_10055587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2005Open in IMG/M
3300027963|Ga0209400_1015705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4601Open in IMG/M
3300027974|Ga0209299_1070056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1419Open in IMG/M
3300028113|Ga0255234_1076654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage883Open in IMG/M
(restricted) 3300028114|Ga0247835_1049250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1873Open in IMG/M
3300031758|Ga0315907_10538978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage916Open in IMG/M
3300031758|Ga0315907_11011737All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300031786|Ga0315908_10688002All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300031787|Ga0315900_10062737All Organisms → cellular organisms → Bacteria3830Open in IMG/M
3300031787|Ga0315900_10158291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2081Open in IMG/M
3300031857|Ga0315909_10127838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2133Open in IMG/M
3300031857|Ga0315909_10162848All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1818Open in IMG/M
3300031857|Ga0315909_10272932Not Available1282Open in IMG/M
3300031951|Ga0315904_10334022Not Available1403Open in IMG/M
3300031951|Ga0315904_10432590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1182Open in IMG/M
3300031951|Ga0315904_10454579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1143Open in IMG/M
3300031951|Ga0315904_10495910Not Available1078Open in IMG/M
3300031951|Ga0315904_11480887All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031963|Ga0315901_10733264All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300031963|Ga0315901_11159648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300032050|Ga0315906_10069448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3591Open in IMG/M
3300032050|Ga0315906_10190089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1943Open in IMG/M
3300032050|Ga0315906_10328674Not Available1363Open in IMG/M
3300032050|Ga0315906_10526333All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300032050|Ga0315906_11047008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300032050|Ga0315906_11281393All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300032116|Ga0315903_10154465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2102Open in IMG/M
3300032116|Ga0315903_10370442All Organisms → cellular organisms → Bacteria → Proteobacteria1178Open in IMG/M
3300033996|Ga0334979_0649212Not Available555Open in IMG/M
3300034023|Ga0335021_0175236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1208Open in IMG/M
3300034062|Ga0334995_0761833Not Available536Open in IMG/M
3300034073|Ga0310130_0006204All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4570Open in IMG/M
3300034102|Ga0335029_0084526All Organisms → Viruses → Predicted Viral2264Open in IMG/M
3300034118|Ga0335053_0473833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300034118|Ga0335053_0599679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300034121|Ga0335058_0051067All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2418Open in IMG/M
3300034284|Ga0335013_0197447All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300034356|Ga0335048_0163257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1263Open in IMG/M
