NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F023008

Metagenome Family F023008

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F023008
Family Type Metagenome
Number of Sequences 212
Average Sequence Length 39 residues
Representative Sequence LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Number of Associated Samples 132
Number of Associated Scaffolds 212

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.37 %
% of genes near scaffold ends (potentially truncated) 96.70 %
% of genes from short scaffolds (< 2000 bps) 84.91 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.547 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(41.509 % of family members)
Environment Ontology (ENVO) Unclassified
(46.698 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.811 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.28%    β-sheet: 0.00%    Coil/Unstructured: 56.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 212 Family Scaffolds
PF13561adh_short_C2 1.89
PF00106adh_short 1.89
PF00294PfkB 1.89
PF08028Acyl-CoA_dh_2 1.42
PF04748Polysacc_deac_2 1.42
PF07859Abhydrolase_3 1.42
PF09084NMT1 1.42
PF03401TctC 0.94
PF13565HTH_32 0.94
PF04199Cyclase 0.94
PF01040UbiA 0.94
PF01799Fer2_2 0.94
PF00459Inositol_P 0.94
PF00903Glyoxalase 0.94
PF02551Acyl_CoA_thio 0.94
PF03454MoeA_C 0.94
PF08592Anthrone_oxy 0.94
PF00753Lactamase_B 0.94
PF08240ADH_N 0.94
PF11953DUF3470 0.94
PF01734Patatin 0.94
PF00892EamA 0.94
PF04191PEMT 0.94
PF12860PAS_7 0.94
PF00083Sugar_tr 0.47
PF00941FAD_binding_5 0.47
PF03918CcmH 0.47
PF02515CoA_transf_3 0.47
PF00072Response_reg 0.47
PF05430Methyltransf_30 0.47
PF00206Lyase_1 0.47
PF00293NUDIX 0.47
PF07372DUF1491 0.47
PF00583Acetyltransf_1 0.47
PF12792CSS-motif 0.47
PF00334NDK 0.47
PF04434SWIM 0.47
PF13089PP_kinase_N 0.47
PF05199GMC_oxred_C 0.47
PF04290DctQ 0.47
PF12146Hydrolase_4 0.47
PF03738GSP_synth 0.47
PF00871Acetate_kinase 0.47
PF05930Phage_AlpA 0.47
PF07687M20_dimer 0.47
PF00227Proteasome 0.47
PF07883Cupin_2 0.47
PF04073tRNA_edit 0.47
PF07690MFS_1 0.47
PF07732Cu-oxidase_3 0.47
PF00543P-II 0.47
PF01790LGT 0.47
PF13527Acetyltransf_9 0.47
PF10755DUF2585 0.47
PF00496SBP_bac_5 0.47
PF04392ABC_sub_bind 0.47
PF00953Glycos_transf_4 0.47
PF04879Molybdop_Fe4S4 0.47
PF01042Ribonuc_L-PSP 0.47
PF15919HicB_lk_antitox 0.47
PF01575MaoC_dehydratas 0.47
PF13744HTH_37 0.47
PF06568DUF1127 0.47
PF00664ABC_membrane 0.47
PF12897Asp_aminotransf 0.47
PF00296Bac_luciferase 0.47
PF01261AP_endonuc_2 0.47
PF02738MoCoBD_1 0.47
PF07730HisKA_3 0.47
PF08386Abhydrolase_4 0.47
PF01047MarR 0.47
PF00015MCPsignal 0.47
PF09587PGA_cap 0.47
PF13419HAD_2 0.47
PF00501AMP-binding 0.47
PF00579tRNA-synt_1b 0.47
PF00873ACR_tran 0.47
PF01081Aldolase 0.47
PF00196GerE 0.47
PF13412HTH_24 0.47
PF02775TPP_enzyme_C 0.47
PF00155Aminotran_1_2 0.47
PF13525YfiO 0.47
PF01522Polysacc_deac_1 0.47
PF07264EI24 0.47
PF01494FAD_binding_3 0.47
PF03965Penicillinase_R 0.47
PF00762Ferrochelatase 0.47
PF13416SBP_bac_8 0.47
PF08883DOPA_dioxygen 0.47
PF04909Amidohydro_2 0.47
PF13358DDE_3 0.47
PF01872RibD_C 0.47
PF13417GST_N_3 0.47
PF00771FHIPEP 0.47
PF13193AMP-binding_C 0.47
PF01370Epimerase 0.47
PF03450CO_deh_flav_C 0.47
PF08843AbiEii 0.47
PF01126Heme_oxygenase 0.47
PF13847Methyltransf_31 0.47
PF00162PGK 0.47
PF00571CBS 0.47
PF13493DUF4118 0.47
PF01746tRNA_m1G_MT 0.47
PF04966OprB 0.47
PF01656CbiA 0.47
PF00596Aldolase_II 0.47
PF01339CheB_methylest 0.47
PF07238PilZ 0.47
PF02547Queuosine_synth 0.47
PF00271Helicase_C 0.47
PF00378ECH_1 0.47
PF12706Lactamase_B_2 0.47
PF02142MGS 0.47
PF09821AAA_assoc_C 0.47
PF07995GSDH 0.47
PF01612DNA_pol_A_exo1 0.47
PF13546DDE_5 0.47
PF00570HRDC 0.47
PF03741TerC 0.47
PF16861Carbam_trans_C 0.47
PF12840HTH_20 0.47
PF09594GT87 0.47
PF13505OMP_b-brl 0.47
PF12697Abhydrolase_6 0.47
PF01207Dus 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 212 Family Scaffolds
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 1.42
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.42
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.42
COG2861Uncharacterized conserved protein YibQ, putative polysaccharide deacetylase 2 familyCarbohydrate transport and metabolism [G] 1.42
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.42
COG0303Molybdopterin Mo-transferase (molybdopterin biosynthesis)Coenzyme transport and metabolism [H] 0.94
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.94
COG0840Methyl-accepting chemotaxis protein (MCP)Signal transduction mechanisms [T] 0.94
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.94
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.94
COG1946Acyl-CoA thioesteraseLipid transport and metabolism [I] 0.94
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 0.94
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.94
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.94
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.94
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.47
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 0.47
COG01263-phosphoglycerate kinaseCarbohydrate transport and metabolism [G] 0.47
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.47
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.47
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.47
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.47
COG0276Protoheme ferro-lyase (ferrochelatase)Coenzyme transport and metabolism [H] 0.47
COG0282Acetate kinaseEnergy production and conversion [C] 0.47
COG0347Nitrogen regulatory protein PIISignal transduction mechanisms [T] 0.47
