NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F023946

Metagenome Family F023946

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023946
Family Type Metagenome
Number of Sequences 208
Average Sequence Length 51 residues
Representative Sequence LPTGNEGDTAGATLSMLTTSLAPELSSVEDVGVRGEAPVILDSFRFGKKK
Number of Associated Samples 156
Number of Associated Scaffolds 208

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.97 %
% of genes near scaffold ends (potentially truncated) 97.12 %
% of genes from short scaffolds (< 2000 bps) 92.79 %
Associated GOLD sequencing projects 136
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.038 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(8.173 % of family members)
Environment Ontology (ENVO) Unclassified
(48.077 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(68.269 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.67%    β-sheet: 26.92%    Coil/Unstructured: 56.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 208 Family Scaffolds
PF00578AhpC-TSA 61.54
PF08534Redoxin 23.56
PF12697Abhydrolase_6 0.48
PF04366Ysc84 0.48
PF00498FHA 0.48
PF08281Sigma70_r4_2 0.48
PF03741TerC 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 208 Family Scaffolds
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.48
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17396701All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2207Open in IMG/M
2162886013|SwBSRL2_contig_5877139All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1587Open in IMG/M
2199352025|deepsgr__Contig_120675All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia691Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13523428All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia565Open in IMG/M
3300000546|LJNas_1003432All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1818Open in IMG/M
3300000550|F24TB_12725014All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia771Open in IMG/M
3300000559|F14TC_109819395All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia519Open in IMG/M
3300000953|JGI11615J12901_10223178All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1256Open in IMG/M
3300000956|JGI10216J12902_100435925All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia896Open in IMG/M
3300000956|JGI10216J12902_112384073All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia609Open in IMG/M
3300001990|JGI24737J22298_10214706All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia568Open in IMG/M
3300002899|JGIcombinedJ43975_10076826All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia589Open in IMG/M
3300004114|Ga0062593_100260638All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1441Open in IMG/M
3300004114|Ga0062593_101269729All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia778Open in IMG/M
3300004157|Ga0062590_102682620All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia531Open in IMG/M
3300004479|Ga0062595_101294641All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia655Open in IMG/M
3300004480|Ga0062592_102117381All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia558Open in IMG/M
3300004643|Ga0062591_102465237All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia546Open in IMG/M
3300004808|Ga0062381_10403124All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia525Open in IMG/M
3300005093|Ga0062594_100199414All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1393Open in IMG/M
3300005294|Ga0065705_10010483All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2656Open in IMG/M
3300005331|Ga0070670_101645450All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia590Open in IMG/M
3300005332|Ga0066388_104877715All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia682Open in IMG/M
3300005332|Ga0066388_106586314All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia585Open in IMG/M
3300005335|Ga0070666_11469795All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia510Open in IMG/M
3300005336|Ga0070680_100126811All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2133Open in IMG/M
3300005336|Ga0070680_101801846All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia530Open in IMG/M
3300005340|Ga0070689_101863426All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia549Open in IMG/M
3300005340|Ga0070689_102183697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300005343|Ga0070687_100023169All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2948Open in IMG/M
3300005343|Ga0070687_100026379All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2797Open in IMG/M
3300005347|Ga0070668_100753778All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia862Open in IMG/M
3300005364|Ga0070673_100445086All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1165Open in IMG/M
3300005459|Ga0068867_100405940All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1150Open in IMG/M
3300005467|Ga0070706_100513682All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1114Open in IMG/M
3300005518|Ga0070699_100320909All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300005518|Ga0070699_101522074All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia613Open in IMG/M
3300005536|Ga0070697_100965068All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia757Open in IMG/M
3300005536|Ga0070697_101326518All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia642Open in IMG/M
3300005536|Ga0070697_102109153All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia505Open in IMG/M
3300005539|Ga0068853_100181746All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1907Open in IMG/M