3300034356|Ga0335048_0378404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300034357|Ga0335064_0009445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4971Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater11.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.14%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake9.66%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton9.66%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater9.66%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake8.21%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.80%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient4.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.86%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.42%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.93%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.45%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.45%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.97%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.97%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.97%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.48%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.48%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.48%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.48%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.48%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2035265000Freshwater microbial communities from Swedish Lakes - surface of Lake ErkenEnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300002375Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004125Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007212Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projectsEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008953Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4EnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010312Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020487Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020529Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020543Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020558Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020568Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021140Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300021141Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300024351Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024357Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300024496Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300024500Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300024505Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024866Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027128Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8dEnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027133Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300027215Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027218Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8dEnvironmentalOpen in IMG/M
3300027531Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027541Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8hEnvironmentalOpen in IMG/M
3300027547Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027689Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034023Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ErSWdraft_91687602035265000FreshwaterMRKQRTVDYFNNKYGLSLDDFDVADAFGIAHYSNEELTKR
JGI12421J11937_1001374363300000756Freshwater And SedimentMRKQRTVDYFNIKYGIKLDDFDVADSFGIAHYANKVLTER*
RCM37_108675543300001850Marine PlanktonKNKMRNIRKQRTVDYFNKMYGLSLSDFDVADSFGIAHYSNRVLTER*
RCM37_117242313300001850Marine PlanktonYKNKMRNIRKQRTVDWVKDKFDINLTDFDVADSFGIAYYANKVLTER*
RCM31_1010069033300001851Marine PlanktonETRKQRTVDYFNKKYNLNLLDFDVADSFGIAHYSNRVLTER*
B570J29617_100831723300002375FreshwaterMRKQRTVDYFNNKYKLLLTDFDVADAFGIAHYSNEVLTKR*
B570J29032_10949759233300002408FreshwaterRTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER*
B570J40625_10170438023300002835FreshwaterRNMRKQRTADYFNKKYKLDVVDFDVADSFGIAHYANKVLTER*
JGI25930J51415_108049613300003499Freshwater LakeYKTQLRNMRKQRTVDYFNNKYGILLNDFDVADSFGIAHYANKVLTER*
Ga0063232_1011701013300004054Freshwater LakeESWYKNQLRNMRKQRTADYFNKKYGLNIVDYDVADSFGIAHYSNQVLTKR*
Ga0066182_1011495233300004125Freshwater LakeRNMRKQRTADYFNKKYGIEIVDFDVADSFGIAHYGNQVLTKR*
Ga0007787_1040730733300004240Freshwater LakeNPGYADSWYKTQLRNMRKQRTVDYFNSKYSLTITDFDVADAFGIAHYANKVLTER*
Ga0070374_1052640713300005517Freshwater LakeQLRNMRKQRTVDYFNNKYKLEINDFDVADSFGIAYYANNVLTKR*
Ga0070374_1054587433300005517Freshwater LakeRTVDYFNLKYGLSIDDFDVADSFGIAHYSNQVLTKR*
Ga0049082_1003027663300005584Freshwater LenticKQRTADYFNKKYGLEIVDFDVADSFGIAHYSNQVLTKR*
Ga0049082_1018916033300005584Freshwater LenticWYQNQLRTMRKQRTVDYFNSKYNLALSDFDVADSFGIAHYANKVLTER*
Ga0049082_1019008513300005584Freshwater LenticLRNMRKQRTADYFNKKYGLNIVDYDVADSFGIAHYSNQVLTKR*
Ga0078894_1037121153300005662Freshwater LakeADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER*
Ga0078894_1051304543300005662Freshwater LakeQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER*
Ga0078894_1089401513300005662Freshwater LakeNQLRNMRKQRTVDYFNKKYTLSLEDFDVADAFGIAHYSNTILTER*
Ga0078894_1149470133300005662Freshwater LakeADSWYKTQLRNMRKQRTVDYFNSKYRLSLEDFDVADSFGIAHYANKVLTER*
Ga0079957_107554213300005805LakeRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER*
Ga0079957_108002913300005805LakeKQRTADYFNKKYNLKLEDFDVADSFGIAYYANEVLTKR*
Ga0079957_115014713300005805LakeQRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER*
Ga0079957_122439213300005805LakeTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER*
Ga0073913_1002557433300005940SandDSWYKTQLRNMRKQRTVDYFNNKYKISLDDFDVADSFGIAHYANKVLTER*
Ga0102977_103134523300007171Freshwater LakeMRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER*
Ga0102978_104753913300007177Freshwater LakeLRFENPGYADSWYKNKMRQIRKQRTVDYFNKKYGLNLDDFDVADAFGIAHYSNTVLTER*
Ga0102978_105873513300007177Freshwater LakeFENPGYADSWYKNKMRQIRKQRTVDYFNNKYNLSLEDFDVADAFGIAHYSNTVLTER*
Ga0102978_108684313300007177Freshwater LakeADSWYKAKMREIRKQRTVDYFNKKYNLSLDDFDVADAFGIAHYSNTVLTER*
Ga0103958_121233913300007212Freshwater LakeMREIRKQRTVDYFNKKYNLDLDDFDVADAFGIAHYSNTVLTER*
Ga0102861_117368013300007544EstuarineKLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER*
Ga0102874_108021113300007546EstuarineNMRKQRTADYFNLKYNLLLNDFDVADSFGIAHYANKELTKR*