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 0.47
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.47
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 0.47
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.47
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.47
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.47
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.47
COG0754Glutathionylspermidine synthase, CHAP domainAmino acid transport and metabolism [E] 0.47
COG08002-keto-3-deoxy-6-phosphogluconate aldolaseCarbohydrate transport and metabolism [G] 0.47
COG0809S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase)Translation, ribosomal structure and biogenesis [J] 0.47
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.47
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.47
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.47
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.47
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.47
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.47
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.47
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.47
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.47
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.47
COG3088Cytochrome c-type biogenesis protein CcmH/NrfFPosttranslational modification, protein turnover, chaperones [O] 0.47
COG3230Heme oxygenaseInorganic ion transport and metabolism [P] 0.47
COG3311DNA-binding transcriptional regulator AlpATranscription [K] 0.47
COG3426Butyrate kinaseEnergy production and conversion [C] 0.47
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 0.47
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 0.47
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.47
COG3805Aromatic ring-cleaving dioxygenaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.47
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.47
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.47
COG4121tRNA U34 5-methylaminomethyl-2-thiouridine-forming methyltransferase MnmCTranslation, ribosomal structure and biogenesis [J] 0.47
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.47
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.47
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.47
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.47
COG5398Heme oxygenaseCoenzyme transport and metabolism [H] 0.47
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 0.47
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 0.47
COG5447Uncharacterized conserved protein, DUF1491 domainFunction unknown [S] 0.47
COG5457Uncharacterized conserved protein YjiS, DUF1127 familyFunction unknown [S] 0.47

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.96 %
UnclassifiedrootN/A16.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918024|NODE_247811_length_1976_cov_8.525304All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium2026Open in IMG/M
3300000912|JGI12032J12867_1006625Not Available686Open in IMG/M
3300001661|JGI12053J15887_10013912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4447Open in IMG/M
3300001661|JGI12053J15887_10023702All Organisms → cellular organisms → Bacteria → Proteobacteria3437Open in IMG/M
3300001661|JGI12053J15887_10052121All Organisms → cellular organisms → Bacteria → Proteobacteria2286Open in IMG/M
3300001661|JGI12053J15887_10083683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1752Open in IMG/M
3300001661|JGI12053J15887_10136333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1301Open in IMG/M
3300001661|JGI12053J15887_10156428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1193Open in IMG/M
3300001661|JGI12053J15887_10478058Not Available595Open in IMG/M
3300001661|JGI12053J15887_10580415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300001661|JGI12053J15887_10587159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium530Open in IMG/M
3300001661|JGI12053J15887_10632884Not Available508Open in IMG/M
3300002245|JGIcombinedJ26739_101039467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales705Open in IMG/M
3300002568|C688J35102_120509130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1129Open in IMG/M
3300002886|JGI25612J43240_1009316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1428Open in IMG/M
3300002886|JGI25612J43240_1018569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum1028Open in IMG/M
3300002886|JGI25612J43240_1051695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis610Open in IMG/M
3300005176|Ga0066679_10441955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium851Open in IMG/M
3300005355|Ga0070671_100408163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1162Open in IMG/M
3300005578|Ga0068854_102039386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium529Open in IMG/M
3300005598|Ga0066706_10719948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.792Open in IMG/M
3300005660|Ga0073904_10061856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2354Open in IMG/M
3300005844|Ga0068862_101329463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium720Open in IMG/M
3300005994|Ga0066789_10003142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7234Open in IMG/M
3300006038|Ga0075365_10465884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium892Open in IMG/M
3300006047|Ga0075024_100012074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00693461Open in IMG/M
3300006047|Ga0075024_100907711All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300006050|Ga0075028_100056830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1897Open in IMG/M
