NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F023867

Metagenome Family F023867

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023867
Family Type Metagenome
Number of Sequences 208
Average Sequence Length 46 residues
Representative Sequence NITVVLARFHGDDLEEPSTDRITIELPPLEEDKTLDDTYEADTEPH
Number of Associated Samples 166
Number of Associated Scaffolds 208

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.48 %
% of genes near scaffold ends (potentially truncated) 99.52 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 153
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.635 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(9.615 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.135 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 16.22%    Coil/Unstructured: 83.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 208 Family Scaffolds
PF01957NfeD 72.12
PF01619Pro_dh 13.46
PF07992Pyr_redox_2 0.96
PF13672PP2C_2 0.48
PF01642MM_CoA_mutase 0.48
PF00076RRM_1 0.48
PF14907NTP_transf_5 0.48
PF00583Acetyltransf_1 0.48
PF04542Sigma70_r2 0.48
PF07949YbbR 0.48
PF13646HEAT_2 0.48
PF00905Transpeptidase 0.48

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 208 Family Scaffolds
COG0506Proline dehydrogenaseAmino acid transport and metabolism [E] 13.46
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.48
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.48
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.48
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.48
COG4856Cyclic di-AMP synthase regulator CdaR, YbbR domainSignal transduction mechanisms [T] 0.48
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.48

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.63 %
UnclassifiedrootN/A3.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02GGOWRAll Organisms → cellular organisms → Bacteria524Open in IMG/M
2170459019|G14TP7Y02F7RT9All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_10419998All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101791547All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300000574|JGI1357J11328_10218270All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300000787|JGI11643J11755_11404733All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300000789|JGI1027J11758_11716233All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300000789|JGI1027J11758_11994749Not Available886Open in IMG/M
3300000953|JGI11615J12901_11320906All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300003321|soilH1_10149561All Organisms → cellular organisms → Bacteria3982Open in IMG/M
3300003324|soilH2_10013288All Organisms → cellular organisms → Bacteria4766Open in IMG/M
3300003324|soilH2_10025779All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300004114|Ga0062593_103215177All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300004463|Ga0063356_102815149All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300004480|Ga0062592_100058703All Organisms → cellular organisms → Bacteria2144Open in IMG/M
3300004480|Ga0062592_100897729All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300004480|Ga0062592_101123530All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300005180|Ga0066685_10866834All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300005181|Ga0066678_10315581All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300005184|Ga0066671_10288406All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300005186|Ga0066676_10506599All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300005289|Ga0065704_10083236All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes3491Open in IMG/M
3300005328|Ga0070676_11379531All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005330|Ga0070690_100723617All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005335|Ga0070666_10462112All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300005340|Ga0070689_101635923All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005341|Ga0070691_10912162All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005438|Ga0070701_11224946All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005440|Ga0070705_100428285All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300005440|Ga0070705_101091461All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005440|Ga0070705_101596657All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005440|Ga0070705_101784003All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005447|Ga0066689_10789201Not Available591Open in IMG/M
3300005459|Ga0068867_101580380All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300005467|Ga0070706_101555861All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005518|Ga0070699_101726163All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005540|Ga0066697_10096176All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300005543|Ga0070672_101204010All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005545|Ga0070695_100592875All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium869Open in IMG/M
3300005545|Ga0070695_100741327All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005545|Ga0070695_100823242All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum745Open in IMG/M