Ga0102879_107771613300007549EstuarineNMRKQRTVDYFNSKYSINLDDFDVADSFGIAHYANKELTKR*
Ga0102828_118936213300007559EstuarineVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER*
Ga0102923_106740833300007606EstuarineRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER*
Ga0102901_108489913300007634EstuarineVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER*
Ga0102906_113911113300007637EstuarineMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER*
Ga0102865_108101913300007639EstuarineRNMRKQRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER*
Ga0102912_107141633300007649EstuarineKQRTVDYFNKKYNLSITDFDVADAFGIAHYSNEELTKR*
Ga0114341_1036021513300008108Freshwater, PlanktonTVDYFNKKYKLSLTDFDVADSFGIAHYSNSILTER*
Ga0114341_1040353413300008108Freshwater, PlanktonNMRKQRTVDYFNNKYNLSVTDFDVADAFGIAHYANKVLTER*
Ga0114343_104277113300008110Freshwater, PlanktonSWYKTQLRNMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER*
Ga0114343_105285613300008110Freshwater, PlanktonMRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER*
Ga0114343_107620413300008110Freshwater, PlanktonVDYFNKKYGLSITDFDVADAFGIAHYANKVLTER*
Ga0114343_117690713300008110Freshwater, PlanktonNQLRNMRKQRTVDYFNKKYGINLTDFDVADAFGIAHYANKVLTER*
Ga0114343_122474533300008110Freshwater, PlanktonLRNMRKQRTVDYFNSKYNLALSDFDVADSFGIAHYSNSILTER*
Ga0114344_1009208103300008111Freshwater, PlanktonMRKQRTVDYFNKKYGLSLKDFDVADAFGIAHYANKVLTER*
Ga0114344_102239463300008111Freshwater, PlanktonQRTVDYFNKKYDLSLNDFDVADSFGIAHYANKVLTER*
Ga0114346_110597743300008113Freshwater, PlanktonRTADYFNKKYNLNISDFDVADSFGIAHYANKVLTER*
Ga0114346_116371313300008113Freshwater, PlanktonRVKNPGYADSWYKTQLRNMRKQRTVDYFNNKYNLSITDFDVADAFGIAHYTNKVLTER*
Ga0114351_115605113300008117Freshwater, PlanktonYADSWYKNKMRQIRKQRTVDYFNKKYNLELDDFDVADAFGIAHYSNTVLTER*
Ga0114351_132115013300008117Freshwater, PlanktonYAESWYKSQLRNMRKQRTVDYFNNKYGLSLNDFDVADSFGIAHYANKVLTER*
Ga0114354_116854033300008119Freshwater, PlanktonYADSWYKTQLRNMRKQRTVDYFNKKYDLSLKDFDVADSFGIAHYANKVLTER*
Ga0114355_108671513300008120Freshwater, PlanktonRKQRTVDYFNSKYNLELDDFDVADAFGIAHYSNKVLTER*
Ga0114355_117110313300008120Freshwater, PlanktonNMRKQRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER*
Ga0114355_122582913300008120Freshwater, PlanktonNPGYADSWYKTQLRNMRKQRTVDYFNSKYNLTITDFDVADAFGIAHYANKVLTER*
Ga0114336_109337343300008261Freshwater, PlanktonADSWYQNQLRNMRKQRTVDYFNSKYNLALSDFDVADSFGIAHYSNSILTER*
Ga0114336_117457213300008261Freshwater, PlanktonRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER*
Ga0114353_105249413300008264Freshwater, PlanktonRTVDYFNKKYGLSLKDFDVADAFGIAHYANKVLTER*
Ga0104241_101409723300008953FreshwaterQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER*
Ga0104242_108740413300008962FreshwaterVDYFNNKYKLFLTDFDVADAFGIAHYSNEVLTKR*
Ga0102829_126946313300009026EstuarineQNQLRNMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER*
Ga0114968_1060998113300009155Freshwater LakeRNMRKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER*
Ga0114978_1058438923300009159Freshwater LakeNMRKQRTVDYFNNKYKLEINDFDVADSFGIAYYANNVLTKR*
Ga0114966_1015587953300009161Freshwater LakeWYKNQLRNMRKQRTADYFNKKYGLEIADFDVADSFGIAHYSNQVLTKR*
Ga0114966_1026578713300009161Freshwater LakeTVDYFNKKYNLSLSDFDVADSFGIAHYSNSILTER*
Ga0114966_1048160523300009161Freshwater LakeKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER*