3300006354|Ga0075021_11156465Not Available508Open in IMG/M
3300006800|Ga0066660_10347678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium1203Open in IMG/M
3300006864|Ga0066797_1004679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4451Open in IMG/M
3300006864|Ga0066797_1041659All Organisms → cellular organisms → Bacteria → Proteobacteria1616Open in IMG/M
3300006864|Ga0066797_1058097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1361Open in IMG/M
3300006864|Ga0066797_1067148All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300006949|Ga0075528_10094196Not Available786Open in IMG/M
3300006950|Ga0075524_10352322All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300006950|Ga0075524_10395768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha610Open in IMG/M
3300006950|Ga0075524_10445432Not Available573Open in IMG/M
3300007255|Ga0099791_10045738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1951Open in IMG/M
3300007255|Ga0099791_10057643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1745Open in IMG/M
3300007255|Ga0099791_10119808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1220Open in IMG/M
3300007255|Ga0099791_10411779All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300007258|Ga0099793_10009634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3698Open in IMG/M
3300007258|Ga0099793_10060972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens1686Open in IMG/M
3300007258|Ga0099793_10079600All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum1493Open in IMG/M
3300007258|Ga0099793_10129742All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas oryzae1184Open in IMG/M
3300007258|Ga0099793_10227081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria898Open in IMG/M
3300007265|Ga0099794_10032398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2454Open in IMG/M
3300007788|Ga0099795_10033397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1787Open in IMG/M
3300007788|Ga0099795_10107163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1103Open in IMG/M
3300007788|Ga0099795_10165141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae916Open in IMG/M
3300009038|Ga0099829_10304408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis1307Open in IMG/M
3300009143|Ga0099792_10288423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei970Open in IMG/M
3300009143|Ga0099792_10741156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis639Open in IMG/M
3300009143|Ga0099792_11147121All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300009176|Ga0105242_12627004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii553Open in IMG/M
3300009540|Ga0073899_10263052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium1299Open in IMG/M
3300010159|Ga0099796_10197975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium814Open in IMG/M
3300012096|Ga0137389_11421333Not Available589Open in IMG/M
3300012199|Ga0137383_10045405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3128Open in IMG/M
3300012199|Ga0137383_10410988All Organisms → cellular organisms → Bacteria → Proteobacteria991Open in IMG/M
3300012199|Ga0137383_10491928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium898Open in IMG/M
3300012200|Ga0137382_10058786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2427Open in IMG/M
3300012200|Ga0137382_10183367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1433Open in IMG/M
3300012200|Ga0137382_10198333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1378Open in IMG/M
3300012200|Ga0137382_10863601All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300012202|Ga0137363_10219480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1534Open in IMG/M
3300012202|Ga0137363_11775824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales509Open in IMG/M
3300012203|Ga0137399_10563102All Organisms → cellular organisms → Bacteria → Proteobacteria957Open in IMG/M
3300012203|Ga0137399_10965907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300012203|Ga0137399_11727691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae514Open in IMG/M
3300012205|Ga0137362_10010082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei6857Open in IMG/M
3300012205|Ga0137362_10066635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2972Open in IMG/M
3300012205|Ga0137362_10138532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2074Open in IMG/M
3300012205|Ga0137362_10948153Not Available734Open in IMG/M
3300012207|Ga0137381_10092204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2558Open in IMG/M
3300012207|Ga0137381_10477099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1088Open in IMG/M
3300012207|Ga0137381_11118808Not Available677Open in IMG/M
3300012208|Ga0137376_10483378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1075Open in IMG/M
3300012208|Ga0137376_11094512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi681Open in IMG/M
3300012211|Ga0137377_10489880All Organisms → cellular organisms → Bacteria → Proteobacteria1168Open in IMG/M
3300012211|Ga0137377_10598311All Organisms → cellular organisms → Bacteria → Proteobacteria1040Open in IMG/M
3300012350|Ga0137372_10443894Not Available974Open in IMG/M
3300012351|Ga0137386_10157366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1626Open in IMG/M
3300012351|Ga0137386_10239294All Organisms → cellular organisms → Bacteria → Proteobacteria1305Open in IMG/M
3300012359|Ga0137385_10972490Not Available701Open in IMG/M