3300005545|Ga0070695_100850439All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300005546|Ga0070696_101754949All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005549|Ga0070704_101051988All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005556|Ga0066707_10929431All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005577|Ga0068857_100543175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae1094Open in IMG/M
3300005577|Ga0068857_101373790All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum687Open in IMG/M
3300005577|Ga0068857_101897479All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005578|Ga0068854_100959328All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005586|Ga0066691_10665662All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005616|Ga0068852_101531964All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum689Open in IMG/M
3300005618|Ga0068864_102655972All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005834|Ga0068851_10980329All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005842|Ga0068858_100390534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae1336Open in IMG/M
3300005842|Ga0068858_101095349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae782Open in IMG/M
3300005843|Ga0068860_101705780All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005843|Ga0068860_101786133All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales637Open in IMG/M
3300005844|Ga0068862_100343505All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300005985|Ga0081539_10349377All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300006046|Ga0066652_101302966All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia685Open in IMG/M
3300006358|Ga0068871_100087191All Organisms → cellular organisms → Bacteria2594Open in IMG/M
3300006755|Ga0079222_11083515All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300006844|Ga0075428_100533231All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300006876|Ga0079217_10209515Not Available1004Open in IMG/M
3300006880|Ga0075429_100600069All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300006880|Ga0075429_100621309All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300006894|Ga0079215_11123535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia591Open in IMG/M
3300006904|Ga0075424_101460542All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300006904|Ga0075424_102848226All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300006954|Ga0079219_10437025All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300007265|Ga0099794_10201092All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1020Open in IMG/M
3300007265|Ga0099794_10468507All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300007265|Ga0099794_10669935All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009012|Ga0066710_102942279All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300009012|Ga0066710_104792217All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009078|Ga0105106_10162212All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300009090|Ga0099827_10943802All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes748Open in IMG/M
3300009094|Ga0111539_11113535All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes917Open in IMG/M
3300009098|Ga0105245_10462505All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1279Open in IMG/M
3300009100|Ga0075418_10833367All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes996Open in IMG/M
3300009101|Ga0105247_10316229All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1088Open in IMG/M
3300009147|Ga0114129_10283457All Organisms → cellular organisms → Bacteria → Acidobacteria2213Open in IMG/M
3300009148|Ga0105243_10704792All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes984Open in IMG/M
3300009148|Ga0105243_10898005All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes881Open in IMG/M
3300009174|Ga0105241_10637206All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes967Open in IMG/M
3300009174|Ga0105241_11383115All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009176|Ga0105242_11677202All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300009176|Ga0105242_12816203All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300009176|Ga0105242_13111034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300009176|Ga0105242_13115549All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300009177|Ga0105248_10444810All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1460Open in IMG/M
3300009177|Ga0105248_12588867All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300009553|Ga0105249_12104719All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300009553|Ga0105249_12267074All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300009789|Ga0126307_11165277All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300009789|Ga0126307_11192495All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300009840|Ga0126313_10960797All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300010037|Ga0126304_10445192All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes867Open in IMG/M