3300005539|Ga0068853_102385665All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia512Open in IMG/M
3300005544|Ga0070686_100472556All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia968Open in IMG/M
3300005544|Ga0070686_101582139All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia554Open in IMG/M
3300005545|Ga0070695_101038485All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia668Open in IMG/M
3300005545|Ga0070695_101536413All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300005546|Ga0070696_100789670All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia781Open in IMG/M
3300005547|Ga0070693_100381985All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia972Open in IMG/M
3300005547|Ga0070693_101274845All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia567Open in IMG/M
3300005549|Ga0070704_100246797All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1464Open in IMG/M
3300005549|Ga0070704_100416726All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1149Open in IMG/M
3300005563|Ga0068855_100536550All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1268Open in IMG/M
3300005564|Ga0070664_101473826All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia644Open in IMG/M
3300005564|Ga0070664_102043603All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia544Open in IMG/M
3300005577|Ga0068857_101315462All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia702Open in IMG/M
3300005578|Ga0068854_100392210All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1147Open in IMG/M
3300005617|Ga0068859_100128925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2600Open in IMG/M
3300005617|Ga0068859_102460118All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia573Open in IMG/M
3300005618|Ga0068864_101408014All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia699Open in IMG/M
3300005840|Ga0068870_11089862All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia574Open in IMG/M
3300005840|Ga0068870_11124544All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia566Open in IMG/M
3300005841|Ga0068863_102409100All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia536Open in IMG/M
3300005842|Ga0068858_100401213All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1317Open in IMG/M
3300005842|Ga0068858_102054985All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia565Open in IMG/M
3300005844|Ga0068862_101013279All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia822Open in IMG/M
3300005895|Ga0075277_1083809All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia528Open in IMG/M
3300006046|Ga0066652_100509685All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1119Open in IMG/M
3300006169|Ga0082029_1617050All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300006169|Ga0082029_1636304All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300006173|Ga0070716_100787490All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia735Open in IMG/M
3300006804|Ga0079221_10095401All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1449Open in IMG/M
3300006853|Ga0075420_100365501All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300006881|Ga0068865_101870433All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300006894|Ga0079215_10018049All Organisms → cellular organisms → Bacteria2316Open in IMG/M
3300006918|Ga0079216_10422458All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia847Open in IMG/M
3300006954|Ga0079219_12007110All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia550Open in IMG/M
3300006969|Ga0075419_10321379All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1047Open in IMG/M
3300009036|Ga0105244_10180412All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1001Open in IMG/M
3300009093|Ga0105240_12294742All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia559Open in IMG/M
3300009094|Ga0111539_12087662All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia657Open in IMG/M
3300009094|Ga0111539_12751651All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia570Open in IMG/M
3300009098|Ga0105245_11190942All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia810Open in IMG/M
3300009098|Ga0105245_11843702All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300009101|Ga0105247_11151433All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia615Open in IMG/M
3300009101|Ga0105247_11183847All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia607Open in IMG/M
3300009147|Ga0114129_11137617All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia975Open in IMG/M
3300009148|Ga0105243_11933272All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia623Open in IMG/M
3300009156|Ga0111538_13797158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300009162|Ga0075423_11593428All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia702Open in IMG/M
3300009174|Ga0105241_10911757All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia817Open in IMG/M
3300009174|Ga0105241_11082899All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia754Open in IMG/M
3300009174|Ga0105241_11238715All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia708Open in IMG/M
3300009176|Ga0105242_12068972All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia613Open in IMG/M
3300009176|Ga0105242_12279115All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia588Open in IMG/M
3300009176|Ga0105242_12851523All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia534Open in IMG/M
3300009177|Ga0105248_10556050All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1295Open in IMG/M