Ga0114975_1033109313300009164Freshwater LakeMRKQRTVDYFNNKYGLSLDDFDVADAFGIAHYSNEELTKR*
Ga0114969_1035492623300009181Freshwater LakeWYQNQLRNMRKQRTVNYFNNKYNLSLTDFDVADSFGIAHYSNSILTER*
Ga0114974_1006810613300009183Freshwater LakeLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER*
Ga0114974_1011283513300009183Freshwater LakeQRTVDYFNDKYNLSLDDFDVADSFGIAHYANKVLTER*
Ga0114974_1073766913300009183Freshwater LakeRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER*
Ga0114976_1041569013300009184Freshwater LakeKNQLRNMRKQRTVDYFNKMYGLDLNDFDVADAFGIAHYSNEVLTKR*
Ga0114982_115550913300009419Deep SubsurfaceVDYFNKKYSLNISDFDVADSFGIAHYANKVLTER*
Ga0102883_113854913300010312EstuarineNMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER*
Ga0129333_10017197183300010354Freshwater To Marine Saline GradientPGYADSWYKNKMREIRKQRTVDYFNKKYNLSLEDFDVADSFGIAYYANEVLTKR*
Ga0129333_1010151913300010354Freshwater To Marine Saline GradientQLRNMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER*
Ga0129333_1047004543300010354Freshwater To Marine Saline GradientKAKMREIRKQRTVDYFNKKYNLRLDDFDVADAFGIAHYSNMVLTER*
Ga0129333_1047004743300010354Freshwater To Marine Saline GradientKAKMREIRKQRTVDYFNKKYNLRLDDFDVADAFGIAHYSNTVLTER*
Ga0129333_1058873523300010354Freshwater To Marine Saline GradientKQRTVDYFNKKYGLSITDFDVADAFGIAHYANKVLTER*
Ga0129333_1067112713300010354Freshwater To Marine Saline GradientKQRTVDYFNKKYNLELDDFDVADAFGIAHYSNTVLTER*
Ga0129333_1095206313300010354Freshwater To Marine Saline GradientLRFENPGHADSWYKAKMREIRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER*
Ga0129336_1028312513300010370Freshwater To Marine Saline GradientDSWYKNKMREIRKQRTVDYFNKKYNLSLEDFDVADSFGIAYYANEVLTKR*
Ga0129336_1063382833300010370Freshwater To Marine Saline GradientRFENPGHADSWYKAKMREIRKQRTVDYFNNKYNLQLDDFDVADAFGIAHYSNTVLTER*
Ga0136551_105389713300010388Pond Fresh WaterRNMRKQRTADYFNRKYDLNVVDFDVADSFGIAHYANKVLTER*
Ga0133913_1345764613300010885Freshwater LakeMRKQRTADYFNTKYNLNVLDFDVADSFGIAHYANKVLTER*
Ga0151620_116218413300011268FreshwaterTVDYFNERYGLKIDDFDVADSFGIAHYANGVLTER*
Ga0151620_120926033300011268FreshwaterWYKNQLRNMRKQRTADYFNKKYGLEIIDFDVADSFGIAHYSNQVLTKR*
Ga0119951_101305073300012000FreshwaterADSWYQNKLRNMRKQRTADYFNTKYNLNVLDFDVADSFGIAHYANKVLTER*
Ga0157208_1000217713300012667FreshwaterGYAESWYKNQLRNMRKQRTCDYFNSKYGLNVSDFDVADSFGIAHYGNQVLTQR*
Ga0129338_158315683300012970AqueousLRFENPGYAESWYKAKMREIRKQRTVDYFNKKYNLELNDFDVADSFGIAYYANEVLTKR*
Ga0164293_1005650113300013004FreshwaterRKQRTVDYFNSKYRLSLEDFDVADSFGIAHYANKVLTER*
Ga0164293_1009795313300013004FreshwaterADSWYKNQLRNMRKQRTADYFNRKYDLNVVDFDVADSFGIAHYANQMLTER*
Ga0164292_1047186013300013005FreshwaterKQRTVDYFNSKYGLKIEDFDVADSMGIAYYANEVLTKR*
(restricted) Ga0172367_1011136113300013126FreshwaterNIRKQRTVDYFNDKYKLKLVDFDVADSFGIAYYAMNNLTLCGR*
(restricted) Ga0172367_1034451713300013126FreshwaterNIRKQRTVDYFNDKYKLKLVDFDVADSFGIAYYAMNNLTL*
(restricted) Ga0172372_1015089713300013132FreshwaterWYKTKMREIRKQRTVDYFNNKYDLKLDDFDVADAFGIAHYSNTVLTER*
(restricted) Ga0172372_1017952313300013132FreshwaterSWYKNKMREIRKQRTVDHFNNKYDLDLDDFDVADAFGIAHYSNSVLTER*
Ga0119952_103732613300014050FreshwaterMRKQRTADYFNRKYDLNVVDFDVADSFGIAHYANKVLTER*
Ga0181356_107726513300017761Freshwater LakeYKNQLRNMRKQRTADYFNKKYGLEIVDFDVADSFGIAHYSNQVLTKR