3300010038|Ga0126315_11087047All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010042|Ga0126314_10545906All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes843Open in IMG/M
3300010045|Ga0126311_11219311All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300010326|Ga0134065_10207967All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300010360|Ga0126372_10842584All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes913Open in IMG/M
3300010360|Ga0126372_12189038All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300010361|Ga0126378_12616967All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010364|Ga0134066_10219747All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300010366|Ga0126379_11313190All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300010397|Ga0134124_11120899All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes804Open in IMG/M
3300010397|Ga0134124_11546670All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300010399|Ga0134127_12223171All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300010399|Ga0134127_12490611All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300010400|Ga0134122_11555682All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300010401|Ga0134121_12170243All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300010403|Ga0134123_11147648All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300010403|Ga0134123_11702719All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010403|Ga0134123_12205933All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300010403|Ga0134123_13587304All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300011271|Ga0137393_10605387All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes940Open in IMG/M
3300012015|Ga0120187_1058078All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300012096|Ga0137389_11392063All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300012096|Ga0137389_11827920Not Available503Open in IMG/M
3300012199|Ga0137383_10231131All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1355Open in IMG/M
3300012200|Ga0137382_10756810All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012202|Ga0137363_10137882All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1903Open in IMG/M
3300012208|Ga0137376_10611326All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300012212|Ga0150985_102916721All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300012285|Ga0137370_10719202All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300012357|Ga0137384_10793860All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300012362|Ga0137361_11411052All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012469|Ga0150984_111035424All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1007Open in IMG/M
3300012474|Ga0157356_1016554All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300012511|Ga0157332_1026998All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012685|Ga0137397_10077894All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2407Open in IMG/M
3300012918|Ga0137396_11195208All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012925|Ga0137419_11936333All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes506Open in IMG/M
3300012927|Ga0137416_11834399All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300012929|Ga0137404_11202827All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012957|Ga0164303_10118838All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1344Open in IMG/M
3300013100|Ga0157373_10603914All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300013306|Ga0163162_12760187All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300013307|Ga0157372_11891842All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300013308|Ga0157375_10776020All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1108Open in IMG/M
3300013308|Ga0157375_13552387All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300013760|Ga0120188_1023402All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300014263|Ga0075324_1161448All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300014326|Ga0157380_12823417All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300014968|Ga0157379_11639382All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300014969|Ga0157376_11109220All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300015373|Ga0132257_100218804All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2263Open in IMG/M
3300018027|Ga0184605_10143254All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1073Open in IMG/M
3300018063|Ga0184637_10171538All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1335Open in IMG/M
3300018076|Ga0184609_10039730All Organisms → cellular organisms → Bacteria1972Open in IMG/M
3300018466|Ga0190268_10778289All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300018476|Ga0190274_10621270All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1111Open in IMG/M
3300018476|Ga0190274_13691736All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium517Open in IMG/M
3300019879|Ga0193723_1178399All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300019999|Ga0193718_1069850All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300020004|Ga0193755_1079893All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1050Open in IMG/M
