


| Basic Information | |
|---|---|
| Family ID | F023290 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 210 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MFHLVEVLAASPVWLGLCGAGLTVAPIMGIMLIHRNK |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 210 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.50 % |
| % of genes near scaffold ends (potentially truncated) | 15.24 % |
| % of genes from short scaffolds (< 2000 bps) | 47.62 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (36.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.190 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 210 Family Scaffolds |
|---|---|---|
| PF02604 | PhdYeFM_antitox | 10.95 |
| PF01786 | AOX | 7.14 |
| PF16363 | GDP_Man_Dehyd | 6.67 |
| PF00210 | Ferritin | 5.24 |
| PF01370 | Epimerase | 3.81 |
| PF00393 | 6PGD | 3.33 |
| PF13640 | 2OG-FeII_Oxy_3 | 3.33 |
| PF00462 | Glutaredoxin | 2.38 |
| PF00565 | SNase | 1.90 |
| PF07484 | Collar | 1.43 |
| PF01844 | HNH | 1.43 |
| PF06210 | DUF1003 | 0.95 |
| PF04820 | Trp_halogenase | 0.95 |
| PF04966 | OprB | 0.95 |
| PF03407 | Nucleotid_trans | 0.95 |
| PF03016 | Exostosin | 0.95 |
| PF03446 | NAD_binding_2 | 0.95 |
| PF00386 | C1q | 0.48 |
| PF01041 | DegT_DnrJ_EryC1 | 0.48 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.48 |
| PF13186 | SPASM | 0.48 |
| PF02540 | NAD_synthase | 0.48 |
| PF05050 | Methyltransf_21 | 0.48 |
| PF03237 | Terminase_6N | 0.48 |
| PF00984 | UDPG_MGDP_dh | 0.48 |
| PF00111 | Fer2 | 0.48 |
| PF01467 | CTP_transf_like | 0.48 |
| PF00124 | Photo_RC | 0.48 |
| PF00268 | Ribonuc_red_sm | 0.48 |
| PF13884 | Peptidase_S74 | 0.48 |
| PF12849 | PBP_like_2 | 0.48 |
| PF08534 | Redoxin | 0.48 |
| PF02672 | CP12 | 0.48 |
| PF01531 | Glyco_transf_11 | 0.48 |
| PF00685 | Sulfotransfer_1 | 0.48 |
| PF02543 | Carbam_trans_N | 0.48 |
| PF16861 | Carbam_trans_C | 0.48 |
| PF03330 | DPBB_1 | 0.48 |
| PF03734 | YkuD | 0.48 |
| PF02562 | PhoH | 0.48 |
| PF14393 | DUF4422 | 0.48 |
| PF00149 | Metallophos | 0.48 |
| PF07728 | AAA_5 | 0.48 |
| PF03414 | Glyco_transf_6 | 0.48 |
| PF00127 | Copper-bind | 0.48 |
| COG ID | Name | Functional Category | % Frequency in 210 Family Scaffolds |
|---|---|---|---|
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 10.95 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 10.95 |
| COG0362 | 6-phosphogluconate dehydrogenase | Carbohydrate transport and metabolism [G] | 3.33 |
| COG1023 | 6-phosphogluconate dehydrogenase (decarboxylating) | Carbohydrate transport and metabolism [G] | 3.33 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.95 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.48 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.48 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.48 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.48 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.48 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.48 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.48 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.48 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.48 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.48 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.33 % |
| Unclassified | root | N/A | 36.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001846|ACM22_1136422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 571 | Open in IMG/M |
| 3300001847|RCM41_1134259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus | 706 | Open in IMG/M |
| 3300001968|GOS2236_1030255 | Not Available | 902 | Open in IMG/M |
| 3300001968|GOS2236_1083199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1536 | Open in IMG/M |
| 3300001968|GOS2236_1085633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 1644 | Open in IMG/M |
| 3300002040|GOScombined01_102474852 | All Organisms → Viruses → Predicted Viral | 2969 | Open in IMG/M |
| 3300002835|B570J40625_100000534 | Not Available | 64310 | Open in IMG/M |
| 3300002835|B570J40625_101215336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 630 | Open in IMG/M |
| 3300002835|B570J40625_101617495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Fibrella → unclassified Fibrella → Fibrella sp. ES10-3-2-2 | 529 | Open in IMG/M |
| 3300004240|Ga0007787_10154761 | Not Available | 1102 | Open in IMG/M |
| 3300004369|Ga0065726_13367 | Not Available | 20114 | Open in IMG/M |
| 3300005527|Ga0068876_10104998 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
| 3300005528|Ga0068872_10687997 | Not Available | 537 | Open in IMG/M |
| 3300005581|Ga0049081_10000664 | Not Available | 13066 | Open in IMG/M |
| 3300005805|Ga0079957_1017398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5132 | Open in IMG/M |
| 3300005805|Ga0079957_1107694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 1503 | Open in IMG/M |
| 3300005805|Ga0079957_1211491 | Not Available | 927 | Open in IMG/M |
| 3300005940|Ga0073913_10003649 | All Organisms → Viruses → Predicted Viral | 2035 | Open in IMG/M |
| 3300006026|Ga0075478_10000152 | Not Available | 24206 | Open in IMG/M |
| 3300006810|Ga0070754_10045564 | All Organisms → Viruses | 2348 | Open in IMG/M |
| 3300006875|Ga0075473_10181989 | Not Available | 847 | Open in IMG/M |
| 3300007538|Ga0099851_1039060 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
| 3300007541|Ga0099848_1012446 | All Organisms → Viruses → Predicted Viral | 3735 | Open in IMG/M |
| 3300007541|Ga0099848_1019539 | All Organisms → Viruses → Predicted Viral | 2903 | Open in IMG/M |