Ga0169931_1004092413300017788FreshwaterKDTLRFENPGHADSWYKTKMREIRKQRTVDYFNNKYDLKLDDFDVADAFGIAHYSNRVLTER
Ga0181359_116015023300019784Freshwater LakeLRNMRKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER
Ga0194113_1029042613300020074Freshwater LakeYADSWYKNKMRQIRKQRTVDYFNNKYKLSLDDFDVADAFGIANYANKVLTER
Ga0211729_1129077633300020172FreshwaterSWYKTQLRNMRKQRTVDYFNNKYGLALNDFDVADAFGIAHYSNTVLTER
Ga0211729_1129305113300020172FreshwaterDSWYQNKLRNMRKQRTADYFNGKYNLNVVDFDVADSFGIAHYANKVLTER
Ga0194115_1047508813300020183Freshwater LakeMRQIRKQRTVDYFNNKYKLSLDDFDVADAFGIANYANKVLTER
Ga0194121_1012526453300020200Freshwater LakeLKLENPGYAESWYKNKMRNIRKQRTVDYFNYKYKLQLNDFDVADSFGIAYYANEVLTKR
Ga0211731_1086431233300020205FreshwaterWYKTQLRNMRKQRTVDYFNSKYNLTITDFDVADSFGIAHYANKVLTER
Ga0211731_11151637183300020205FreshwaterWYKNQLRNMRKQRTADYFNKKYGLDVVDFDVADSFGIAHYANKVLTER
Ga0208200_10967913300020487FreshwaterMRKQRTVEYFNNKYNLTLSDFDVADAFGIAHYSNRILTER
Ga0208050_100041813300020498FreshwaterRKQRTADYFNKKHGLAIEDFDVADAFGIAYYAREVLTNK
Ga0208233_101407543300020529FreshwaterKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER
Ga0208235_102894833300020530FreshwaterNMRKQRTVDYFNKKYKLSLTDFDVADAFGIAHYSNQVLTKR
Ga0208089_101431013300020543FreshwaterADSWYKTQLRNMRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER
Ga0208362_106393733300020558FreshwaterGYADSWYKTQLRNMRKQRTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER
Ga0208598_101121413300020568FreshwaterRTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER
Ga0208723_105440523300020571FreshwaterKNPGYADSWYKTQLRNMRKQRTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER
Ga0214168_103204013300021140FreshwaterIRVKNPGYADSWYKTQLRNMRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER
Ga0214163_104160213300021141FreshwaterQLRNMRKQRTADYFNKKYGLEIIDFDVADSFGIAHYSNQVLTKR
Ga0194117_1013566943300021424Freshwater LakeFWYKNKMRQIRKQRTVDYFNNKYKLSLNDFDVADAFGIANYANKVLTER
Ga0222713_1012964013300021962Estuarine WaterAAIRVKNPGYADSWYKTQLRNMRKQRTVDYFNKKYQLSITDFDVADAFGIAHYANKVLTE
Ga0222713_1054577913300021962Estuarine WaterWYKNQLRNMRKQRTVDYFNKKYNLSITDFDVADSFGIAHYSNQVLTKR
Ga0222713_1068252413300021962Estuarine WaterMRKQRTVDYFNKKYDLSLKDFDVADSFGIVHYANKVLTER
Ga0181354_116497723300022190Freshwater LakeNMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER
Ga0214917_1001539013300022752FreshwaterNKIREARKQRTADYFNKKYNLKIEDFDVADSFGIAYYANEVLTKR
Ga0255147_100342113300024289FreshwaterKLRFENPGHTDSWYKAKMREIRKQRTVDYFNNKYSLKLDDFDVADAFGIAHYSNTVLTER
Ga0255147_102094943300024289FreshwaterQRTVDYFNKKYNLNLEDFDVADSFGIAYYANEVLTKR
Ga0255148_102545233300024306FreshwaterENPGYADSWYKNKMREIRKKRTVDYFNKKYNLSLEDFDVADSFGIAYYANEVLTKR
Ga0255141_100005313300024351FreshwaterFENPGHADSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER
Ga0255142_104013213300024352FreshwaterSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER
Ga0255165_101677913300024357FreshwaterLRFENPGHADSWYKAKMREIRKQRTVDYFNNKYNLSLDDFDVADAFGIAHYSNTVLTER
Ga0255151_101166033300024496FreshwaterADSWYKNKMRQIRKQRTVDYFNKKYGLELEDFDVADAFGIAHYSNTVLTER
Ga0255143_103768513300024500FreshwaterLRFENPGHADSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER
Ga0255150_103985013300024505FreshwaterDSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER
Ga0256340_100295113300024865FreshwaterNMRKQRTADYFNKKYNLNLEDFDVADSFGIAYYANEVLTKR