3300020061|Ga0193716_1273163All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium591Open in IMG/M
3300025893|Ga0207682_10534587All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300025899|Ga0207642_10054271All Organisms → cellular organisms → Bacteria1827Open in IMG/M
3300025903|Ga0207680_10528095All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300025904|Ga0207647_10381090All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300025908|Ga0207643_10046009All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2466Open in IMG/M
3300025908|Ga0207643_10837117All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300025913|Ga0207695_11745225All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025920|Ga0207649_11454175All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300025922|Ga0207646_10672622All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300025923|Ga0207681_10583586All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes922Open in IMG/M
3300025923|Ga0207681_11851591Not Available503Open in IMG/M
3300025925|Ga0207650_11468284Not Available580Open in IMG/M
3300025930|Ga0207701_10412832All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1162Open in IMG/M
3300025933|Ga0207706_11159628All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300025936|Ga0207670_10987779All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300025939|Ga0207665_11515479Not Available533Open in IMG/M
3300025941|Ga0207711_10503118All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1129Open in IMG/M
3300025945|Ga0207679_11844809All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025945|Ga0207679_11978379All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300025981|Ga0207640_11736256All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300025986|Ga0207658_11497371All Organisms → cellular organisms → Bacteria → Proteobacteria617Open in IMG/M
3300026035|Ga0207703_10315801All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300026041|Ga0207639_10566120All Organisms → cellular organisms → Bacteria → Acidobacteria1045Open in IMG/M
3300026095|Ga0207676_11390674All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300026095|Ga0207676_12062268All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes569Open in IMG/M
3300026116|Ga0207674_10076224All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes3362Open in IMG/M
3300026142|Ga0207698_11977917All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300026285|Ga0209438_1034934All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1667Open in IMG/M
3300026313|Ga0209761_1158238All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1060Open in IMG/M
3300027748|Ga0209689_1354312All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300027886|Ga0209486_11219925All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300027909|Ga0209382_11194730All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300028381|Ga0268264_12523489All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300028536|Ga0137415_10303675All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300028792|Ga0307504_10415990All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031229|Ga0299913_10155407All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2258Open in IMG/M
3300031716|Ga0310813_10961346All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300031731|Ga0307405_10483131All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium989Open in IMG/M
3300031740|Ga0307468_102139090All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031852|Ga0307410_11365273All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300032002|Ga0307416_101201022All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes864Open in IMG/M
3300032003|Ga0310897_10442876All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300032004|Ga0307414_10989364All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300032005|Ga0307411_10453891All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1073Open in IMG/M
3300032126|Ga0307415_100286979All Organisms → cellular organisms → Bacteria → Acidobacteria1356Open in IMG/M
3300032180|Ga0307471_103414607All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300033412|Ga0310810_10727766All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes915Open in IMG/M
3300033412|Ga0310810_10789164All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes861Open in IMG/M
3300033412|Ga0310810_11406261All Organisms → cellular organisms → Bacteria532Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.73%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.29%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.33%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.37%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.44%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.48%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.48%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.48%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.48%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.48%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.48%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.48%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.48%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.48%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.48%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012015Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013760Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2EnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_042185402065487018SoilNITVVLARFIGDDLEEPSNDRITIELPQLEEDKTLDDTYEADTEPRI