| 3300007541|Ga0099848_1049098 | All Organisms → Viruses → Predicted Viral | 1705 | Open in IMG/M |
| 3300007541|Ga0099848_1250819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3 | 619 | Open in IMG/M |
| 3300007541|Ga0099848_1282278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 574 | Open in IMG/M |
| 3300007545|Ga0102873_1233817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 551 | Open in IMG/M |
| 3300007551|Ga0102881_1173100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 597 | Open in IMG/M |
| 3300007634|Ga0102901_1178989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 599 | Open in IMG/M |
| 3300007735|Ga0104988_10472 | All Organisms → Viruses | 15845 | Open in IMG/M |
| 3300007960|Ga0099850_1064722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Eneladusvirus → Eneladusvirus BF | 1540 | Open in IMG/M |
| 3300008107|Ga0114340_1010907 | All Organisms → Viruses → Predicted Viral | 4514 | Open in IMG/M |
| 3300008108|Ga0114341_10135703 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
| 3300008113|Ga0114346_1002946 | Not Available | 12937 | Open in IMG/M |
| 3300008113|Ga0114346_1039642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2418 | Open in IMG/M |
| 3300008113|Ga0114346_1072500 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300008113|Ga0114346_1294764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → unclassified Bdellovibrionales → Bdellovibrionales bacterium GWB1_55_8 | 563 | Open in IMG/M |
| 3300008120|Ga0114355_1000762 | Not Available | 30681 | Open in IMG/M |
| 3300008262|Ga0114337_1011389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4 | 6542 | Open in IMG/M |
| 3300009009|Ga0105105_10001396 | Not Available | 10253 | Open in IMG/M |
| 3300009085|Ga0105103_10576391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 638 | Open in IMG/M |
| 3300009221|Ga0103849_1012670 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300009228|Ga0103854_1000442 | All Organisms → cellular organisms → Bacteria | 3185 | Open in IMG/M |
| 3300009230|Ga0103855_10001153 | All Organisms → cellular organisms → Bacteria | 3281 | Open in IMG/M |
| 3300009466|Ga0126448_1000618 | Not Available | 10669 | Open in IMG/M |
| 3300009470|Ga0126447_1101747 | Not Available | 701 | Open in IMG/M |
| 3300010293|Ga0116204_1049050 | All Organisms → Viruses → Predicted Viral | 1577 | Open in IMG/M |
| 3300010296|Ga0129348_1334700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3 | 503 | Open in IMG/M |
| 3300010318|Ga0136656_1027503 | All Organisms → Viruses → Predicted Viral | 2066 | Open in IMG/M |
| 3300010354|Ga0129333_10002085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 18502 | Open in IMG/M |
| 3300010354|Ga0129333_10002162 | All Organisms → Viruses | 18183 | Open in IMG/M |
| 3300010354|Ga0129333_10008058 | All Organisms → cellular organisms → Bacteria | 9931 | Open in IMG/M |
| 3300010354|Ga0129333_10009821 | Not Available | 9038 | Open in IMG/M |
| 3300010354|Ga0129333_10019130 | Not Available | 6515 | Open in IMG/M |
| 3300010354|Ga0129333_10033375 | Not Available | 4861 | Open in IMG/M |
| 3300010354|Ga0129333_10055574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 3699 | Open in IMG/M |
| 3300010354|Ga0129333_10061226 | All Organisms → Viruses → Predicted Viral | 3508 | Open in IMG/M |
| 3300010354|Ga0129333_10104622 | All Organisms → Viruses → Predicted Viral | 2614 | Open in IMG/M |
| 3300010354|Ga0129333_10160809 | Not Available | 2058 | Open in IMG/M |
| 3300010354|Ga0129333_10238297 | All Organisms → Viruses → Predicted Viral | 1644 | Open in IMG/M |
| 3300010354|Ga0129333_10357771 | Not Available | 1298 | Open in IMG/M |
| 3300010354|Ga0129333_10378475 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300010354|Ga0129333_10477909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 1095 | Open in IMG/M |
| 3300010354|Ga0129333_10489525 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300010354|Ga0129333_10635277 | Not Available | 923 | Open in IMG/M |
| 3300010354|Ga0129333_10690659 | Not Available | 878 | Open in IMG/M |
| 3300010354|Ga0129333_10912093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 743 | Open in IMG/M |
| 3300010354|Ga0129333_11154302 | Not Available | 645 | Open in IMG/M |
| 3300010354|Ga0129333_11619797 | Not Available | 528 | Open in IMG/M |
| 3300010354|Ga0129333_11663742 | Not Available | 520 | Open in IMG/M |
| 3300010370|Ga0129336_10121567 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300010370|Ga0129336_10323020 | Not Available | 854 | Open in IMG/M |
| 3300010389|Ga0136549_10023776 | All Organisms → Viruses → Predicted Viral | 3602 | Open in IMG/M |
| 3300010389|Ga0136549_10036251 | All Organisms → Viruses → Predicted Viral | 2693 | Open in IMG/M |
| 3300012000|Ga0119951_1016127 | All Organisms → Viruses → Predicted Viral | 2816 | Open in IMG/M |
| 3300012000|Ga0119951_1045822 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10120746 | Not Available | 1477 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10145070 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10154129 | All Organisms → Viruses → Predicted Viral | 1512 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10439301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 789 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10083365 | All Organisms → Viruses → Predicted Viral | 2265 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10212839 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10012199 | Not Available | 10800 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10677620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn | 654 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10086859 | All Organisms → Viruses → Predicted Viral | 2281 | Open in IMG/M |