3300009551|Ga0105238_11771600All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia649Open in IMG/M
3300009789|Ga0126307_10158002All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1816Open in IMG/M
3300010037|Ga0126304_10346253All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia988Open in IMG/M
3300010043|Ga0126380_11838868All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia549Open in IMG/M
3300010159|Ga0099796_10547068All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia520Open in IMG/M
3300010373|Ga0134128_10247184All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2002Open in IMG/M
3300010373|Ga0134128_12122894All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia619Open in IMG/M
3300010399|Ga0134127_10587416All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1140Open in IMG/M
3300010399|Ga0134127_10710080All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1046Open in IMG/M
3300010400|Ga0134122_12084782All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia608Open in IMG/M
3300010403|Ga0134123_12472819All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia585Open in IMG/M
3300010403|Ga0134123_13651725All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia500Open in IMG/M
3300011119|Ga0105246_10217336All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1496Open in IMG/M
3300011119|Ga0105246_10462460All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1069Open in IMG/M
3300011119|Ga0105246_10769646All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia851Open in IMG/M
3300011119|Ga0105246_11096201All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia727Open in IMG/M
3300011119|Ga0105246_11470822All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia638Open in IMG/M
3300012199|Ga0137383_10244869All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1314Open in IMG/M
3300012203|Ga0137399_11407501All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia583Open in IMG/M
3300012209|Ga0137379_10579335All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1029Open in IMG/M
3300012357|Ga0137384_11289385All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia577Open in IMG/M
3300012363|Ga0137390_10379537All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1393Open in IMG/M
3300012469|Ga0150984_123113489All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1011Open in IMG/M
3300012925|Ga0137419_10526517All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia941Open in IMG/M
3300012960|Ga0164301_10900402All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia686Open in IMG/M
3300012961|Ga0164302_11173275All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia612Open in IMG/M
3300012984|Ga0164309_10864168All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia734Open in IMG/M
3300012984|Ga0164309_11073588All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia668Open in IMG/M
3300012986|Ga0164304_10944558All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia678Open in IMG/M
3300013102|Ga0157371_10474716All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia921Open in IMG/M
3300013297|Ga0157378_10564465All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1145Open in IMG/M
3300013297|Ga0157378_11971415All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia634Open in IMG/M
3300013306|Ga0163162_12463538All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia598Open in IMG/M
3300013306|Ga0163162_12653119All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia577Open in IMG/M
3300013308|Ga0157375_13592668All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia516Open in IMG/M
3300014325|Ga0163163_11541828All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia726Open in IMG/M
3300014326|Ga0157380_12654894All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia567Open in IMG/M
3300014968|Ga0157379_11100561All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia761Open in IMG/M
3300015241|Ga0137418_10682593All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300015262|Ga0182007_10326877All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia570Open in IMG/M
3300015372|Ga0132256_100162936All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2250Open in IMG/M
3300015372|Ga0132256_100950597All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia975Open in IMG/M
3300015372|Ga0132256_103507467All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia527Open in IMG/M
3300015373|Ga0132257_101707547All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia807Open in IMG/M
3300015374|Ga0132255_104913939All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia566Open in IMG/M
3300017695|Ga0180121_10001227All Organisms → cellular organisms → Bacteria10866Open in IMG/M
3300017789|Ga0136617_10629754All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium839Open in IMG/M
3300018072|Ga0184635_10159928All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia900Open in IMG/M
3300018082|Ga0184639_10276376All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia885Open in IMG/M
3300018422|Ga0190265_11822187All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia716Open in IMG/M
3300018433|Ga0066667_10381009All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1133Open in IMG/M
3300018466|Ga0190268_10357183All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia914Open in IMG/M
3300018466|Ga0190268_12041096All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia529Open in IMG/M
3300018920|Ga0190273_10154040All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1377Open in IMG/M