4MG_039966502170459019Switchgrass, Maize And Mischanthus LitterEDNITVVMARFFGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH
ICChiseqgaiiFebDRAFT_1041999833300000363SoilDDLALPTSDKITIELPPLEEDKTLDDNYEADTEPQG*
INPhiseqgaiiFebDRAFT_10179154723300000364SoilRGGEDNITVVLARFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI*
JGI1357J11328_1021827023300000574GroundwaterNITVVLARFTGEDLREASADRITVELPPLEEDKTLDETEADTSSH*
JGI11643J11755_1140473313300000787SoilLGEDLALPTNDKITIELPPLEEDKTLDDNYEADTEPQGS*
JGI1027J11758_1171623323300000789SoilDLEEPSNDRITIELPQLEEDKTLDDTYEADTEPRI*
JGI1027J11758_1199474933300000789SoilTVVLARFTGDDLRDPNDDRITVELPPLEEDRTLDETETDTQHP*
JGI11615J12901_1132090633300000953SoilFGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH*
soilH1_1014956113300003321Sugarcane Root And Bulk SoilEDNITVVLARFQGDDLEEPATDRITIELPPLEEDKTLDDTYEADTEPH*
soilH2_1001328813300003324Sugarcane Root And Bulk SoilGEDNITVVLARFQGDDLEEPATDRITIELPPLEEDKTLDDTYEADTEPH*
soilH2_1002577943300003324Sugarcane Root And Bulk SoilNITVVLARFHGDDLEEPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0062593_10321517723300004114SoilRFNGDELEDPSSDRITIELPPIEEEDKTLDDTYDPTTEPR*
Ga0063356_10281514923300004463Arabidopsis Thaliana RhizosphereNITVVLARFHGDDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH*
Ga0062592_10005870313300004480SoilDNITVVLARFQGDDLEEPSTDRITIELPPLEEDKTLDDNYEADTEPH*
Ga0062592_10089772913300004480SoilGGEDNITVILARFSGDELEEPSAEKITIELPLLEEDKTLDDTYDPDTEPR*
Ga0062592_10112353023300004480SoilVVLARFQGDDLEAPSSDRITIELPPLEEDKTLDDNYEADTEPH*
Ga0066685_1086683423300005180SoilLARFLGDDLEEPVSDRITIELPALEEDKTLEDTFEPDTEPH*
Ga0066678_1031558133300005181SoilVLARFTGEELSNSSHDRITVELPPLEEDKTLDETEADTEQQ*
Ga0066671_1028840633300005184SoilANNRGGEDNITVVLARFSGEDLRDPNDDRITVELPTLEEDRTLDETEADTESGNR*
Ga0066676_1050659913300005186SoilRFLGDDLEPPTTERITIELPPLEEDKTLDDSYDEPDTEPQ*
Ga0065704_1008323663300005289Switchgrass RhizosphereARFLGDDLEAPSTEKITIELPPLDEDKTLDDGYEADTEPH*
Ga0070676_1137953123300005328Miscanthus RhizosphereGGEDNITVVLARFIGDDLEEPSNDRITVELPQLEEDKTLDDTYEADTEPRI*
Ga0070690_10072361723300005330Switchgrass RhizosphereSGDELEEPDTDRITIELPPLEEDMTLDDSYEHDTEPREQ*
Ga0070666_1046211213300005335Switchgrass RhizosphereGDDLEAPATDRITIELPPLEEDKTLDDTYEADTEPRTGE*
Ga0070689_10163592323300005340Switchgrass RhizosphereILARFSGDELEEPDTDRITIELPPLEEDMTLDDNYEPDTEPR*
Ga0070691_1091216213300005341Corn, Switchgrass And Miscanthus RhizosphereNNRGGEDNITVVLARFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI*
Ga0070701_1122494613300005438Corn, Switchgrass And Miscanthus RhizosphereGGEDNITVVLAKFLGDDLALPTSDKITIELPPLEEDKTLDDNYEADTEPQG*
Ga0070705_10042828533300005440Corn, Switchgrass And Miscanthus RhizosphereGGEDNITVVLAHFSGDDLEPPATDRITIELPPLEEDKTLDDTYEADTEPR*
Ga0070705_10109146113300005440Corn, Switchgrass And Miscanthus RhizosphereRGGEDNITVVLARFGGDDLEEATSERITIELPALEEDKTLEDNFEADTEPQ*
Ga0070705_10159665713300005440Corn, Switchgrass And Miscanthus RhizosphereEANNRGGEDNITVVLARFTGEELRDPNDDRITVELPLMEEDRTLDETEVDTQHP*
Ga0070705_10178400313300005440Corn, Switchgrass And Miscanthus RhizosphereIRGGEDNITVVLARFLGDDLEPPTTERITIELPPLEEDKTLDDSYDEPDTEPQ*
Ga0066689_1078920113300005447SoilITVVLARFTGDELREPTSDRITIELPPMEEDKTLDETEADTENPD*
Ga0068867_10158038013300005459Miscanthus RhizosphereNITVVLARFSGDDLRDPNDDRITVELPPLDEDRTLDETVADTEHP*
Ga0070706_10155586113300005467Corn, Switchgrass And Miscanthus RhizosphereEANNRGGEDNITVVLARFTGKDLRDPNDDRITVELPLMEEDRTLDETEVDTQHP*
Ga0070699_10172616323300005518Corn, Switchgrass And Miscanthus RhizosphereRGGEDNITVVLARFTGDELKDGSADRITVELPVLEEDKTLDETEADTGQM*
Ga0066697_1009617613300005540SoilELREPTSDRITIELPPMEEDKTLDETEADTENPD*
Ga0070672_10120401023300005543Miscanthus RhizosphereANNRGGEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0070695_10059287513300005545Corn, Switchgrass And Miscanthus RhizosphereNERGGEDNITVVLARFSGEGLDDGAADRITVELPVSEEDRTLDETEVDSQHQTPSL*
Ga0070695_10074132723300005545Corn, Switchgrass And Miscanthus RhizosphereRFSGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0070695_10082324213300005545Corn, Switchgrass And Miscanthus RhizosphereTAANDRGGEDNITVVLARFTGKELEDAGTDRITVELPVVEEDKTLEETEIDTQHRTPIL*
Ga0070695_10085043913300005545Corn, Switchgrass And Miscanthus RhizosphereLIDEANNRGGEDNITVVLAHFSGDDLEPPATDRITIELPPLEEDKTLDDTYEADTEPN*
Ga0070696_10175494923300005546Corn, Switchgrass And Miscanthus RhizosphereDNITVVLARFIGDDLEEPSNDRITIELPQLEEDKTLDDTYDADTEPRI*
Ga0070704_10105198833300005549Corn, Switchgrass And Miscanthus RhizosphereANNRGGEDNITVVLVRFLGDDLQEPTNDHITVELPPLEEDKTLDDTYEADTESS*
Ga0066707_1092943123300005556SoilITVVLARFVGDDLEPPTTERITIELPPLEEDKTLDDNFEADTEPQ*
Ga0068857_10054317533300005577Corn RhizosphereTVVLVRFLGDDLQEPTGDHITVELPPLEEDKTLDDTYEADTEAS*
Ga0068857_10137379023300005577Corn RhizosphereANNRGGEDNITVVLARFDGEDLEAPATDRITIELPPLEEDKTLDDNYEADTEPH*