| 3300020074|Ga0194113_10002981 | Not Available | 22864 | Open in IMG/M |
| 3300020074|Ga0194113_10012454 | Not Available | 9974 | Open in IMG/M |
| 3300020074|Ga0194113_10028007 | Not Available | 5969 | Open in IMG/M |
| 3300020074|Ga0194113_10044362 | All Organisms → Viruses → Predicted Viral | 4403 | Open in IMG/M |
| 3300020074|Ga0194113_10125219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 2186 | Open in IMG/M |
| 3300020074|Ga0194113_10430177 | Not Available | 962 | Open in IMG/M |
| 3300020074|Ga0194113_10458746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 923 | Open in IMG/M |
| 3300020074|Ga0194113_10582674 | Not Available | 791 | Open in IMG/M |
| 3300020083|Ga0194111_10109308 | Not Available | 2198 | Open in IMG/M |
| 3300020083|Ga0194111_10609437 | Not Available | 683 | Open in IMG/M |
| 3300020084|Ga0194110_10196574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1526 | Open in IMG/M |
| 3300020109|Ga0194112_10004728 | Not Available | 18533 | Open in IMG/M |
| 3300020109|Ga0194112_10222250 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300020109|Ga0194112_10449263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 917 | Open in IMG/M |
| 3300020109|Ga0194112_10501460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn | 850 | Open in IMG/M |
| 3300020151|Ga0211736_10745845 | Not Available | 5109 | Open in IMG/M |
| 3300020151|Ga0211736_10980101 | All Organisms → Viruses → Predicted Viral | 2320 | Open in IMG/M |
| 3300020161|Ga0211726_10400216 | All Organisms → Viruses → Predicted Viral | 2523 | Open in IMG/M |
| 3300020179|Ga0194134_10065662 | All Organisms → Viruses → Predicted Viral | 1915 | Open in IMG/M |
| 3300020179|Ga0194134_10079724 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
| 3300020179|Ga0194134_10102160 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300020179|Ga0194134_10220557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 798 | Open in IMG/M |
| 3300020183|Ga0194115_10053102 | Not Available | 2544 | Open in IMG/M |
| 3300020183|Ga0194115_10058263 | All Organisms → Viruses → Predicted Viral | 2378 | Open in IMG/M |
| 3300020183|Ga0194115_10062680 | Not Available | 2256 | Open in IMG/M |
| 3300020183|Ga0194115_10074029 | All Organisms → Viruses → Predicted Viral | 2005 | Open in IMG/M |
| 3300020183|Ga0194115_10088469 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| 3300020183|Ga0194115_10125866 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300020183|Ga0194115_10152188 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300020183|Ga0194115_10177330 | Not Available | 1077 | Open in IMG/M |
| 3300020183|Ga0194115_10193938 | Not Available | 1009 | Open in IMG/M |
| 3300020183|Ga0194115_10250128 | Not Available | 838 | Open in IMG/M |
| 3300020183|Ga0194115_10268849 | Not Available | 795 | Open in IMG/M |
| 3300020183|Ga0194115_10345239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 660 | Open in IMG/M |
| 3300020183|Ga0194115_10369742 | Not Available | 627 | Open in IMG/M |
| 3300020190|Ga0194118_10070843 | All Organisms → Viruses → Predicted Viral | 2211 | Open in IMG/M |
| 3300020190|Ga0194118_10085923 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1958 | Open in IMG/M |
| 3300020190|Ga0194118_10178683 | Not Available | 1224 | Open in IMG/M |
| 3300020196|Ga0194124_10226082 | Not Available | 947 | Open in IMG/M |
| 3300020197|Ga0194128_10011606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 10178 | Open in IMG/M |
| 3300020204|Ga0194116_10076068 | All Organisms → Viruses → Predicted Viral | 2236 | Open in IMG/M |
| 3300020204|Ga0194116_10347787 | Not Available | 756 | Open in IMG/M |
| 3300020220|Ga0194119_10013912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 9950 | Open in IMG/M |
| 3300020220|Ga0194119_10108286 | Not Available | 2172 | Open in IMG/M |
| 3300020220|Ga0194119_10129989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 1909 | Open in IMG/M |
| 3300020220|Ga0194119_10641230 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 648 | Open in IMG/M |
| 3300020222|Ga0194125_10061886 | All Organisms → Viruses → Predicted Viral | 3468 | Open in IMG/M |
| 3300020222|Ga0194125_10092857 | Not Available | 2551 | Open in IMG/M |
| 3300020530|Ga0208235_1000049 | Not Available | 36399 | Open in IMG/M |
| 3300020578|Ga0194129_10281276 | Not Available | 946 | Open in IMG/M |
| 3300021091|Ga0194133_10003938 | Not Available | 20486 | Open in IMG/M |
| 3300021091|Ga0194133_10009380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 11210 | Open in IMG/M |
| 3300021091|Ga0194133_10099862 | All Organisms → Viruses → Predicted Viral | 2231 | Open in IMG/M |
| 3300021091|Ga0194133_10127204 | All Organisms → Viruses → Predicted Viral | 1875 | Open in IMG/M |
| 3300021093|Ga0194123_10028489 | All Organisms → Viruses | 4098 | Open in IMG/M |
| 3300021376|Ga0194130_10025313 | All Organisms → cellular organisms → Bacteria | 4810 | Open in IMG/M |
| 3300021376|Ga0194130_10307523 | Not Available | 877 | Open in IMG/M |
| 3300021376|Ga0194130_10671054 | Not Available | 505 | Open in IMG/M |
| 3300021961|Ga0222714_10224703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Vequintavirinae → Vequintavirus → unclassified Vequintavirus → Escherichia phage navn | 1068 | Open in IMG/M |