3300020003|Ga0193739_1029767All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1418Open in IMG/M
3300021081|Ga0210379_10153300All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia981Open in IMG/M
3300021445|Ga0182009_10350572All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia754Open in IMG/M
3300025313|Ga0209431_10484740All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia943Open in IMG/M
3300025900|Ga0207710_10299603All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia812Open in IMG/M
3300025904|Ga0207647_10521801All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia661Open in IMG/M
3300025906|Ga0207699_10156542All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1513Open in IMG/M
3300025917|Ga0207660_10346881All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1189Open in IMG/M
3300025918|Ga0207662_10697516All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia711Open in IMG/M
3300025919|Ga0207657_11250149All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia563Open in IMG/M
3300025922|Ga0207646_11062435All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia714Open in IMG/M
3300025925|Ga0207650_10804716All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia797Open in IMG/M
3300025925|Ga0207650_11316706All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia615Open in IMG/M
3300025926|Ga0207659_10279422All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1364Open in IMG/M
3300025927|Ga0207687_10280046All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1336Open in IMG/M
3300025927|Ga0207687_11932751All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300025930|Ga0207701_10059197All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia3502Open in IMG/M
3300025930|Ga0207701_11686316All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia507Open in IMG/M
3300025933|Ga0207706_10247776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1557Open in IMG/M
3300025934|Ga0207686_10653829All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300025935|Ga0207709_10237825All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1323Open in IMG/M
3300025936|Ga0207670_10880221All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia749Open in IMG/M
3300025938|Ga0207704_10471609All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1006Open in IMG/M
3300025942|Ga0207689_10594310All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia931Open in IMG/M
3300025960|Ga0207651_10796345All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia838Open in IMG/M
3300025981|Ga0207640_11796397All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia554Open in IMG/M
3300026035|Ga0207703_10412599All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1255Open in IMG/M
3300026035|Ga0207703_10535723All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1103Open in IMG/M
3300026035|Ga0207703_11797816All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia589Open in IMG/M
3300026075|Ga0207708_10017722All Organisms → cellular organisms → Bacteria5360Open in IMG/M
3300026088|Ga0207641_10082881All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia2787Open in IMG/M
3300026088|Ga0207641_10604764All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1074Open in IMG/M
3300026088|Ga0207641_12572653All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia507Open in IMG/M
3300026095|Ga0207676_10823884All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia906Open in IMG/M
3300026116|Ga0207674_10668564All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1003Open in IMG/M
3300026116|Ga0207674_11925041All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia557Open in IMG/M
3300026121|Ga0207683_11531112All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia616Open in IMG/M
3300026142|Ga0207698_11126997All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia798Open in IMG/M
3300027517|Ga0209113_1057630All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia573Open in IMG/M
3300027639|Ga0209387_1112536All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia679Open in IMG/M
3300027691|Ga0209485_1174528All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia656Open in IMG/M
3300027691|Ga0209485_1250866All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia569Open in IMG/M
3300027886|Ga0209486_10660598All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia670Open in IMG/M
3300027907|Ga0207428_10526360All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia857Open in IMG/M
3300028381|Ga0268264_11514942All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia681Open in IMG/M
3300030511|Ga0268241_10009654All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1801Open in IMG/M
3300031740|Ga0307468_100153599All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1483Open in IMG/M
3300031740|Ga0307468_100721774All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia837Open in IMG/M
3300031740|Ga0307468_101112998All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia705Open in IMG/M
3300031740|Ga0307468_101991985All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300031847|Ga0310907_10373333All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia737Open in IMG/M
3300031901|Ga0307406_10196721All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1480Open in IMG/M
3300031913|Ga0310891_10176100All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia707Open in IMG/M
3300032174|Ga0307470_11923298All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia504Open in IMG/M
3300033412|Ga0310810_10408337All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1398Open in IMG/M