Ga0068857_10189747913300005577Corn RhizosphereDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0068854_10095932813300005578Corn RhizosphereNNRGGEDNITVVLARFSGDDLEEPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0066691_1066566223300005586SoilEDNITVVLARFTGEELSNSGHDRITVELPPLEEDKTLDETESDTEVQ*
Ga0068852_10153196413300005616Corn RhizosphereEEANNRGGEDNITVVLARFLGEDLGLPTNDKITIELPPLEEDKTLDDNYEADTEPQGS*
Ga0068864_10265597223300005618Switchgrass RhizosphereLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI*
Ga0068851_1098032913300005834Corn RhizosphereSGDDLEEAQSDRITIELPPMEEDKTLDDTYEADTEPR*
Ga0068858_10039053433300005842Switchgrass RhizosphereDNITVVLAKFLGDDLALPTSDKITIELPPLEEDKTLDDNYEADTEPQG*
Ga0068858_10109534933300005842Switchgrass RhizosphereARFFGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0068860_10170578023300005843Switchgrass RhizosphereTVILARFSGDELEEPSAEKITIELPLLEEDKTLDDTYDPDTEPR*
Ga0068860_10178613323300005843Switchgrass RhizosphereNNRGGEDNITVVLARFFGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0068862_10034350533300005844Switchgrass RhizosphereELEEPSAEKITIELPLLEEDKTLDDTYDPDTEPR*
Ga0081539_1034937723300005985Tabebuia Heterophylla RhizosphereDLEPPATDRITIELPPLEEDKTLDDTYEADTEPQ*
Ga0066652_10130296613300006046SoilRGGEDNITVVLARFSGDDLRDPNDDRITVELPPLDEDRTLDETIADTEHP*
Ga0068871_10008719153300006358Miscanthus RhizosphereRFSGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0079222_1108351513300006755Agricultural SoilARFFGDDLEGPSSDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0075428_10053323113300006844Populus RhizosphereDNITVVLARFMGDDLEPPATDRITIELPPLEEDKTLDDSYEADTEPQ*
Ga0079217_1020951523300006876Agricultural SoilVVLARFHGDDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH*
Ga0075429_10060006933300006880Populus RhizosphereDLEAPATDRITIELPPLEEDKTLDDNYEADTEPH*
Ga0075429_10062130913300006880Populus RhizosphereDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ*
Ga0079215_1112353513300006894Agricultural SoilGGEDNITVILARFSGDELQEPASDRITVELPAIEEEDKTLDDTYESDTEPQPNS*
Ga0075424_10146054223300006904Populus RhizosphereVLARFLGEDLEEPSTDRITIELPPLEEDKTLDDTYDADTEPRI*
Ga0075424_10284822623300006904Populus RhizosphereANNRGGEDNITVVLARFSGDELQDGAEDRITVELPVLDEDKTLDETEVDSHTTPKL*
Ga0079219_1043702513300006954Agricultural SoilNRGGEDNITVVLARFFGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0099794_1020109233300007265Vadose Zone SoilGGEDNITVVLARFSGDELRDPNDDRITVELPPVEDDKTLDETEADTQNPER*
Ga0099794_1046850713300007265Vadose Zone SoilNRGGEDNITVVLARFSGDELRDPNDDRITVELPPVEDDKTLDETEADTQQP*
Ga0099794_1066993513300007265Vadose Zone SoilNRGGEDNITVVLARFVGDDLELPTTERITIELPPLEEDKTLDDNFEADTEPQ*
Ga0066710_10294227913300009012Grasslands SoilRGGEDNITVVLARFTGEELSAPDQDRITVELPPLDEDRTLDETDIDTTANM
Ga0066710_10479221723300009012Grasslands SoilEDNITVVLARFTGDELREPTQDRITIELPPLEEDKTLDETEADTQHETEDD
Ga0105106_1016221243300009078Freshwater SedimentDGKDLEEPSTDRITIELPQLDEDKTLDDNYQADTEPH*
Ga0099827_1094380233300009090Vadose Zone SoilARFSGEELEEPASDRITIELPPLEEDKTLDDNFEPDTEPR*
Ga0111539_1111353513300009094Populus RhizosphereDNITVVVARFSGDDLEEAQSDRITIELPPMEEDKTLDDTYEADTEPR*
Ga0105245_1046250543300009098Miscanthus RhizosphereNITVVLARISGDDLEAPASDRITIELPPLEEDKTLDDTYEADTEPR*
Ga0075418_1083336733300009100Populus RhizosphereAEANNRGGEDNITVVLARFTGEELRDPNDDRITVELPPMEEDRTLDETEVDTQHP*
Ga0105247_1031622913300009101Switchgrass RhizosphereDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0114129_1028345743300009147Populus RhizosphereDLEAPSSDRITIELPPLEEDKTLDDNYEADTEPH*
Ga0105243_1070479233300009148Miscanthus RhizosphereEDNITVVLARFIGDDLEEPSNDRITIELPQLEEDKTLDDTYDADTEPRI*
Ga0105243_1089800533300009148Miscanthus RhizosphereTVILARFTGDELEEPASEKITVELPPMTEEDKTLDDTYSPDTEPR*
Ga0105241_1063720613300009174Corn RhizosphereVLARFSGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0105241_1138311513300009174Corn RhizosphereITVVLARFQGDDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH*
Ga0105242_1167720213300009176Miscanthus RhizosphereTVILARFSGEELEEPSTDRITIELPPLEEDMTLDDSYERDTEPR*
Ga0105242_1281620323300009176Miscanthus RhizosphereGEDNITVVLARFSGDDLRDPNDDRITVELPPLDEDRTLDETIADTEHP*
Ga0105242_1311103413300009176Miscanthus RhizosphereRFSGNELEEPSADKITIELPLLDEDKTLDDTYDPDTEPR*
Ga0105242_1311554923300009176Miscanthus RhizosphereLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0105248_1044481033300009177Switchgrass RhizosphereVLARFSGEDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0105248_1258886723300009177Switchgrass RhizosphereEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0105249_1210471923300009553Switchgrass RhizosphereGEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0105249_1226707413300009553Switchgrass RhizosphereLARFFGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0126307_1116527723300009789Serpentine SoilEDNITVVLARFSGDDLEAPATDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0126307_1119249523300009789Serpentine SoilFSGDDLEPPATDRITIELLPLEEDKTLDDTYEADTEPQ*
Ga0126313_1096079713300009840Serpentine SoilRGGEDNITVVLARFSGDDLEAPATDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0126304_1044519213300010037Serpentine SoilITVVLARFSGDDLQAPATDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0126315_1108704723300010038Serpentine SoilVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0126314_1054590633300010042Serpentine SoilFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0126311_1121931123300010045Serpentine SoilVLAHFSGDDLEPPATDRITIELPPLEEDKTLDDTYEADTEPQ*