| 3300021962|Ga0222713_10019298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5771 | Open in IMG/M |
| 3300021962|Ga0222713_10020050 | Not Available | 5643 | Open in IMG/M |
| 3300021962|Ga0222713_10043883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 3472 | Open in IMG/M |
| 3300021962|Ga0222713_10117865 | All Organisms → Viruses | 1875 | Open in IMG/M |
| 3300021963|Ga0222712_10060167 | All Organisms → Viruses → Predicted Viral | 2790 | Open in IMG/M |
| 3300021963|Ga0222712_10083856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2271 | Open in IMG/M |
| 3300021963|Ga0222712_10783325 | Not Available | 527 | Open in IMG/M |
| 3300022198|Ga0196905_1002107 | Not Available | 7487 | Open in IMG/M |
| 3300022198|Ga0196905_1003344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 5883 | Open in IMG/M |
| 3300022198|Ga0196905_1013213 | All Organisms → Viruses | 2685 | Open in IMG/M |
| 3300022198|Ga0196905_1014591 | All Organisms → Viruses | 2537 | Open in IMG/M |
| 3300022200|Ga0196901_1022659 | All Organisms → Viruses → Predicted Viral | 2516 | Open in IMG/M |
| 3300022200|Ga0196901_1058148 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300022752|Ga0214917_10027494 | All Organisms → Viruses → Predicted Viral | 4387 | Open in IMG/M |
| 3300022752|Ga0214917_10357110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3 | 622 | Open in IMG/M |
| 3300024239|Ga0247724_1000383 | All Organisms → cellular organisms → Bacteria | 10566 | Open in IMG/M |
| 3300024239|Ga0247724_1001101 | Not Available | 5427 | Open in IMG/M |
| 3300024343|Ga0244777_10386553 | All Organisms → Viruses | 873 | Open in IMG/M |
| 3300024348|Ga0244776_10101317 | Not Available | 2153 | Open in IMG/M |
| 3300024348|Ga0244776_10230987 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300025610|Ga0208149_1000506 | Not Available | 14985 | Open in IMG/M |
| 3300025646|Ga0208161_1001295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13433 | Open in IMG/M |
| 3300027499|Ga0208788_1010438 | All Organisms → Viruses → Predicted Viral | 3401 | Open in IMG/M |
| 3300027608|Ga0208974_1027384 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300027762|Ga0209288_10000010 | All Organisms → Viruses | 71431 | Open in IMG/M |
| 3300027793|Ga0209972_10437926 | Not Available | 548 | Open in IMG/M |
| 3300027816|Ga0209990_10002115 | Not Available | 15908 | Open in IMG/M |
| 3300029930|Ga0119944_1000634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6265 | Open in IMG/M |
| 3300029930|Ga0119944_1001772 | All Organisms → Viruses → Predicted Viral | 3793 | Open in IMG/M |
| 3300029930|Ga0119944_1002773 | All Organisms → Viruses → Predicted Viral | 2978 | Open in IMG/M |
| 3300029930|Ga0119944_1004485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2281 | Open in IMG/M |
| 3300029930|Ga0119944_1008411 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300029930|Ga0119944_1012752 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300029930|Ga0119944_1015775 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300029930|Ga0119944_1018829 | Not Available | 954 | Open in IMG/M |
| 3300029933|Ga0119945_1003240 | All Organisms → Viruses → Predicted Viral | 2340 | Open in IMG/M |
| 3300029933|Ga0119945_1020905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 781 | Open in IMG/M |
| 3300031784|Ga0315899_10164311 | All Organisms → Viruses → Predicted Viral | 2257 | Open in IMG/M |
| 3300031787|Ga0315900_10042212 | All Organisms → Viruses → Predicted Viral | 4913 | Open in IMG/M |
| 3300031857|Ga0315909_10934653 | Not Available | 531 | Open in IMG/M |
| 3300032093|Ga0315902_10008890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13532 | Open in IMG/M |
| 3300032093|Ga0315902_10238172 | All Organisms → Viruses → Predicted Viral | 1783 | Open in IMG/M |
| 3300032093|Ga0315902_10311326 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300033521|Ga0316616_104150012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 545 | Open in IMG/M |
| 3300033557|Ga0316617_100099409 | All Organisms → Viruses → Predicted Viral | 2046 | Open in IMG/M |
| 3300033978|Ga0334977_0053957 | All Organisms → Viruses → Predicted Viral | 2229 | Open in IMG/M |
| 3300033981|Ga0334982_0134662 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300034071|Ga0335028_0547031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 632 | Open in IMG/M |
| 3300034073|Ga0310130_0001202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14783 | Open in IMG/M |
| 3300034073|Ga0310130_0015041 | All Organisms → Viruses → Predicted Viral | 2571 | Open in IMG/M |
| 3300034102|Ga0335029_0000628 | Not Available | 28224 | Open in IMG/M |
| 3300034103|Ga0335030_0005077 | Not Available | 10202 | Open in IMG/M |
| 3300034106|Ga0335036_0001516 | Not Available | 20538 | Open in IMG/M |
| 3300034112|Ga0335066_0000153 | Not Available | 45427 | Open in IMG/M |