Ga0256340_107347713300024865FreshwaterSWYKAKMREIRKQRTVDYFNNKYSLKLDDFDVADAFGIAHYSNTVLTER
Ga0255272_109805013300024866FreshwaterRKQRTVDYFNNKYNLSLDDFDVADAFGIAHYSNTVLTER
Ga0208005_128113213300025848AqueousENPGYADSWYKNKMRQIRKQRTVDYFNKKYNLELDDFDVADAFGIAHYSNTVLTER
Ga0255099_105815433300027128FreshwaterNMRKQRTANYFNDKYNIVVNDFDVADSFGIAHYANKVLTER
Ga0255066_103883413300027131FreshwaterQRTVDYFNKKYDLSLKDFDVADSFGIVHYANKVLTER
Ga0255070_104507413300027133FreshwaterWYQNKLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER
Ga0208166_102581313300027215EstuarineSWYKNQLRNMRKQRTADYFNKKYGLQIVDFDVADSFGIAHYSNQVLTKR
Ga0208165_101299833300027218EstuarineRTVDYFNKKYNLSITDFDVADAFGIAHYSNEELTKR
Ga0208440_103261743300027281EstuarineESWYKNQLRNMRKQRTADYFNKKYGLQIVDFDVADSFGIAHYANKVLTER
Ga0208923_102598513300027320EstuarineMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER
Ga0255154_106437243300027467FreshwaterENPGHADSWYKAKMREIRKQRTVDYFNKKYSLSLDDFDVADAFGIAHYSNTVLTER
Ga0255182_105018543300027503FreshwaterLRFENPGHTDSWYKAKMREIRKQRTVDYFNNKYGLKLDDFDVADAFGIAHYSNTVLTER
Ga0208682_105206243300027531EstuarineQNKLRNMRKQRTADYFNRKYDLNVVDFDVADSFGIAHYANKVLTER
Ga0255158_101561743300027541FreshwaterTVDYFNKKYNLSLDDFDVADAFGIAHYSNTVLTER
Ga0209864_101557813300027547SandDSWYKTQLRNMRKQRTVDYFNNKYKISLDDFDVADSFGIAHYANKVLTER
Ga0255117_103877713300027600FreshwaterQRTVEYFNKKYSINLNDFDVADSFGIAHYANKVLTER
Ga0208974_102676933300027608Freshwater LenticQLRNMRKQRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER
Ga0208133_105498313300027631EstuarineYADSWYKNQLRNMRKQRTADYFNTKYNLNVVDFDVADSFGIAHYANKVLTER
Ga0209357_110591223300027656Freshwater LakeRNMRKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER
Ga0208975_101139463300027659Freshwater LenticQRTVDYFNNKYNLSITDFDVADAFGIAHYANKVLTER
Ga0209769_123821213300027679Freshwater LakeYKTQLRNMRKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER
Ga0209551_1003383133300027689Freshwater LakeWYKNQLRNMRKQRTADYFNKKYGLTVEDFDVADAFGIAYYAREVLTNK
Ga0209617_1036604223300027720Freshwater And SedimentDSWYQNQLRNMRKQRTVDYFNKKYNLSLTDFDVADSFGIAHYSNSILTER
Ga0209596_120080123300027754Freshwater LakeWYQNQLRNMRKQRTVNYFNNKYNLSLTDFDVADSFGIAHYSNSILTER
Ga0209444_1023826133300027756Freshwater LakeRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR
Ga0209296_112101633300027759Freshwater LakeLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER
Ga0209088_1034914723300027763Freshwater LakeKLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER
Ga0209768_1000793113300027772Freshwater LakeWYKNQLRNMRKQRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR
Ga0209107_1001570493300027797Freshwater And SedimentKQRTVDYFNSKYGIKLDDFDVADSFGIAHYANKVLTER
Ga0209107_1047629323300027797Freshwater And SedimentDSWYKNQLRNMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANEVLTDRT
Ga0209354_1021381613300027808Freshwater LakeKNQLRNMRKQRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR
Ga0209990_1005558713300027816Freshwater LakeKQRTVDYFNSKYNLTITDFDVADAFGIAHYANKVLTER
Ga0209400_101570513300027963Freshwater LakeNQLRNMRKQRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR
Ga0209299_107005613300027974Freshwater LakeSWYKNQLRNMRKQRTVDYFNSKYNLSLTDFDVADSFGIAHYSNQVLTKR
Ga0255234_107665413300028113FreshwaterLANPGYADSWYKNQLRNMRKQRTANYFNDKYNIVVNDFDVADSFGIAHYANKVLTER