3300033475|Ga0310811_10808323All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia873Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere7.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.25%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.29%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.44%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.48%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.48%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.48%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.48%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.48%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000546Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027517Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_022054202088090014SoilVIFLPTNKEGDTTGATLTMLSTSLAPELLSVDDLGVKGEAPVILDSFRFGKKK
SwBSRL2_0612.000051802162886013Switchgrass RhizosphereFLPTGKEGDTTGATLTMLSTSLAPELSSVDDLGVKGEAPVVLESFRFGKKK
deepsgr_019231702199352025SoilVIFLPTNKEGDTTGATLTMLSTSLAPELLSVDDLGVKGEAPVILDSFRFG
ICChiseqgaiiFebDRAFT_1352342813300000363SoilWGRVIFVPTGNEGDTTGATLIMFTTSLAPELSSVEDVGKRGEAPVILDSFRFGKKQ*
LJNas_100343243300000546Quercus RhizosphereKGTEKGDLHLWGRVVFVPAGVAGNKNGAILSMFTTSLAPELSSVEDVGTRGEMPVILESFRFIKKP*
F24TB_1272501423300000550SoilFLPTGNEGDTTGATLTMLTTSLAGELSSVEDVGERGQMPVILDSFRFGKKQ*
F14TC_10981939523300000559SoilLPEKGDVQLWGRVVFLPTGTEGDTSGATLTMFSTSLAGELSSVXDVGEKGEMPIILESFRFGXKK*
JGI11615J12901_1022317843300000953SoilEGDTAGATIVMLSTSLAPELSSVEDIGEKGEAKVILDSFRFGKK*
JGI10216J12902_10043592513300000956SoilGTERGDLKLWGRIIFLPTGTEGNTTGATLSMLCTSLAPELSSVEDVGTRGETPVILDSFRFGKK*
JGI10216J12902_11238407323300000956SoilGATLSMFTTSLAPELSSVEDVGTKGEAPVILESFRFGKK*
JGI24737J22298_1021470613300001990Corn RhizosphereLHLWGRVIFLPTGKEGDTTGAVLSMFTTSLAPELSSVEDVGTHGEAPVILDSFRFGKK*
JGIcombinedJ43975_1007682623300002899SoilGDLQLWGRVIFLPTGKEGDTAGATLSMLTTSLAPELSSVEDVGARGEAPVILDSFRFGKKQ*
Ga0062593_10026063843300004114SoilIFLPTGKEGDTSGAILSMFTTSLAPELSSVEDVGTRGEGPVILDSFRFGKKN*
Ga0062593_10126972923300004114SoilWGRVIFLPTGNEGDTTGATLSMLCTNLAGELSSVEDVGERGESPVILESFRFGKKK*
Ga0062590_10268262023300004157SoilFLPTGTEGDTTGATLYMLTTSLAGELSSVEDVGSRGQMPVILDSFRFGKKK*
Ga0062595_10129464123300004479SoilAGEQTGATLIMLATSLSPEISGVEDVGAKGQMPVILESFRFGRNR*
Ga0062592_10211738113300004480SoilGDLNLWGRVIFLPTGKEGDSTGATLTMLCTNLAGELSSVQDVGERGEAPVILDSFRFGKKK*
Ga0062591_10246523723300004643SoilLKLWGRIIFLPTGHEGDTTGATLSMLCTSLAPELSSWKDVGEHGETPMILDSFKFGKK*
Ga0062381_1040312413300004808Wetland SedimentTTGATIIMLATSLAPELSGVEDVGAKGQMPVILESFRFGEK*
Ga0062594_10019941443300005093SoilTLWGRVIFLPTGKEGDTTGATLSMLCTNLAGELSSVEDVGVRGQAPVILDTFRFGKKK*
Ga0065705_1001048313300005294Switchgrass RhizosphereGDLHLWGRVIFLPTGKEGDATGAVLSMFTTSLAPELSSVEDVGTQGEAPMILESFRFGKK
Ga0070670_10164545013300005331Switchgrass RhizosphereVIFLPTNKEGDTTGATLTMLSTSLAPELTSVDDLGAKGEAPVILDSFRFGKKK*
Ga0066388_10487771513300005332Tropical Forest SoilGDLNLWGRVIFLPTGKEGDTTGATLSMLCTNLAGELSSVEDVGVRGETPVILDSFRFGKKK*
Ga0066388_10658631423300005332Tropical Forest SoilGTEKGDLHLWGRVIFLPTGKEGDTTGAVLSMVTTSLAPELSSVEDVGTQGEAPVILDSFRFGKK*
Ga0070666_1146979523300005335Switchgrass RhizosphereGTDRGDLKLWGRVIFLPTGTEGDTAGATLTMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0070680_10012681113300005336Corn RhizosphereKGTERGDLKLWGRVIFLPTGNEGDTAGATLSMLTTSLAPELSSVEDVGVRGEAPVILDSFRFGKKK*
Ga0070680_10180184623300005336Corn RhizosphereDRGDVHLWGRVIFVPTGKEGDTAGATLSMFTTSLAPELSSVEDVGTKGEAPVILESFRFGKK*
Ga0070689_10186342613300005340Switchgrass RhizosphereKEGDSTGAILSMFTTSLAPELSSVEDVGTQGEAPVILDSFRFGKK*
Ga0070689_10218369713300005340Switchgrass RhizosphereGDLKLWGRIIFLPTGNEGDTTGATLSMLCTSLAPELSSWKDVGEHGETPMILESFKFGKK
Ga0070687_10002316963300005343Switchgrass RhizosphereGNEGDSAGATLLMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ*
Ga0070687_10002637913300005343Switchgrass RhizosphereGATLTMLTTSLAGELSSVEDVGQRGEMPVILDSFRFGKQK*
Ga0070668_10075377813300005347Switchgrass RhizosphereGDSTGATLTMLSTSLAPELTSVDDLGVKGEAPVILDSFRFGKKQ*
Ga0070673_10044508613300005364Switchgrass RhizosphereATLSMLCTNLAGELSSVDDVGTRGEAPVILDSFRFGKKK*
Ga0068867_10040594033300005459Miscanthus RhizosphereTEKGDIQLWGRVVFLPTGTEGDTTGATLSMFSTSLAPELSSVDDIGKKGEATVILDSFRFGKKQ*
Ga0070706_10051368213300005467Corn, Switchgrass And Miscanthus RhizosphereIFLPTGKEGDSAGATLTMLSTNLATELTSVDDLGVKGEAPVILESFRFGKKK*
Ga0070699_10032090913300005518Corn, Switchgrass And Miscanthus RhizosphereKGDLKLWGRVIFLPTGREGDTSGAILSMFTTSLAPELSSVEDVGTKGEAPVILDSFRFVKK*
Ga0070699_10152207423300005518Corn, Switchgrass And Miscanthus RhizosphereVIFLPAGNESANGATLVMLATSRAPELSGAEDIGEKGQLPIILESFRFGKSE*
Ga0070697_10096506823300005536Corn, Switchgrass And Miscanthus RhizosphereKGDIQLWGRVVFLPPGVEGQKTGATLIMLSTSLAPELSGVEDVGTKGQMPIILESFRFGKKK*
Ga0070697_10132651813300005536Corn, Switchgrass And Miscanthus RhizosphereGETTGAILTMLTTSLAPEISGVDDVGVKGEAPVILESFRFGKKP*
Ga0070697_10210915323300005536Corn, Switchgrass And Miscanthus RhizosphereDLHLWGRVIFVPTGREGDTSGAILSMFTTSLAPELSSVEDVGTRGEAPVILDSFRFGKK*
Ga0068853_10018174653300005539Corn RhizosphereEGDTTGAVLSMFTTSLAPELSSVEDVGTHGEAPVILDSFRFGKK*
Ga0068853_10238566523300005539Corn RhizosphereGTDRGDLNLWGRVIFLPTGKEGDNTGATLSMLCTYLAPELSSLDDVGLRGEAPVILDSFRFGKKK*
Ga0070686_10047255633300005544Switchgrass RhizosphereDTTGATLTMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0070686_10158213913300005544Switchgrass RhizosphereIFLPTGKEGDTTGATLSMLCTSLAGELSSVEDVGERGETPVILESFRFGKKK*
Ga0070695_10103848513300005545Corn, Switchgrass And Miscanthus RhizosphereREGDTSGAILSMFTTSLAPELSSVEDVGTRGEAPVILESFRFGKK*