| 3300034283|Ga0335007_0045618 | All Organisms → Viruses → Predicted Viral | 3395 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 28.57% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 11.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.10% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 4.76% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.86% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.90% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.90% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.43% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.43% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.43% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.95% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.95% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.95% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.95% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.48% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.48% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.48% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.48% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.48% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.48% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009221 | Microbial communities of water from Amazon river, Brazil - RCM2 | Environmental | Open in IMG/M |
| 3300009228 | Microbial communities of water from Amazon river, Brazil - RCM7 | Environmental | Open in IMG/M |
| 3300009230 | Microbial communities of water from Amazon river, Brazil - RCM8 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACM22_11364221 | 3300001846 | Marine Plankton | MIFHIVEALAKSQIWLGMCGFGLIIAPIIGIQLIHNNK* |
| RCM41_11342591 | 3300001847 | Marine Plankton | MLNHLVEALAASQIWLGLCGFGIIILPVIGIWAIHK |
| GOS2236_10302553 | 3300001968 | Marine | MFHLVETLAGSQIWIGLCGFGIIVLPILGIMFIHDKK* |
| GOS2236_10831996 | 3300001968 | Marine | MIFHIVEALAASPVWLGLCGGGLIIPPIIGIMLIHRSPKNNN* |
| GOS2236_10856335 | 3300001968 | Marine | MFHLVEVLAASPIWLGACGFGIIVLPIMGIAFIHNTKEKT* |
| GOScombined01_1024748522 | 3300002040 | Marine | MNMLFHLVEFLAGSKIWLGLCGFGVIVVPIMGIQYIYNKHKNDT* |
| B570J40625_10000053472 | 3300002835 | Freshwater | MIFHIVEYLAQSPVWLGLCGAGLTVAPIMGIMLIHKQNGK* |
| B570J40625_1012153362 | 3300002835 | Freshwater | MIFHIVETLAESPIWLGACGFGIIVVPIMGIAFIHNKIK* |
| B570J40625_1016174951 | 3300002835 | Freshwater | ICKMIFHIVEYLAHSPVWLFICGMGLTTVPIMGIMFIHRTK* |
| Ga0007787_101547614 | 3300004240 | Freshwater Lake | MFHLVEVLAASPIWIGACGFGIIVLPIMGIAFIHNKEKKQS* |
| Ga0065726_1336715 | 3300004369 | Saline | MIFHIVEALASSPIWIGMCGFGLIFVPILGIAFIHNKEKQEKKD* |
| Ga0068876_101049983 | 3300005527 | Freshwater Lake | MIFHIVEALADSPIWLGLCGAGLTIAPIIGIMIIHRSPKK* |
| Ga0068872_106879972 | 3300005528 | Freshwater Lake | MTFFQVIEFLAASPIWLGLCGFGIIVVPILGIMVIHNNNH* |
| Ga0049081_1000066420 | 3300005581 | Freshwater Lentic | MFHLVEVLAASQLWLGLCGAGLTVAPILGIMLIHRTK* |
| Ga0049081_100964565 | 3300005581 | Freshwater Lentic | MFHLVEALAASQIWLGLCGMGLTIIPILGIIAVHSKKDNGA* |
| Ga0079957_10173989 | 3300005805 | Lake | MIFHIVEALAASPIWIGLCGAGLTIAPIMGIMLIHRTK* |
| Ga0079957_11076943 | 3300005805 | Lake | MIFHLVETLAASPVWLGLCGFGIIVVPIIGISFIHSNKK* |
| Ga0079957_12114912 | 3300005805 | Lake | MIFRIVEALASSQIWIGLCGFGLIFVPILGIAFIHNKEKQEKKD* |
| Ga0073913_100036493 | 3300005940 | Sand | MLHLVEVLASNPAWIGLCGGGLIIPPIIGIMLIHHNK* |
| Ga0075478_1000015211 | 3300006026 | Aqueous | MIFHIVETLASSPLWIGLCGAGLTLIPFCGIAYIHNKKN* |
| Ga0070754_100455644 | 3300006810 | Aqueous | MIFHIVETLATSPVWLGICGGGLIIPPIIGIMLTHRNK* |
| Ga0075473_101819894 | 3300006875 | Aqueous | MKPIFHLVELLASSPLWIGLCGFGIIIIPILGIQLVHKNK* |
| Ga0099851_10390602 | 3300007538 | Aqueous | MIFHVVETLANSPLWLGLCGFGIIVVPIMGISYIHNNKK* |
| Ga0099848_10124467 | 3300007541 | Aqueous | MIFHIVEYLAQSPVWLFICGMGLTVVPFMGIMLIHKSPKK* |
| Ga0099848_10195392 | 3300007541 | Aqueous | MIFHIVETLAASPLWLGLCGFGIIVIPILGIMIIHNNK* |
| Ga0099848_10490982 | 3300007541 | Aqueous | MIFHIVETLANSPIWLGLCGFGVIVVPIMGISYIHNNKK* |
| Ga0099848_12508193 | 3300007541 | Aqueous | FHIVETLAASPVWLGICGGGLIIPPIIGIMLIHRDK* |
| Ga0099848_12822783 | 3300007541 | Aqueous | MFHLVEVLAGSPIWLGLCGFGVIVLPIIGIQYIHNKHENGK* |
| Ga0102873_12338172 | 3300007545 | Estuarine | MIFNIVETLAASPIWLGLCGFGIIVVPIMGIAYIHKEK* |
| Ga0102881_11731002 | 3300007551 | Estuarine | MIFNIVETLAASPIWLGLCGFGIIVVSIMGIAFIHNIDKK* |
| Ga0102901_11789892 | 3300007634 | Estuarine | MIFNIVETLAASPIWLGLCGFGVIVVPIMGIAFIHNIEKK* |
| Ga0104988_1047210 | 3300007735 | Freshwater | MIFHIVETLASSPIWLGLCGGGLIIPPIIGIMLIHRSSKNNN* |
| Ga0099850_10647224 | 3300007960 | Aqueous | MIFHIVETLAASPVWLFICGMGLTVVPFMGIMLIHKQKGK* |
| Ga0114340_10109072 | 3300008107 | Freshwater, Plankton | MIFHLVEVLAASPVWLGVCGAGLTVAPIMGIMLIHRTK* |
| Ga0114341_101357035 | 3300008108 | Freshwater, Plankton | MFHLVEVLAASPIWIGACGFGIIVLPIMGIAFIHNKEKI* |
| Ga0114346_100294627 | 3300008113 | Freshwater, Plankton | MIFHIVETLAASPIWLGLCGAGLTIAPIMGIMLIHRTK* |
| Ga0114346_10396423 | 3300008113 | Freshwater, Plankton | MIFHIVETLAASPVWLGLCGGGLIILPIMGIIYIHDK* |
| Ga0114346_10725004 | 3300008113 | Freshwater, Plankton | MIFHIVEVLAASPVWLGLCGAGLTVAPIMGIMLIHRNK* |
| Ga0114346_12947642 | 3300008113 | Freshwater, Plankton | MLDKMFHLVEFLAASPIWIGLCGFGIIIVPIIGIDYIHRRNKT* |
| Ga0114355_100076227 | 3300008120 | Freshwater, Plankton | MFHLVEVLAASPVWLGLCGAGLTIAPIMGIMLIHRNK* |
| Ga0114337_10113896 | 3300008262 | Freshwater, Plankton | MLTLVEHLASSPIWLGLCGFGIIVLPIIGIQYIHKDK* |
| Ga0105105_1000139613 | 3300009009 | Freshwater Sediment | MIFHTVEALAASPIWIGLCGFGIIVVPIIGIAYIHKK* |
| Ga0105103_105763913 | 3300009085 | Freshwater Sediment | MIFHIVETLAKSPVWLGLCGFGIIVVPILGISYIHNEDKK* |
| Ga0105102_107958631 | 3300009165 | Freshwater Sediment | NIIFTLVEFLAESKIWIALCGFGLTIVPILGIMYVHSDKK* |
| Ga0103849_10126701 | 3300009221 | River Water | IMLFKIVEYLASNKIWLGLCGFGITIIPIMGIQYIHHKK* |
| Ga0103854_10004422 | 3300009228 | River Water | MLFKIVEYLASNKIWLGLCGFGITIIPIMGIQYIHRKK* |
| Ga0103855_100011538 | 3300009230 | River Water | MLFKIVEYLASNKIWLGLCGFGITIIPIMGIQYIHHKK* |