(restricted) Ga0247835_104925043300028114FreshwaterMRKQRTVDYFNKKYNLSITDFDVADAFGIAHYANKVLTER
Ga0315907_1053897833300031758FreshwaterQLRNMRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER
Ga0315907_1101173713300031758FreshwaterYKNKMRQIRKQRTVDYFNKKYGLELDDFDVADAFGIAHYSNTVLTER
Ga0315908_1068800233300031786FreshwaterTQLRNMRKQRTVDYFNKKYGLSLKDFDVADAFGIAHYANKVLTER
Ga0315900_1006273783300031787FreshwaterNPGHADSWYKAKMREIRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER
Ga0315900_1015829143300031787FreshwaterIRVKNPGYADSWYKTQLRNMRKQRTVDYFNNKYDLSITDFDVADAFGIAHYANKVLTER
Ga0315909_1012783863300031857FreshwaterNMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER
Ga0315909_1016284813300031857FreshwaterQLRNMRKQRTVDYFNNKYNLSLTDYDVADSFGIAHYANKVLTER
Ga0315909_1027293243300031857FreshwaterIRKQRTVDYFNSKYNLELDDFDVADAFGIAHYSNKVLTER
Ga0315904_1033402213300031951FreshwaterMREIRKQRTVDYFNSKYNLELDDFDVADAFGIAHYSNKVLTER
Ga0315904_1043259043300031951FreshwaterKTQLRNMRKQRTADYFNKKYNLNISDFDVADSFGIAHYANKVLTER
Ga0315904_1045457913300031951FreshwaterMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER
Ga0315904_1049591043300031951FreshwaterKAKMREIRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER
Ga0315904_1148088723300031951FreshwaterHTDSWYKAKMREIRKQRTVDYFNNKYGLQLDDFDVADAFGIAHYSNTVLTER
Ga0315901_1073326413300031963FreshwaterMRKQRTADYFNRKYNLNVVDFDVADSFGIAHYANKVLTER
Ga0315901_1115964833300031963FreshwaterQLRNMRKQRTVDYFNKKYGLSITDFDVADAFGIAHYANKVLTER
Ga0315906_1006944873300032050FreshwaterKQRTVDYFNTKYGLSLDDFDVADAFGIAHYSNTVLTER
Ga0315906_1019008943300032050FreshwaterMRKQRTVDYFNNKYSLSVTDFDVADAFGIAHYANKVLTER
Ga0315906_1032867413300032050FreshwaterLRFENPGHADSWYKAKMREIRKQRTVDYFNKKYNLQLDDFDVADAFGIAHYSNTVLTER
Ga0315906_1052633333300032050FreshwaterRTVDYFNKKYGLSVSDFDVADAFGIAHYANKVLTER
Ga0315906_1104700813300032050FreshwaterQLRNMRKQRTVDYFNKKYNLSLTDFDVADAFGIAHYANKVLTER
Ga0315906_1128139333300032050FreshwaterRKQRTVDYFNNKYNLLLTDYDVADSFGIAHYANKVLTER
Ga0315903_1015446513300032116FreshwaterKLRNMRKQRTVDYFNSKYNLSITDFDVADAFGIAHYANKVLTER
Ga0315903_1037044233300032116FreshwaterKQRTVDYFNSKYNLELDDFDVADAFGIAHYSNKVLTER
Ga0334979_0649212_3_1523300033996FreshwaterSWYKTQLRNMRKQRTVEYFNNKYNLTLSDFDVADAFGIAHYSNRILTER
Ga0335021_0175236_1031_11533300034023FreshwaterMRKQRTADYFNNKYGLDIIDYDVADSFGIAYYANEVLTKR
Ga0334995_0761833_408_5303300034062FreshwaterMRKQRTADYFNKKYGLSVIDFDVADSFGIAYYANEVLTKR
Ga0310130_0006204_3_1733300034073Fracking WaterENPGHADSWYKAKMREIRKQRTVDYFNKKYNLELDDFDVADAFGIAHYSNTVLTER
Ga0335029_0084526_105_2273300034102FreshwaterMRKQRTVDYFNKKYSINLNDFDVADSFGIAHYANKVLTER
Ga0335053_0473833_634_7443300034118FreshwaterRTADYFNKKYGLEIIDFDVADSFGIAHYSNQVLTKR
Ga0335053_0599679_480_6023300034118FreshwaterMRKQRTVDYINDKYNLNLDDFDVADSFGIAHYANKVLTER
Ga0335058_0051067_2262_23843300034121FreshwaterMRKQRTADYFNKKHGLKIEDFDVADAFGIAYYAREVLTNK
Ga0335013_0197447_2_1243300034284FreshwaterMRKQRTVDYFNSKYRLSLEDFDVADSFGIAHYANKVLTER
Ga0335048_0163257_1116_12623300034356FreshwaterWYKNQIRNMRKQRTVDYFNTKYGLSLTDFDVADSFGIAHYANKVLTER
Ga0335048_0378404_1_1263300034356FreshwaterNMRKQRTVDYFNSKYRLSLEDFDVADSFGIAHYANKVLTER
Ga0335064_0009445_53_1753300034357FreshwaterMRKQRTVDYFNSKYSLSLEDFDVADSFGIAHYANKVLTER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.