Ga0070695_10153641323300005545Corn, Switchgrass And Miscanthus RhizosphereRFVSSSPDSASGNLQLWGRVIFLPAGNESANGATLVMLATSRAPELSGAEDIGEKGQLPIILESFRFGKSE*
Ga0070696_10078967013300005546Corn, Switchgrass And Miscanthus RhizosphereLWGRVIFLPTGREGDTSGAILSMFTTSLAPELSSVEDVGTRGEAPVILDSFRFGKK*
Ga0070693_10038198533300005547Corn, Switchgrass And Miscanthus RhizosphereDLNLWGRVIFLPTGKEGDNTGATLSMLCTNLAPELSSLDDVGLRGEAPVILDSFRFGKKK
Ga0070693_10127484513300005547Corn, Switchgrass And Miscanthus RhizosphereETTGATLSMLTTSLAPELSGVDDVGEKGELPIVLKSFRFGK*
Ga0070704_10024679743300005549Corn, Switchgrass And Miscanthus RhizosphereQLWGRVVFVPTGKAGDTNGAVLTMFTTSLAPELSSIEDVGSRGEMPVILDSFRFGKSP*
Ga0070704_10041672613300005549Corn, Switchgrass And Miscanthus RhizosphereDKAGATLTMFSTSLAPELSGVEDVGQKGEMPVILDSFRLGKKK*
Ga0068855_10053655033300005563Corn RhizosphereDLQLWGRVIFVPTGHEGDTAGATLSMLTTSLAPELSSVEDVGERGEAPVILQSFRFGKKQ
Ga0070664_10147382613300005564Corn RhizosphereTARGDLNLWGRVIFLPTGKEGDNTGATLSMLCTNLAGELSSVDDVGTRGEAPVILDSFRFGKKK*
Ga0070664_10204360323300005564Corn RhizospherePTGKEGDTTGATLTMLTTSLAGELSSVADVGQRGEMPVILDSFRFGKQK*
Ga0068857_10131546223300005577Corn RhizosphereKGTERGDLKLWGRVIFLPTGNEGDTAGATLSMLTTSLAPELSSVEDVGQRGEAPVILDSFRFGKKK*
Ga0068854_10039221033300005578Corn RhizosphereRVIFLPTGTEGDTTGATLTMLTTSLAGELSSVQDVGSQGQMPVILDSFRFSKKK*
Ga0068859_10012892513300005617Switchgrass RhizosphereIFLPTGNEGDTTGATLSMLCTSLAPELSSWKDVGEHGETPMILESFKFGKK*
Ga0068859_10246011823300005617Switchgrass RhizosphereDSGAILSFLCTSLAPELSSVEDVGERGEAPVILESFRFGKKK*
Ga0068864_10140801413300005618Switchgrass RhizosphereKKGDLHLWGRVVFVPKGSGGDGNGAVLTMFTTSLAPELSSVEDVGTRGEMPVILESFRFGGGNP*
Ga0068870_1108986213300005840Miscanthus RhizosphereDTNGAILSMFTTSLAPELSSIEDVGSKGEMPVILDSFRFGK*
Ga0068870_1112454413300005840Miscanthus RhizosphereDNGDVKLWGRVVFLPTGKEGDKEGATIVMLSTSLAPELSSVEDIGQKGEATVILDSFRFGKK*
Ga0068863_10240910013300005841Switchgrass RhizosphereIFLPTGKEGDTTGATLSMLGTNLAGELSSVEDIGTKGETPVILDSFRFGKKK*
Ga0068858_10040121313300005842Switchgrass RhizosphereLTMLTTSLAPELSSVEDVGERGEAPVILQSFRFGKKQ*
Ga0068858_10205498523300005842Switchgrass RhizosphereGTEGETAGATLTMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKQ*
Ga0068862_10101327933300005844Switchgrass RhizosphereLSIFTTSLAPELSSVEDVGTQGEAPVILDSFRFGKK*
Ga0075277_108380923300005895Rice Paddy SoilGDTTGATLTMLTTSLAGELSSVEDVGERGEMPVILDSFRFGKQK*
Ga0066652_10050968533300006046SoilSGATLAMLSTSLAPELSSVDDLGSKGEAPVILDSFRFGKKK*
Ga0082029_161705013300006169Termite NestLPTGNEGDTAGATLSMLTTSLAPELSSVEDVGVRGEAPVILDSFRFGKKK*
Ga0082029_163630413300006169Termite NestVIFLPTGNEGDTAGATLSMLTTSLAPDLSSVEDVGERGEAPVILESFRFGKKK*
Ga0070716_10078749013300006173Corn, Switchgrass And Miscanthus RhizosphereILSMFTTSLAPELSSVEDVGDKGQSPVILDSFRFGKKK*
Ga0079221_1009540113300006804Agricultural SoilVIFLPTGKEGDTTGATLSMLGTNLAGELSSVADIGARGETPVILDSFRFGKKK*
Ga0075420_10036550143300006853Populus RhizosphereGDTTGATLSMLTTSLAPELSSVEDVGERGEAPVILESFRFGKKK*
Ga0068865_10187043313300006881Miscanthus RhizospherePSGVAGSETGATLSMLATSLAPELSGINDVGSKGEIPVILDSFRFGKGN*
Ga0079215_1001804913300006894Agricultural SoilVQLWGRVVFLPTGKEGDTAGATLSMLSTSLAPELSSVEDIGQKGEATVILDSFRFGKK*
Ga0079216_1042245823300006918Agricultural SoilFLPTGNEGDTTGATLTMFSTSLASELSSVDDVGEKGETPVILESFRFKQK*
Ga0079219_1200711023300006954Agricultural SoilGRVIFLPTGHEGDTNGAILSMFTTSLAPELSSVEDVGTRGEAPVILESFRFGKK*
Ga0075419_1032137913300006969Populus RhizosphereGATLIMLTTSLAGELSSVEDVGERGEMPVILQSFRFGKKQ*
Ga0105244_1018041233300009036Miscanthus RhizosphereEGDTSGATLYMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0105240_1229474213300009093Corn RhizosphereVSPGTARGDLNLWGRVIFLPTGKEGDTTGATLSMLCTNLAGELSSVEDVGVRGQAPVILDTFRFGKKK*
Ga0111539_1208766223300009094Populus RhizosphereGTEKGDIQLWGRVVFLPTGNEGDSAGATLLMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ*
Ga0111539_1275165123300009094Populus RhizosphereLSMFTTNLAPELSSVEDVGERGEAKVILDSFRFGKKN*
Ga0105245_1119094223300009098Miscanthus RhizosphereAILSFLCTSLAPELSSVEDVGERGEAPVILESFRFGKKK*
Ga0105245_1184370223300009098Miscanthus RhizosphereSAGATLTMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKQ*
Ga0105247_1115143313300009101Switchgrass RhizosphereLTLLCTSLAGELSSVEDVGERGEAPVILESFRFGKKK*
Ga0105247_1118384713300009101Switchgrass RhizosphereLKLWGRVIFLPTGKEGDTTGATLTMLTTSLAGELSSVEDVGQRGEMPVILDSFRFGKAK*
Ga0114129_1113761733300009147Populus RhizosphereGDTAGATIVMLSTSLAPELSSVEDIGEKGQATVILDSFRFGKK*
Ga0105243_1193327213300009148Miscanthus RhizosphereSGEVKLWGRVVFLPTGKEGDKEGATIVMLSTSLAPELTSVEDIGHKGEATVILDSFRFGKK*
Ga0111538_1379715813300009156Populus RhizosphereIQLWGRVVFLPTGNEGDTTGVTLIMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ*
Ga0075423_1159342813300009162Populus RhizosphereGATLTMLSTSLAPELSSVDDLGVKGEAPVILESFRFGKKK*
Ga0105241_1091175713300009174Corn RhizosphereVVFLPTGTEGDTTGATLSMFSTSLAPELSSVDDIGKKGEATVILDSFRFGKKQ*
Ga0105241_1108289923300009174Corn RhizosphereLKLWGRVIFLPTGTEGDTAGATLTMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0105241_1123871523300009174Corn RhizosphereAGATLTMLTTSLAPELSSVEDVGERGEAPVILQSFRFGKKQ*
Ga0105242_1206897213300009176Miscanthus RhizosphereGKAGDANGAVLTMFTTSLAPELSSVEDVGSRGEMPVILDSFRFGQAH*
Ga0105242_1227911513300009176Miscanthus RhizospherePTGNEGDTSGATLLMFATSLAGELSSVEDVGVRGEMPVILDSFRFSKKQ*
Ga0105242_1285152323300009176Miscanthus RhizosphereGKAGDANGAVLTMFTTSLAPELSSVEDVGSRGEMPVILDSFRFGKSP*
Ga0105248_1055605013300009177Switchgrass RhizosphereGDTSGATLYMLTTSLAGELSSVEAVGSQGQMPVILDSFRFGKKK*
Ga0105238_1177160023300009551Corn RhizosphereDGDTTGATLTMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0126307_1015800253300009789Serpentine SoilRVIFLPTGKEGDTTGATLSMLCTSLAGELSSVEDVGERGETPVILESFRFGKKK*