| Ga0126448_10006187 | 3300009466 | Meromictic Pond | MIFHIVETLANSTIWLGLCGFGLIIVPIIGISFIHSNKK* |
| Ga0126447_11017472 | 3300009470 | Meromictic Pond | MIFHIVETLAASPIWLGLCGFGIIVVPIFGIMVIHNRKGGPL* |
| Ga0116204_10490506 | 3300010293 | Anoxic Lake Water | MFHLIEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTDGV* |
| Ga0129348_13347002 | 3300010296 | Freshwater To Marine Saline Gradient | HIVERLAESPIWLGLMGGGLIIPPIIGIMLIHRNK* |
| Ga0136656_10275035 | 3300010318 | Freshwater To Marine Saline Gradient | MIFHIVETLAASPVWLGICGGGLIIPPIIGIMLIHRNK* |
| Ga0129333_1000208534 | 3300010354 | Freshwater To Marine Saline Gradient | MFHLVEILASSPIWLGLCGFGIIVLPIMGIQYIHRQK* |
| Ga0129333_1000216212 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHIVETLASSPVWLGLCGAGLTIAPIMGIMLIHRTK* |
| Ga0129333_1000805815 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHIVEALASSPIWLGLCGFGKIVIPIMGIAFIHNDINKK* |
| Ga0129333_100098214 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHIVEALAASPIWLGLCGGGLIIPPVIGIILIHNSFKS* |
| Ga0129333_100191306 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHIVEALAASQLWLGLCGFGIIVVPILGISFIHNIKDKK* |
| Ga0129333_1003337510 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHVVEALASSPIWLGLCGFGIIVVPIMGIAYIHKENKE* |
| Ga0129333_100555749 | 3300010354 | Freshwater To Marine Saline Gradient | MFKLVETLANSPVWLGLCGFGVIVLPIMGIQYIHRNK* |
| Ga0129333_100612267 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHIVETLANSPIWLGLCGMGLTVVPFIGIMLIHRNK* |
| Ga0129333_101046225 | 3300010354 | Freshwater To Marine Saline Gradient | MFHLVEVLAASKLWLGACGFGIIVLPIMGIAYIHKNKV* |
| Ga0129333_101608092 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHITEALAASPIWLGLCGFGIIVVPIMGIAFIHNNIK* |
| Ga0129333_102382977 | 3300010354 | Freshwater To Marine Saline Gradient | MFHLVEVLAASPIWIGLCGFGIICVPIIGIAFIHNKELDKNKK* |
| Ga0129333_103577712 | 3300010354 | Freshwater To Marine Saline Gradient | MIKLVEFLADSPIWLGFCGFGIIVLPIMGIQYIHNKKDAK* |
| Ga0129333_103784752 | 3300010354 | Freshwater To Marine Saline Gradient | MFHLVEVLAGSPIWLGACGFGVIVLPIMGIQYIHNKHHDT* |
| Ga0129333_104779094 | 3300010354 | Freshwater To Marine Saline Gradient | MFHLVEVLAASPIWLGACGFGLIVLPIMGIAFIHNKEQINRKE* |
| Ga0129333_104895253 | 3300010354 | Freshwater To Marine Saline Gradient | MFHLVEVLAGSPIWLGLCGFGVIVLPIMGIQYIHNKHENGK* |
| Ga0129333_106352771 | 3300010354 | Freshwater To Marine Saline Gradient | RISTMIFHTVEALAASPVWLGLCGFGIIVVPIMGIAYIHNRR* |
| Ga0129333_106906592 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHMVEILAASPIWLGLCGFGIVVVPIMGIAYIHKEK* |
| Ga0129333_109120932 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHVVETLASSKIWLGLCGFGIIVVPIMGISYIHSTDKNR* |
| Ga0129333_111543022 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHIVETLAASPIWLGICGFGIIVVPIMGISFIHKK* |
| Ga0129333_116197972 | 3300010354 | Freshwater To Marine Saline Gradient | MIFHIVEALAASPIWLGLCGFGIIVLPIMGIAFIHNIDKK* |
| Ga0129333_116637421 | 3300010354 | Freshwater To Marine Saline Gradient | IVEVLAASPVWLGLCGAGLTIVPIIGIMVIHNKDNGV* |
| Ga0129336_101215674 | 3300010370 | Freshwater To Marine Saline Gradient | MIFHIVEALAASPIWLGLCGFGIIVLPIIGIAFIHNIDKK* |
| Ga0129336_103230201 | 3300010370 | Freshwater To Marine Saline Gradient | MIFHIVEALASSPIWLGLCGFGIIVIPIMGIAFIHNDINKK* |
| Ga0136549_100237762 | 3300010389 | Marine Methane Seep Sediment | MIFHIVETLAASPIWLGLCGFGIIVVPILGIMIIHNNK* |
| Ga0136549_100362518 | 3300010389 | Marine Methane Seep Sediment | MIFHIVETLAASPVWLGICGMGLTVVPFMGIMLIHKQKGK* |
| Ga0119951_10161277 | 3300012000 | Freshwater | MIFDIVEKLAHNPIWIGLCGGGLIIPPIIGIMLIHRTK* |
| Ga0119951_10458222 | 3300012000 | Freshwater | MFRLVEFLADSPIWLGLCGFGIIVLPIMGIQYIHNKDNAK* |
| (restricted) Ga0172368_101207466 | 3300013123 | Freshwater | FHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK* |
| (restricted) Ga0172369_101450702 | 3300013125 | Freshwater | MFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK* |
| (restricted) Ga0172367_101541297 | 3300013126 | Freshwater | HLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK* |
| (restricted) Ga0172366_104393012 | 3300013128 | Sediment | MIFHIVETLAASPVWLGLCGGGLIIPPIIGIMLIHRN |
| (restricted) Ga0172363_100833656 | 3300013130 | Sediment | MIFHIVETLAASPVWLGLCGGGLIIPPIIGIMLIHRNK* |
| (restricted) Ga0172373_102128395 | 3300013131 | Freshwater | MFHLVEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK* |
| (restricted) Ga0172372_100121991 | 3300013132 | Freshwater | LEGILMFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK* |
| (restricted) Ga0172372_106776201 | 3300013132 | Freshwater | LEGILMFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQTK* |
| (restricted) Ga0172370_100868596 | 3300013136 | Freshwater | MFHLIEALAGSPIWLGLCGAGLTIAPIIGIMITHQNK* |
| Ga0177922_103529663 | 3300013372 | Freshwater | MFHLVEALAASKIWLGLCGMGLTIVPILGIIAVHSKKDNGA* |
| Ga0194113_1000298118 | 3300020074 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPIMGIMLIHQTK |
| Ga0194113_1001245422 | 3300020074 | Freshwater Lake | MFHLVEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0194113_100280072 | 3300020074 | Freshwater Lake | MMFHFVEVLAGSKIWLGLCGFGVIVLPIVGIQYIHNKHDAK |
| Ga0194113_1004436210 | 3300020074 | Freshwater Lake | MFHLIEALAGSPVWLGLCGAGLTIAPIIGIMVTHQNK |
| Ga0194113_100867353 | 3300020074 | Freshwater Lake | MIFHVVETLANNPIWLGLCGMGLTIIPIIGIMAVHNKK |
| Ga0194113_101252195 | 3300020074 | Freshwater Lake | MLHLIEVLAASPIWLGLCGFGVIVLPIVGIQYIHNKKDAK |