Ga0134065_1020796723300010326Grasslands SoilVLARFTGEELSNSSHDRITVELPPLEEDKTLDETEADTEI*
Ga0126372_1084258433300010360Tropical Forest SoilLAKFLGDDLEAPSSNRITIELPPLEEDKTLDDGYEADTEPRS*
Ga0126372_1218903813300010360Tropical Forest SoilVLARFFGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0126378_1261696713300010361Tropical Forest SoilNRGGEDNITVVLARFGGDDLEEPVSDRITIELPPLEEDKTLEDGFEADTQPH*
Ga0134066_1021974723300010364Grasslands SoilEDNITVVIARFDGDDLQEPTTNRITIELPALEEDKTLEDTFDADTQPQ*
Ga0126379_1131319023300010366Tropical Forest SoilTVVLARFGGDDLDEPTSDRITIELPPLEEDKTLEDNFESDTQTQQ*
Ga0134124_1112089913300010397Terrestrial SoilDLEEAQSDRITIELPPMEEDKTLDDTYEADTEPR*
Ga0134124_1154667023300010397Terrestrial SoilEDNITVVLAKFLGDDLALPTSDKITIELPPLEEDKTLDDNYEADTEPQG*
Ga0134127_1222317123300010399Terrestrial SoilARFSGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0134127_1249061113300010399Terrestrial SoilDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0134122_1155568213300010400Terrestrial SoilRGGEDNITVVLARFDGDDLQEATTDRITIELPTLEEDKTLEDTFDADTQPH*
Ga0134121_1217024313300010401Terrestrial SoilRGGEDNITVVLARFFGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0134123_1114764823300010403Terrestrial SoilLARFLGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPQH*
Ga0134123_1170271923300010403Terrestrial SoilVILARFTGDELEDPATDRITIELPPIEEEDKTLDDTYDPDTEPR*
Ga0134123_1220593313300010403Terrestrial SoilDDLEEPATDRITIELPPLEEDKTLDDSYEADTEPQ*
Ga0134123_1358730413300010403Terrestrial SoilHRGGEDNITVVLARFDGDDLQEATTDRITIELPALEEDKTLEDTFDADTQPH*
Ga0137393_1060538733300011271Vadose Zone SoilANNRGGEDNITVVLARFVGDDLEPPTTERITIELPPLEEDKTLDDNFEADTEPQ*
Ga0120187_105807823300012015TerrestrialEANNRGGEDNITVVLARFNGDDLEAPATDKITIELPPMEEDKTLDDTYEADTEPR*
Ga0137389_1139206313300012096Vadose Zone SoilEDNITVVLARLTGEALKPTLEDRITVKLPVLKENKTLEKTKADTEDPTIGN*
Ga0137389_1182792023300012096Vadose Zone SoilVLARFSGEELSNSSHDRITVELPPLEEDKTLDETEADTEQQ*
Ga0137383_1023113133300012199Vadose Zone SoilGGEDNITVVLARFSGDDLEEAREDRITVELPAIEEDQTLDETEIDTEADTVIPHRR*
Ga0137382_1075681023300012200Vadose Zone SoilEDNITVILARFSGNELEDPASDRITIELPAMDEDKTLDDTYDTYDPDTEPH*
Ga0137363_1013788213300012202Vadose Zone SoilEELEEPASDRITIELPPLEEDKTLDDSYESDTEPR*
Ga0137376_1061132623300012208Vadose Zone SoilEANRRGGEDNITVVLARFTGEELSNSSHDRITVELPPLEEDKTLDETEADAEQR*
Ga0150985_10291672123300012212Avena Fatua RhizosphereGEDNITVVLARFLGDDLEEPSNERITIELPPLEEDKTLDDTYEADTEPQS*
Ga0137370_1071920223300012285Vadose Zone SoilNRGGEDNITVVLARFTGDELRDPNDDRITVELPPLEEDRTLDETEADTQHE*
Ga0137384_1079386033300012357Vadose Zone SoilEDLEEPVTDRITIELPALEEDKTLEDNFDSDTEPQ*
Ga0137361_1141105213300012362Vadose Zone SoilANNRGGEDNITVVLARFDGDDLQEPATDRITIELPALEEDKTLEDFEGDTEPQ*
Ga0150984_11103542413300012469Avena Fatua RhizosphereRGGEDNITVVLARFSGGDLRDPNDDRITVELPPLDDDRTLDETIADTEHP*
Ga0157356_101655413300012474Unplanted SoilANNRGGEDNITVVLARFLGDDLAEPSTDRITIELPPLEEDKTLDDSYEADTEPQH*
Ga0157332_102699823300012511SoilGEDNITVVLARFLGDDLEEPSNERITIELPPLEEDKTLDDSYEADTEPQH*
Ga0137397_1007789413300012685Vadose Zone SoilTGEELREASADRITVELPPLEEDKTLDETEADTSHH*
Ga0137396_1119520813300012918Vadose Zone SoilDNITVVLARFTGDELREASEDRITVELPPLEEDKTLDETEADTQNPDR*
Ga0137419_1193633313300012925Vadose Zone SoilNYRGGEDNITVVLARFTGEELREASEDRITVELPPLEEDKTLDETEADTSPH*
Ga0137416_1183439913300012927Vadose Zone SoilTGNELEDPASDRITIELPAMEDEDKTRDATYDTDTEPR*
Ga0137404_1120282723300012929Vadose Zone SoilEANNRGGEDNITVILARFGGPDLEEATTERITIELPILEEDKTLEDTFEADTEPPTGD*
Ga0164303_1011883833300012957SoilFLGDDLEAPATEKITIELPPLDEDKTLDDGYEADTEPR*
Ga0157373_1060391433300013100Corn RhizosphereDNITVVLARFSGDDLEAPATDRITIELPPLEEDKTLDDTYEADTGPH*
Ga0163162_1276018713300013306Switchgrass RhizosphereEDNITVVLARFLGDDLEAPATEKITIELPPLDEDKTLDDGYEADTEPR*
Ga0157372_1189184223300013307Corn RhizosphereRGGEDNITVVLARFQGDDLEEAATDRITIELPPLDEDKTLDDNYEADTEPH*
Ga0157375_1077602033300013308Miscanthus RhizosphereVVLARFLGGDLEAPSTEKITIELPPLDEDKTLDDGYEADTEPH*
Ga0157375_1355238723300013308Miscanthus RhizosphereRGGEDNITVILARFTGDELEEPASDRITVELPAMQEEDKTLDDTYSPETDPR*
Ga0120188_102340213300013760TerrestrialLEEPASDRITVELPAIQEEDKTLDDTFESDTEPHG*
Ga0075324_116144823300014263Natural And Restored WetlandsNITVVLARFFGEDLEAPASDRITIELPPLEEDKTLDDTYEADTEPH*
Ga0157380_1282341713300014326Switchgrass RhizosphereNNRGGEDNITVILARFNGDELEDPASDRITIELPPIEEEDKTLDDTYDPDTEPH*
Ga0157379_1163938213300014968Switchgrass RhizosphereNRGGEDNITVVLARFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI*
Ga0157376_1110922013300014969Miscanthus RhizosphereRFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI*
Ga0132257_10021880453300015373Arabidopsis RhizosphereAQFSGDDLEAPESDRITIELPPLEEDKTLDDTYEADTEPQ*
Ga0184605_1014325413300018027Groundwater SedimentIRGGEDNITVVLARFLGDDLEPASTDRITIELPPLEEDKTLDDSYEPDTEPQ
Ga0184637_1017153813300018063Groundwater SedimentSGDELEEPASDRITIELPPLQEEDKTLDDTYDPDTDPR
Ga0184609_1003973043300018076Groundwater SedimentGEDNITVVLARFLGDDLEEPANDRVTIELPQLEEDKTLDDSYEADTEPQQQ
Ga0190268_1077828923300018466SoilVLAHFSGDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ
Ga0190274_1062127033300018476SoilGGEDNITVVLARFLGEDLEAPSTERITIELPPLEEDKTLDDTYEADTEPQQN