Ga0126304_1034625333300010037Serpentine SoilTERGDLWLWGRVIFLPTGNEGDTTGATLTMLCTSLAPELSGVADVGEKGQAPVILDSFRFGKKK*
Ga0126380_1183886823300010043Tropical Forest SoilVIFIPRGHGEKTGAVITLLATSLASDQSGVEDIGEKGEATVILESFRFGK*
Ga0099796_1054706823300010159Vadose Zone SoilGATLTMFATSLAPELSGVEDVGGKGEMPVILESFRVGKKSN*
Ga0134128_1024718463300010373Terrestrial SoilSMFTTSLAPELSSVEDVGSHGEAPVILDSFRFGKK*
Ga0134128_1212289413300010373Terrestrial SoilLSKGTERGDLQLWGRVVFVPTGKAGDTNGAVLTMFTTSLAPELSSVADVGTVGEMPVLLDSFRFGKSQ*
Ga0134127_1058741633300010399Terrestrial SoilTGKEGDSTGAILSMFTTSLAPELSSVEDVGQHGEAPVILDSFRFGKK*
Ga0134127_1071008033300010399Terrestrial SoilILSMLTTSLAPELSGVDDVGEKGELPVVLKSFRFAKKP*
Ga0134122_1208478223300010400Terrestrial SoilGDLKLWGRVIFLPTGTEGNTTGATLTMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0134123_1247281923300010403Terrestrial SoilKGTDRGDLKLWGRVIFLPTGKEGDATGATLTMLTTSLAGELSSVEDVGARGEMPVILDSFRFGKQK*
Ga0134123_1365172513300010403Terrestrial SoilGDIDLWGRVIFVPPGVAGEQAGATMILLATSLAPELSGVEDVGTKGELPVILDTFRFGKKR*
Ga0105246_1021733623300011119Miscanthus RhizosphereMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0105246_1046246013300011119Miscanthus RhizosphereGTEGDTTGATLTMLTTSLAGELSSVEDVGSRGEMPVILDSFRFGKKK*
Ga0105246_1076964613300011119Miscanthus RhizosphereIKIFGRIIFLPTGKEGDTTGATLIMSSSSLAPELTSVDDLGTKGEAPVILESFRFGKKK*
Ga0105246_1109620113300011119Miscanthus RhizosphereGDLQLWGRVIFLPTGKAGDSTGAILSMFTTSLAPELSSVEDVGQHGEAPVILDSFRFGKK
Ga0105246_1147082223300011119Miscanthus RhizosphereLQLWGRVVFLPRGEGETTGAILSMLTTSLAPELSGVDDVGEKGELPVVLKSFRFAKKP*
Ga0137383_1024486933300012199Vadose Zone SoilLPTGIAGDQSGATLVMLASSLAPELSGVEDVGEKGQMPVVLESFRFGSGR*
Ga0137399_1140750123300012203Vadose Zone SoilDLQLWGRVVFLATGVEGDKTGATLTMFATSLAPELSGVEDVGGKGEMPVILESFRVGKKK
Ga0137379_1057933523300012209Vadose Zone SoilMLSTSLAPELSGVEDLGEKGEMPVILESFRFGRKK*
Ga0137384_1128938523300012357Vadose Zone SoilTLSMLATSLAPELSDVEDVGEKGDMPVILESFRFGRSQ*
Ga0137390_1037953713300012363Vadose Zone SoilGDKTGATLTMFATSLAPELSGVEDVGGKGEMPVILESFRVGKKR*
Ga0150984_12311348933300012469Avena Fatua RhizosphereGATLAMLSTSLAPELSSVDDLGSKGEAPVILDSFRFGKKK*
Ga0137419_1052651723300012925Vadose Zone SoilQLWGRVVFLPTGVEGDKTGATLTMFATSLAPELSGVEDVGGKGEMPVILESFRVGKKSN*
Ga0164301_1090040213300012960SoilMRSPSAGATLTMLSTNLATELTSVDDLGVKGEAPVILESFRFGKKK*
Ga0164302_1117327523300012961SoilDLQLWGRVVFVPTGKAGDTNGAVLTMFTTSLAPELSSIEDVGSRGEMPVILDSFRFGKSP
Ga0164309_1086416823300012984SoilTMLSTSLAPELASVDDLGVKGEAPVILESFRFGKKK*
Ga0164309_1107358823300012984SoilVPTGKAGDANGAVLTMFTTSLAPELSSVADVGSVGEMPVILDSFRFGKRP*
Ga0164304_1094455823300012986SoilDRGDLKLWGRVIFLPTGTEGDTAGATLTMLTTSLAGELSSIEDVGSKGQMPVILDSFRFGKKK*
Ga0157371_1047471613300013102Corn RhizosphereSAGATLLMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ*
Ga0157378_1056446533300013297Miscanthus RhizosphereKEGDTGGATLTMLTTSLAPELSSIEDVGDKGEAPVILDSFRFGKK*
Ga0157378_1197141523300013297Miscanthus RhizosphereWGRVVFLPTGTEGDKTGATLYMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0157378_1296712023300013297Miscanthus RhizosphereGATLSMLTTSLAPELSGVDDVGEKGELPIVLKSFRFGK*
Ga0163162_1246353823300013306Switchgrass RhizosphereGDIQLWGRVVFLPTGNEGDTSGATLLMFATSLAGELSSVEDVGVRGEMPVILDSFRFSKKQ*
Ga0163162_1265311923300013306Switchgrass RhizosphereVVFLPTGTEGDTTGATLYMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK*
Ga0157375_1359266823300013308Miscanthus RhizosphereSMFTTSLAPELSSVEDVGTQGEAPVILDSFRFGKK*
Ga0163163_1154182823300014325Switchgrass RhizosphereTDRGDLKLWGRVIFLPTGTEGDTTGATLTMLTTSLAGELSSVEDVGSRGEMPVILDSFRFGKKK*
Ga0157380_1265489413300014326Switchgrass RhizosphereLWGRVIFLPTGKEGDTAGATLSMLTTSLAPELSSVEDVGERGEAPVILQSFRFGKKQ*
Ga0157379_1110056113300014968Switchgrass RhizosphereGAILSFLCTSLAPELSSVEDVGERGEAPVILESFRFGKKK*
Ga0137418_1068259323300015241Vadose Zone SoilRVIFLPRGEGETTGAILTMLTTSLAPEISGVDDVGVKGEAPVILESFRFGKKP*
Ga0182007_1032687713300015262RhizosphereEKGDLHLWGRVIFLPTGREGDTSGAILSMFTTSLAPELSSVEDVGTRGEAPVILDSFRFGKK*
Ga0132256_10016293613300015372Arabidopsis RhizosphereKGTEQGDLKLWGRVIFLPTNKEGDTTGATLAMLSTSLAPELSSENDLGVKGEAPVILDSFRFAKRK*
Ga0132256_10095059733300015372Arabidopsis RhizosphereIIFVPTGTEGNTTGATLSMFTTSLAPELSSVEDVGTKGEAPVILETFRFGKK*
Ga0132256_10350746723300015372Arabidopsis RhizosphereGHEGDTTGATLTMFATSLATDLSGVDDVGVKGQMPVILDTFKFGKR*
Ga0132257_10170754713300015373Arabidopsis RhizosphereMLSTSLAPELSSVDDLGVKGEAPVILESFRFGKKK*
Ga0132255_10491393913300015374Arabidopsis RhizosphereKGDIHLWGRVIFLPTGKEGDTSGATLTILSTSLAPELSSVEDVGEKGEAPVILESFRFGKKQ*
Ga0180121_1000122713300017695Polar Desert SandTLIMLATSLAPEMSGVEDVGEKGEMPVILESFRFARK
Ga0136617_1062975413300017789Polar Desert SandKGDIMVWGRVVFLPPGVEGKTNGVQLLMLTTSLAPELSSAEDIGDKGELPIILNSFRMGSDK
Ga0184635_1015992833300018072Groundwater SedimentWGRVIFLPTGKEGDTTGATLTMLSTSLATELSSVEDLGVKGEAPVILDSFRFGKKK
Ga0184639_1027637613300018082Groundwater SedimentTAGATLIMLATSLATELSGIEDVGEKGEMPVILESFRFGSSE
Ga0190265_1182218723300018422SoilGQQTGATIIMLATSLAPEISGVGDVGEKGEMPVILESFRFGK
Ga0190272_1000117413300018429SoilDQTGATLIMLATSLAPELSGVEDVGEKGEMPVILESFRFGKKS
Ga0066667_1038100913300018433Grasslands SoilQVWGRVIFLPTGIAGDQSGATLVMLASSLAPELSGVEDVGEKGQMPVVLESFRFGKGR
Ga0190268_1035718333300018466SoilDEGDVKLWGRVIFLPTGKEGDTTGLTLSMLGTSLAPDLSSIADVGERGESPVILDSFRFGKKN
Ga0190268_1204109623300018466SoilIFLPTGNEGDTAGATLSLLTTSLAPELSSVEDVGERGEAPVILESFRFGKKK
Ga0190273_1015404013300018920SoilKGTEKGDLQLWGRVVFVPTGVAGDNSGVILTMFTTSLAPELSSVEDVGAQGEMPVILESFRFGKAR
Ga0193739_102976713300020003SoilTEKGDLQLWGRVVFVPTGVEGDSNGAILTMFTTSLAPELSSVEDVGTRGEMPVILESFRFGKSR
Ga0210379_1015330013300021081Groundwater SedimentVFVPTGKAGDTNGAVLTMFTTSLAPELSSVEDVGSRGEMPVILDSFRFGKSP