| Ga0194113_104301772 | 3300020074 | Freshwater Lake | MFHLIEVLASSPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0194113_104587461 | 3300020074 | Freshwater Lake | MFHFVEVLAGSKIWLGLCGFGVIVLPIMGIQYIHNKHDA |
| Ga0194113_105826744 | 3300020074 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTDGV |
| Ga0194111_101093089 | 3300020083 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0194111_102264095 | 3300020083 | Freshwater Lake | MIFHAVETLANNPIWLGLCGMGLTIIPIIGIMTVHNKK |
| Ga0194111_106094371 | 3300020083 | Freshwater Lake | MFHFVEVLAGSKIWLGLCGFGVIVLPIMGIQYIHNKHDAK |
| Ga0194110_1003719612 | 3300020084 | Freshwater Lake | MIFHVVETLANNPIWLGLCGMGLTIIPIIGIMTVHNKK |
| Ga0194110_101965742 | 3300020084 | Freshwater Lake | MFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0194112_1000472830 | 3300020109 | Freshwater Lake | LEGILMFHLIEVLAASPVWLGLCGAGLTVAPIMGIMLIHQTK |
| Ga0194112_102222507 | 3300020109 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPIMGIMLIHQT |
| Ga0194112_104492633 | 3300020109 | Freshwater Lake | MFHFVEVLAGSKIWLGLCGFGVIVLPIMGIQYIHNKH |
| Ga0194112_105014601 | 3300020109 | Freshwater Lake | EGILMFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0211736_107458452 | 3300020151 | Freshwater | MIFHLVETLAASPVWLGLCGGGLIILPIMGIMYIHDK |
| Ga0211736_109801016 | 3300020151 | Freshwater | MIFHIVEGLAASPVWLGLCGAGLTVAPIMGIMLIHRTK |
| Ga0211726_104002166 | 3300020161 | Freshwater | MLHLVEVLATSPIWLGACGFGIIVLPIMGIAFIHKDK |
| Ga0194134_100656622 | 3300020179 | Freshwater Lake | MFHLIEVLASSPIWLGLCGAGLTVAPIIGIMITHQNK |
| Ga0194134_100797245 | 3300020179 | Freshwater Lake | MFHLIEVLAASPVWIGLCGAGLTVAPILGIMYTHSKTDGV |
| Ga0194134_101021601 | 3300020179 | Freshwater Lake | HLIEVLAASPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0194134_102205573 | 3300020179 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPILGIMYTHS |
| Ga0194115_100531027 | 3300020183 | Freshwater Lake | MFHLIEVLASSPVWLGLCGAGLTVAPIIGIMITHQNK |
| Ga0194115_100582637 | 3300020183 | Freshwater Lake | MFHLIEVLASSPVWIGLCGGGLIIPPIIGIMITHQNK |
| Ga0194115_100626806 | 3300020183 | Freshwater Lake | MMLHIVEVLADSPLWIGLCGGALIIPPILGIMAVHRNK |
| Ga0194115_100740294 | 3300020183 | Freshwater Lake | MFHLIEVLASSPIWLGLCGAGLTVAPILGIMYTHSKTDGV |
| Ga0194115_100884693 | 3300020183 | Freshwater Lake | MFHLIEVLASSPVWLGLCGAGLTVAPILGIMYTHSKTDGV |
| Ga0194115_101258666 | 3300020183 | Freshwater Lake | MFHLIEALAGSPVWLGLCGAGLTVAPIIGIMITHSKTDGV |
| Ga0194115_101521884 | 3300020183 | Freshwater Lake | MFHLIEVLAASPIWLGLCGAGLTVAPILGIMYIHSKTDGV |
| Ga0194115_101773303 | 3300020183 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPIIGIMITHSKTDGV |
| Ga0194115_101939382 | 3300020183 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPILGIMYTHQNK |
| Ga0194115_102501282 | 3300020183 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPILGIMFTHSKTDGV |
| Ga0194115_102688494 | 3300020183 | Freshwater Lake | MFHFIEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTDGV |
| Ga0194115_103452391 | 3300020183 | Freshwater Lake | MFHLIEALAGSPVWLGLCGAGLTIAPIIGIMITHQ |
| Ga0194115_103697421 | 3300020183 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPILGIIYTHQNK |
| Ga0194118_100708433 | 3300020190 | Freshwater Lake | MFHLVETLAASPIWLGLCGFGIIVLPIIGIMFIHRKKSNDR |
| Ga0194118_100859235 | 3300020190 | Freshwater Lake | MFHLIEVLASSPVWLGLCGAGLTVAPILGIMYTHFGQKLTG |
| Ga0194118_101786835 | 3300020190 | Freshwater Lake | MFHLMEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTDGV |
| Ga0194124_101175271 | 3300020196 | Freshwater Lake | LEREMIFHAVETLANNPIWLGLCGMGLTIIPIIGIMAVHNKK |
| Ga0194124_102260826 | 3300020196 | Freshwater Lake | ILMFHLIEVLAASPVWLGLCGAGLTVAPIMGIMLIHQTK |
| Ga0194128_100116066 | 3300020197 | Freshwater Lake | MMFHFVEVLAGSKIWLGLCGFGVIVLPIVGIQYIYNKHDAK |
| Ga0194121_101008237 | 3300020200 | Freshwater Lake | MIFHAVETLANNPIWLGLCGMGLTIIPIIGIMAVHNKK |
| Ga0194116_100760682 | 3300020204 | Freshwater Lake | MFHLIEVLASSPVWIGFCGGGLIIPPIIGIMITHQNK |
| Ga0194116_103477871 | 3300020204 | Freshwater Lake | LMFHLIEALAGSPVWLGLCGAGLTVAPIIGIMITHSKTDGV |
| Ga0194119_100139121 | 3300020220 | Freshwater Lake | YDLMFHFVEVLAGSKIWLGLCGFGVIVLPIVGIQYIHNKHDAK |
| Ga0194119_101082861 | 3300020220 | Freshwater Lake | IEVLAASPVWLGLCGAGLTVAPILGIMYTHSKTNGV |
| Ga0194119_101299893 | 3300020220 | Freshwater Lake | MFQLIEVLASNPVWLGLCGAGLTVVPILGIMTVHSKNNGV |
| Ga0194119_106412303 | 3300020220 | Freshwater Lake | LIEVLASSPVWLGLCGAGLTVAPILGIMYTHFGQKLTG |
| Ga0194125_100618861 | 3300020222 | Freshwater Lake | FHLIEALAGSPVWLGLCGAGLTIAPIIGIMVTHQNK |
| Ga0194125_100928573 | 3300020222 | Freshwater Lake | MFHLIEALAGSPVWLGLCGAGLTVAPILGIMYTHSKTDGV |
| Ga0208235_100004944 | 3300020530 | Freshwater | MIFHIVEYLAQSPVWLGLCGAGLTVAPIMGIMLIHKQNGK |
| Ga0194129_102812762 | 3300020578 | Freshwater Lake | MFHLIEILAASPIWLGLCGAGLTVAPILGIMYTHSKTDGV |
| Ga0194133_100039389 | 3300021091 | Freshwater Lake | MIFHIVETLATSSVWLGLCGFGIIVVPILGIMIIHSKKSV |
| Ga0194133_100093803 | 3300021091 | Freshwater Lake | MFHFVEVLAGSKIWLGLCGFGVIVLPIVGIQYIYNKHDAK |
| Ga0194133_100998627 | 3300021091 | Freshwater Lake | MIFKIVEFLAESPVWLGLCAGGLIIPPIIGIMLIHRNK |
| Ga0194133_101200727 | 3300021091 | Freshwater Lake | MIFHVVETLANNSIWLGLCGMGLTIIPIIGIMAVHNKK |
| Ga0194133_101272042 | 3300021091 | Freshwater Lake | MFHLIEVLATSPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0194123_100284894 | 3300021093 | Freshwater Lake | MFHLIEALAASPVWLGLCGAGLTVAPIIGIMITHQNK |
| Ga0194130_100253132 | 3300021376 | Freshwater Lake | MFHFIEVLAASPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0194130_103075231 | 3300021376 | Freshwater Lake | GILMFHLIEVLASSPVWLGLCGAGLTIAPIIGIMITHQNK |