Ga0190274_1369173613300018476SoilARFSGDELEEPATDRITIELPPLEEEDMTLDDTYESDTESH
Ga0193723_117839923300019879SoilGDELEEPTADRITIELPLLEEDKTLDDTYDPDTEPR
Ga0193718_106985023300019999SoilANYRGGEDNITVVLAKFTGEDLREANADRITVELPPLEEDKTLDETEADTSHH
Ga0193755_107989333300020004SoilEDNITVVLARFTGDELREASEDRITVELPPLEEDRTLDETEADTQNPNK
Ga0193716_127316313300020061SoilRLMGDDLEEPANDRVTIELPQLEEDKTLDDNYEADTEPTAE
Ga0207682_1053458713300025893Miscanthus RhizosphereSGTELEEPVNDRITIELPPLTEDDKTLDDTYEQDTEPRQL
Ga0207642_1005427113300025899Miscanthus RhizosphereTVVLAWFLGDDLEEPSNDRITIELPPLEEDKTLDDTYEADTEPRI
Ga0207680_1052809523300025903Switchgrass RhizosphereGEDNITVVLARFLGDDLEAPATDRITIELPPLEEDKTLDDTYEADTEPRTGE
Ga0207647_1038109023300025904Corn RhizosphereEEANNRGGEDNITVVLARFLGEDLGLPTNDKITIELPPLEEDKTLDDNYEADTEPQGS
Ga0207643_1004600913300025908Miscanthus RhizosphereTVVLAQFSGDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ
Ga0207643_1083711723300025908Miscanthus RhizosphereVVARFSGDDLEEAQSDRITIELPPMEEDKTLDDTYEADTEPR
Ga0207695_1174522523300025913Corn RhizosphereAEANNRGGEDNITVVLARFTDDELRDPNDDRITVELPPLEEDRTLDETEADTQHE
Ga0207649_1145417513300025920Corn RhizosphereEDNITVVLARFSGEDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH
Ga0207646_1067262233300025922Corn, Switchgrass And Miscanthus RhizosphereRGGEDNITVVLARFLGDDLEEPVSDRITIELPALEEDKTLEDTFEPDTEPH
Ga0207681_1058358613300025923Switchgrass RhizosphereFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH
Ga0207681_1185159123300025923Switchgrass RhizosphereARFDGDDLEAPSTERITIELPPLEEDKTLDDNYEADTEPH
Ga0207650_1146828413300025925Switchgrass RhizosphereLARFTGDELEEPTTDRITVELPPMQEEDKTLDDTYSPDTDPQ
Ga0207701_1041283233300025930Corn, Switchgrass And Miscanthus RhizosphereYRGGEDNITVVVARFDGDDLEAPATDRITIELPPLEEDKTLDDNYEADTEPH
Ga0207706_1115962823300025933Corn RhizosphereGEDNITVVLAHFSGDDLEEAASDRITIELPPLEEDKTLDDTYEADTEPQ
Ga0207670_1098777913300025936Switchgrass RhizosphereGGEDNITVVLARFLGDDLDEPSTDRITIELPPLEEDKTLDDNYEADTEPH
Ga0207665_1151547913300025939Corn, Switchgrass And Miscanthus RhizosphereTVILARFTGDELEEPASDRITIELPPLEEDMTLDDSYESDTEPR
Ga0207711_1050311813300025941Switchgrass RhizosphereVVIARFSGSDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH
Ga0207679_1184480923300025945Corn RhizosphereVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH
Ga0207679_1197837923300025945Corn RhizosphereNRGGEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPR
Ga0207640_1173625613300025981Corn RhizosphereDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH
Ga0207658_1149737123300025986Switchgrass RhizosphereANNRGGEDNITVILARFSGDELQEPATDRITIELPALTEEDKTLDDTYDPDTEPR
Ga0207703_1031580113300026035Switchgrass RhizosphereGGEGNITVVLARFLGDDLDEPSTDRITIELPPLEEDKTLDDSYEADTEPQH
Ga0207639_1056612023300026041Corn RhizosphereLARFSGDDLDAPSTDRITIELPPLEEDKTLDDTYEADTEPH
Ga0207676_1139067413300026095Switchgrass RhizosphereNNRGGEDNITVVLARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH
Ga0207676_1206226813300026095Switchgrass RhizosphereANNRGGEDNITVILARFSGDELEEPSADKITIELPLLEEDKTLDDTYDPDTEPR
Ga0207674_1007622413300026116Corn RhizosphereARFSGDDLEAPSTDRITIELPPLEEDKTLDDTYEADTEPH
Ga0207698_1197791713300026142Corn RhizosphereNNRGGEDNITVILARFSGDELEEPDTDRITIELPPLEEDMTLDDNYEPDTEPR
Ga0209438_103493433300026285Grasslands SoilVLARFLGDDLEAPSTERITIELPPLEEDKTLDDNYEADTEPQQ
Ga0209761_115823813300026313Grasslands SoilILARVDGDDLDEPTTDRITIELPALEEDKTLEDTFEPDTEPH
Ga0209689_135431223300027748SoilARFLGDDLEEPVSDRITIELPALEEDKTLEDTFEPDTEPH
Ga0209486_1121992513300027886Agricultural SoilEANNRGGEDNITVVLARFDGEDLEAPSTDRITIELPPLEEDKTLDDNYEADTEPH
Ga0209382_1119473013300027909Populus RhizosphereITVVLAQFSGDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ
Ga0268264_1252348923300028381Switchgrass RhizosphereGGEDNITVVLARFSGDDLEEPASDRITIELPPLEEDKTLDDTYEADTEPH
Ga0137415_1030367513300028536Vadose Zone SoilARFTGEELREASEDRITVELPPLEEDKTLDETEADTASH
Ga0307504_1041599023300028792SoilGEELEEPASDRITIELPPLEEDKTLDDNYESDTEPR
Ga0299913_1015540713300031229SoilDNITVVLARFDGEDLEEATSDRITIELPPLEDDKTLDDNFEADTEPH
Ga0310813_1096134623300031716SoilITVVLARFSGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH
Ga0307405_1048313113300031731RhizosphereNNRGGEDNITVVLARFQGEDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH
Ga0307468_10213909023300031740Hardwood Forest SoilNRGGEDNITVVLARFTGDELRDAKDDRITVELAPQEEDKTLDETEIDKPHDTPPL
Ga0307410_1136527313300031852RhizosphereAQFSGDDLEPAASDRITIELPPLEEDKTLDDTYEADTEPQ
Ga0307416_10120102213300032002RhizosphereFLGDDLEEPANDRVTIELPQLEEDKTLDDTYEADTEPQS
Ga0310897_1044287613300032003SoilITVVVARFDGDDLEAPTTDRITIELPPLEEDKTLDDNYEADTEPH
Ga0307414_1098936423300032004RhizosphereARFHGDDLEEPATDRITIELPPLEEDKTLDDNYEADTEPH
Ga0307411_1045389113300032005RhizosphereNITVVLARFDGDDLEAPSTDRITIELPPLEEDKTLDDNYEADTEPH
Ga0307415_10028697913300032126RhizosphereVVLARFSGGDLQEPASERITIELPPMEEDSTLGDTEPPTEPNPNN
Ga0307471_10341460723300032180Hardwood Forest SoilSGEGLRDPSNDRITIELPPLEEDKTLDETEADTQNPD
Ga0310810_1072776633300033412SoilITVVIARFFGDDLQEPASDRITIELPPLEEDKTLDDTYEADTEPH
Ga0310810_1078916433300033412SoilDNITVILARFSGDELEEPSADKITIELPLLEEDKTLDDTYDPDTEPR
Ga0310810_1140626123300033412SoilDLEEPSNDRITIELPPLEEDKTLDDTYDADTEPRI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.