Ga0182009_1035057213300021445SoilPPGVEGQKTGATLIMLATSLAPELSSIEDVGVKGEMPVILDSFRFGAKK
Ga0209431_1048474013300025313SoilLGDRNETTGATLVMISTSLANELSGVEDVGVKGEMPVILESFRFGKR
Ga0207710_1029960323300025900Switchgrass RhizosphereRVVFLPTGTEGDTSGATLYMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK
Ga0207647_1052180123300025904Corn RhizosphereVPTGHEGDTAGATLTMLTTSLAPELSSVEDVGERGEAPVILQSFRFGKKQ
Ga0207699_1015654243300025906Corn, Switchgrass And Miscanthus RhizosphereTTGATLSMFTTSLAPELSSVEDVGTKGEAPVILNSFRFGKKN
Ga0207660_1034688143300025917Corn RhizosphereDLKLWGRVIFLPTGNEGDTAGATLSMLTTSLAPELSSVEDVGVRGEAPVILDSFRFGKKK
Ga0207662_1069751613300025918Switchgrass RhizospherePTGNEGDSAGATLLMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ
Ga0207657_1125014913300025919Corn RhizosphereAKNTDRGDLQLWGRVIFVPTGHEGDTAGATLTMLTTSLAPELSSVEDVGERGEAPVILQSFRFGKKQ
Ga0207646_1106243513300025922Corn, Switchgrass And Miscanthus RhizosphereMLCTSLAGELSSVEDVGEKGEAPVILDSFRFGKKK
Ga0207650_1080471623300025925Switchgrass RhizosphereEGDSAGATLTMLSTNLATELTSVDDLGVKGEAPVILESFRFGKKK
Ga0207650_1131670613300025925Switchgrass RhizosphereVIFLPTNKEGDTTGATLTMLSTSLAPELTSVDDLGAKGEAPVILDSFRFGKKK
Ga0207659_1027942243300025926Miscanthus RhizosphereTNKEGDTTGATLTMLATSLAPELSSENDLGVKGEAPVILDSFRFGKKK
Ga0207687_1028004633300025927Miscanthus RhizosphereGNESANGATLVMLATSRAPELSGAEDIGEKGQLPIILESFRFGKSE
Ga0207687_1193275123300025927Miscanthus RhizosphereNEGDTSGATLLMFATSLAGELSSVEDVGVRGEMPVILDSFRFSKKQ
Ga0207701_1005919763300025930Corn, Switchgrass And Miscanthus RhizospherePTGNEGDSGAILSFLCTSLAPELSSVEDVGERGEAPVILESFRFGKKK
Ga0207701_1168631613300025930Corn, Switchgrass And Miscanthus RhizosphereVFLPTGTEGDTTGATLSMFSTSLAPELSSVDDIGKKGEATVILDSFRFGKKQ
Ga0207706_1024777643300025933Corn RhizosphereMLSTSLAPELSSVDDLGVKGEAPMILESFRFGKKK
Ga0207686_1065382923300025934Miscanthus RhizosphereMFATSLAGELSSVEDVGVRGEMPVILDSFRFSKKQ
Ga0207709_1023782513300025935Miscanthus RhizosphereKGTDRGDLKLWGRVIFLPTGTEGDATGATLTMLTTSLAGELSSVEDVGQRGEMPVILDSFRFGKQK
Ga0207670_1088022113300025936Switchgrass RhizosphereKEGDSTGAILSMFTTSLAPELSSVEDVGTQGEAPVILDSFRFGKK
Ga0207704_1047160933300025938Miscanthus RhizosphereGDTSGATLYMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK
Ga0207689_1059431033300025942Miscanthus RhizosphereLPTGTEGDTTGATLSMFSTSLAPELSSVDDIGKKGEATVILDSFRFGKKQ
Ga0207651_1079634523300025960Switchgrass RhizosphereAILSMFTTSLAPELSSVEDVGTQGEAPVILDSFRFGKK
Ga0207640_1179639713300025981Corn RhizosphereWGRVIFLPTGHEGDTSGAILSMFTTSLAPELSSVEDVGTRGEAPVILESFRFGKK
Ga0207703_1041259913300026035Switchgrass RhizosphereEGDTAGATLTMLTTSLAPELSSVEDVGERGEAPVILQSFRFGKKQ
Ga0207703_1053572333300026035Switchgrass RhizosphereSGATLYMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK
Ga0207703_1179781623300026035Switchgrass RhizosphereGRVIFLPTGTEGETAGATLTMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKQ
Ga0207708_1001772213300026075Corn, Switchgrass And Miscanthus RhizosphereDIQLWGRVVFLPTGNEGDSAGATLLMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ
Ga0207641_1008288163300026088Switchgrass RhizosphereAGDANGAILSMFTTSLAPELSGVEDVGVKGEMPVILESFRFGKKP
Ga0207641_1060476413300026088Switchgrass RhizosphereGATLYMLTTSLAGELSSVEDVGSQGQMPVILDSFRFGKKK
Ga0207641_1257265323300026088Switchgrass RhizosphereMLSTSLAPELSGVEDVGEKGEAPVILDSFRFGKKQ
Ga0207676_1082388433300026095Switchgrass RhizosphereIYLPTGKEGDSTGAILSIFTTSLAPELSSVEDVGTQGEAPVILDSFRFGKK
Ga0207674_1066856433300026116Corn RhizosphereGKEGDSAGATLTMLSTNLATELTSVDDLGVKGEAPVILESFRFGKKK
Ga0207674_1192504123300026116Corn RhizosphereAGATLSMLCTSLAGELSSVEDVGEKGESPVILESFRFGKKK
Ga0207683_1153111213300026121Miscanthus RhizosphereKGDLHLWGRVVFLPPGVAGAQNGAILTMFTTSLAPELSSVEDVGTRGEMPVILDSFRFVKKP
Ga0207698_1112699713300026142Corn RhizosphereLSFFCTSLAPELSSVEDVGTRGEAPVILDSFRFGKKK
Ga0209113_105763013300027517Forest SoilLRLWGRVIFLPTGKEGDGTGAVLSMFTTSLAPELSSVEDVGQHGEAPVILESFRFGKK
Ga0209387_111253623300027639Agricultural SoilVQLWGRVVFLPTGKEGDTAGATLSMLSTSLAPELSSVEDIGQKGEATVILDSFRFGKK
Ga0209485_117452823300027691Agricultural SoilFLPTGIEGHTAGATLIMLATSLAPELSGVEDVGVKGEMPVILESFRFTRD
Ga0209485_125086623300027691Agricultural SoilNEGDTTGATLTMFSTSLASELSSVDDVGEKGETPVILESFRFKQK
Ga0209486_1066059823300027886Agricultural SoilTGATLSMLCTSLAGELSSVADVGERGQAPVILESFRFGKKK
Ga0207428_1052636013300027907Populus RhizosphereGTEKGDIQLWGRVVFLPTGNEGDSAGATLLMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ
Ga0268264_1151494223300028381Switchgrass RhizosphereGDTSGATLTMLSTSLAPELSGVEDVGEKGEAPVILDSFRFGKKQ
Ga0268241_1000965453300030511SoilTGNEGDTTGATLSMFTTSLAPELSSVEDVGTKGEAPVILDSFRFGKKK
Ga0307468_10015359933300031740Hardwood Forest SoilSMLTTSLAPELSGVDDVGQKGELPVVLESFRFGKKP
Ga0307468_10072177413300031740Hardwood Forest SoilPTGVQGDQTGATLVMLTTSLAPELSGVEDVGEKGQMPVILESFRFGKSP
Ga0307468_10111299813300031740Hardwood Forest SoilTGVAGDQAGATLIMLTTSLAPELSSVDDVGVKGQMPVILDSFRFAKAP
Ga0307468_10199198513300031740Hardwood Forest SoilTSKGDIQLWGRVVFLPPGVEGQKTGATLIMLSTSLAPELSGVEDVGTKGEMPLILESFRFGKKK
Ga0310907_1037333323300031847SoilLPTGNEGDSAGATLLMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ
Ga0307406_1019672113300031901RhizosphereTERGDLNLWGRVIFLPTGKEGDTTGATLIMFCTNLAGELSSVEDVGSRGEAPVILDSFRFGKKK
Ga0310891_1017610023300031913SoilKGDIQLWGRVVFLPTGNEGDSAGATLLMLTTSLASELSSVADVGERGEMPVILESFRFGKKQ
Ga0307470_1192329813300032174Hardwood Forest SoilTGATLVMLTTSLAPELAGIDDIGSKGQMPVILDSFRFGKPKV
Ga0310810_1040833713300033412SoilRVIFLPTGKEGDTTGATLSMLGTNLAGELSSVQDIGSRGETPVILDSFRFGKKK
Ga0310811_1080832333300033475SoilGDTSGAILSMFTTSLAPELSSVEDVGTRGEAPVILDSFRFGKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.