| Ga0194130_106710541 | 3300021376 | Freshwater Lake | MFHLIEVLAASPVWLGLCGAGLTVAPIIGIMITHQNK |
| Ga0222714_102247033 | 3300021961 | Estuarine Water | ERNMIFHIVEALAASQLWLGLCGFGVIVVPILGISFIHNTKDKK |
| Ga0222713_100192988 | 3300021962 | Estuarine Water | MIFHIVEALAASQLWLGLCGFGVIVVPILGISFIHNTKDKK |
| Ga0222713_100200503 | 3300021962 | Estuarine Water | MIFHIVETLAASPIWLGLCGAGLTIAPIMGIMLIHRTK |
| Ga0222713_100438838 | 3300021962 | Estuarine Water | MIFHIVETLAASPVWLGLCGGGLIIPPIIGIMLIHRTK |
| Ga0222713_101178652 | 3300021962 | Estuarine Water | MFHLVEVLASSPIWLGLCGAGLTVAPIMGIMYIHSKNNGA |
| Ga0222712_100601676 | 3300021963 | Estuarine Water | MIFHIVEALAASPIWLGLCGAGLTIAPIMGIMLIHRTK |
| Ga0222712_100838563 | 3300021963 | Estuarine Water | MFHLVETLAGSQIWIGLCGFGIIIMPILGIMFIHDKK |
| Ga0222712_107833252 | 3300021963 | Estuarine Water | MFHLVEVLAASQIWLGACGFGVIVLPIMGIQYIHNKNHDT |
| Ga0196905_100210713 | 3300022198 | Aqueous | MIFHIVETLAASPVWLGICGGGLIIPPIIGIMLIHRNK |
| Ga0196905_10033447 | 3300022198 | Aqueous | VIFHAVEALANSPLWLGLCGFGIIVVPIMGIAYIHKEK |
| Ga0196905_10132132 | 3300022198 | Aqueous | MIFHVVETLANSPLWLGLCGFGIIVVPIMGISYIHNNKK |
| Ga0196905_10145917 | 3300022198 | Aqueous | MIFHIVETLANSPIWLGLCGFGVIVVPIMGISYIHNNKK |
| Ga0196901_10121965 | 3300022200 | Aqueous | MILHFVETLANSPLWVGLCGFGLVVLPILGIMTVHNNVK |
| Ga0196901_10226596 | 3300022200 | Aqueous | MIFHIVETLAASPLWLGLCGFGIIVIPILGIMIIHNNK |
| Ga0196901_10581482 | 3300022200 | Aqueous | MIFHIVEYLAQSPVWLFICGMGLTVVPFMGIMLIHKSPKK |
| Ga0214917_1002749416 | 3300022752 | Freshwater | MFHLVEKLAHNSIWIGLMGGGLIIPPIIGIMFIHRNK |
| Ga0214917_103571101 | 3300022752 | Freshwater | TMIFDIVEKLAHNPIWIGLCGGGLIIPPIIGIMLIHRNK |
| Ga0247724_100038315 | 3300024239 | Deep Subsurface Sediment | MIFHIVETLAASPIWLGLCGFGIIVVPIMGISFIHNIDKK |
| Ga0247724_100110116 | 3300024239 | Deep Subsurface Sediment | MIFHIVETLAASPIWLGLCGFGIIVVPILGIMVIHSKKSI |
| Ga0244777_103865531 | 3300024343 | Estuarine | MIFNIVETLAASPIWLGLCGFGIIVVPIMGIAFIHNIDKK |
| Ga0244776_101013177 | 3300024348 | Estuarine | IVETLAASPIWLGLCGFGIIVVPIMGIAFIHNIDKK |
| Ga0244776_102309874 | 3300024348 | Estuarine | MIFNIVETLAASPIWLGLCGFGIIVVPIMGIAYIHKEK |
| Ga0208149_100050620 | 3300025610 | Aqueous | MIFHIVETLASSPLWIGLCGAGLTLIPFCGIAYIHNKKN |
| Ga0208161_10012953 | 3300025646 | Aqueous | MIFHIVETLAASPVWLFVCGMGLTVVPFMGIMLIHRNK |
| Ga0208788_10104386 | 3300027499 | Deep Subsurface | MIFHIVEYLAQSPVWLGLCGAGLTVAPIMGIMLIHRTK |
| Ga0208974_10273848 | 3300027608 | Freshwater Lentic | MFHLVEVLAASQLWLGLCGAGLTVAPILGIMLIHRTK |
| Ga0209288_1000001076 | 3300027762 | Freshwater Sediment | MIFHTVEALAASPIWIGLCGFGIIVVPIIGIAYIHKK |
| Ga0209972_104379261 | 3300027793 | Freshwater Lake | FFQVIEFLAASPIWLGLCGFGIIVVPILGIMVIHNNNH |
| Ga0209990_1000211511 | 3300027816 | Freshwater Lake | MIFHIVEALADSPIWLGLCGAGLTIAPIIGIMIIHRSPKK |
| Ga0119944_10006348 | 3300029930 | Aquatic | MFHLVEVLAASPIWLGACGFGVIVLPIMGIQYIHNKHHDT |
| Ga0119944_10017727 | 3300029930 | Aquatic | MFHLVEVLAASKLWLGACGFGIIVLPIMGIAFIHNTKEKT |
| Ga0119944_10027732 | 3300029930 | Aquatic | MFHLIEVLASNTVWLGLCGAGLTIVPIMGIMYVHRK |
| Ga0119944_10044859 | 3300029930 | Aquatic | MIFHIVEALAASPVWLGLCGAGLTIAPIMGIMFIHRTK |
| Ga0119944_10084113 | 3300029930 | Aquatic | VFHLVEVLAASPLWLGACGFGIIVLPIMGIAFIHNTKEKT |
| Ga0119944_10127523 | 3300029930 | Aquatic | MFHLVEVLAASPIWLGACGFGIIVLPIMGIAFIHNTKEKT |
| Ga0119944_10157754 | 3300029930 | Aquatic | MFHLVEVLAASPLWLGACGFGIIVLPIMGIAFIHNTKE |
| Ga0119944_10188295 | 3300029930 | Aquatic | MIFHLVEVLAASPIWLGACGFGIIVLPIMGIAFIHNTKEKT |
| Ga0119945_10032405 | 3300029933 | Aquatic | MFHLVEVLAASKIWLGACGFGIIVLPIMGIAFIHSTKE |
| Ga0119945_10209053 | 3300029933 | Aquatic | MFHLVEVLAASKIWLGACGFGIIVLPIMGIAFIHNKDKK |
| Ga0315899_101643116 | 3300031784 | Freshwater | MFHLVEVLAASPVWLGLCGAGLTIAPIMGIMLIHRNK |
| Ga0315900_1004221214 | 3300031787 | Freshwater | MIFHLVEVLAASPVWLGVCGAGLTVAPIMGIMLIHRTK |
| Ga0315909_109346532 | 3300031857 | Freshwater | MIFHVVETLAANPVWLGLCGGGLIIPPIIGIMLIHRSFKSNN |
| Ga0315902_1000889031 | 3300032093 | Freshwater | MIFHIVETLAASPIWLGLCGAGLTIAPIMGIMLIHRNK |
| Ga0315902_102381722 | 3300032093 | Freshwater | MTFFQVIEFLAASPIWLGLCGFGIIVVPILGIMVIHNNNH |
| Ga0315902_103113266 | 3300032093 | Freshwater | MIFHIVETLAASPVWLGLCGAGLTILPFMGIMLIHRTK |
| Ga0316616_1041500123 | 3300033521 | Soil | MIFHVVEALASSPIWLGLCGFGIIVVPIMGIAYIHKENKE |
| Ga0316617_1000994095 | 3300033557 | Soil | MIFHIVETLAASPVWLGLCGAGLTVAPIMGIMLIHRTK |
| Ga0334977_0053957_2035_2148 | 3300033978 | Freshwater | MFHLVEALAASQIWLGLCGMGLTILPIMGIMVVHKTK |
| Ga0334982_0134662_857_982 | 3300033981 | Freshwater | MFHLVEALAASPIWIGACGFGIIVLPIMGIAFIHNKEKNQS |
| Ga0335028_0547031_169_288 | 3300034071 | Freshwater | MIFHVVETLANSPIWLGLCGFGIVVVPIMGIAFIHNNIK |
| Ga0310130_0001202_13374_13496 | 3300034073 | Fracking Water | MIFHIVELLASNPVWIGLCGGGLIIPPIIGIMIIHNNKQK |
| Ga0310130_0015041_849_971 | 3300034073 | Fracking Water | MIFHIVETLAASPVWLGICGMGLTVVPFMGIMLIHKQKGK |
| Ga0335029_0000628_7554_7667 | 3300034102 | Freshwater | MFHLVEVLAASPVWLGLCGAGLTVAPIMGIMLIHRNK |
| Ga0335030_0005077_1403_1531 | 3300034103 | Freshwater | MIFHIVEALAASPIWLGLCGGGLIIPPIIGIMLIHRSSKNNN |
| Ga0335036_0001516_7201_7320 | 3300034106 | Freshwater | MIFHIVETLAESPIWLGACGFGIIVVPIMGIAFIHNKIK |
| Ga0335066_0000153_8680_8802 | 3300034112 | Freshwater | MFKLVESLANSPVWLGLCGFGVIVLPIMGIQYIHNKKNDT |
| Ga0335007_0045618_1662_1778 | 3300034283 | Freshwater | MIFHIVEALAASPVWLGLCGFGIIVVPIMGISYIHNIK |
| ⦗Top⦘ |