3300012361|Ga0137360_10420936All Organisms → cellular organisms → Bacteria → Proteobacteria1128Open in IMG/M
3300012361|Ga0137360_11101961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium686Open in IMG/M
3300012362|Ga0137361_10429743Not Available1213Open in IMG/M
3300012363|Ga0137390_10968100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium804Open in IMG/M
3300012582|Ga0137358_10609000All Organisms → cellular organisms → Bacteria → Proteobacteria733Open in IMG/M
3300012582|Ga0137358_10643236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria710Open in IMG/M
3300012683|Ga0137398_10143863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1542Open in IMG/M
3300012683|Ga0137398_10975749Not Available588Open in IMG/M
3300012683|Ga0137398_11196804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales519Open in IMG/M
3300012685|Ga0137397_10125042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1896Open in IMG/M
3300012685|Ga0137397_10453018All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300012685|Ga0137397_11067841Not Available590Open in IMG/M
3300012898|Ga0157293_10267496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales550Open in IMG/M
3300012917|Ga0137395_11069895Not Available573Open in IMG/M
3300012918|Ga0137396_10339291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1112Open in IMG/M
3300012918|Ga0137396_11058360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae583Open in IMG/M
3300012922|Ga0137394_10816251All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300012922|Ga0137394_11360978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens571Open in IMG/M
3300012923|Ga0137359_11747958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae509Open in IMG/M
3300012924|Ga0137413_10182246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1398Open in IMG/M
3300012924|Ga0137413_10667318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria785Open in IMG/M
3300012925|Ga0137419_10191354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1509Open in IMG/M
3300012925|Ga0137419_10617625All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300012925|Ga0137419_11515682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae568Open in IMG/M
3300012925|Ga0137419_11749363All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012925|Ga0137419_11940754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales506Open in IMG/M
3300012927|Ga0137416_10520034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1027Open in IMG/M
3300012929|Ga0137404_11397779Not Available646Open in IMG/M
3300012929|Ga0137404_12040812Not Available535Open in IMG/M
3300012944|Ga0137410_10457403Not Available1037Open in IMG/M
3300012944|Ga0137410_11775572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300012961|Ga0164302_10902196All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300014160|Ga0181517_10202493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1085Open in IMG/M
3300014167|Ga0181528_10050192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2313Open in IMG/M
3300014168|Ga0181534_10546518All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300014502|Ga0182021_13223832All Organisms → cellular organisms → Bacteria → Proteobacteria545Open in IMG/M
3300014658|Ga0181519_10129421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1619Open in IMG/M
3300014838|Ga0182030_10353913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1567Open in IMG/M
3300014838|Ga0182030_10481086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1249Open in IMG/M
3300015052|Ga0137411_1137822All Organisms → cellular organisms → Bacteria → Proteobacteria1613Open in IMG/M
3300015053|Ga0137405_1248921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae989Open in IMG/M
3300015053|Ga0137405_1283155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2138Open in IMG/M
3300015241|Ga0137418_10016381All Organisms → cellular organisms → Bacteria → Proteobacteria6852Open in IMG/M
3300015242|Ga0137412_10348005All Organisms → cellular organisms → Bacteria → Proteobacteria1154Open in IMG/M
3300015242|Ga0137412_10377186All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1101Open in IMG/M
3300015264|Ga0137403_10055544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4063Open in IMG/M
3300018028|Ga0184608_10013907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00692801Open in IMG/M
3300018469|Ga0190270_11754223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium675Open in IMG/M
3300018476|Ga0190274_12716795Not Available592Open in IMG/M
3300019877|Ga0193722_1029308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1424Open in IMG/M
3300019878|Ga0193715_1025982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1271Open in IMG/M
3300019882|Ga0193713_1001428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7938Open in IMG/M
3300019882|Ga0193713_1150658All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300019883|Ga0193725_1048008All Organisms → cellular organisms → Bacteria → Proteobacteria1098Open in IMG/M
3300019883|Ga0193725_1147671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300019885|Ga0193747_1041622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1144Open in IMG/M
3300019885|Ga0193747_1042070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1138Open in IMG/M
3300019887|Ga0193729_1197545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C-145688Open in IMG/M
3300019890|Ga0193728_1111674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1250Open in IMG/M
3300020004|Ga0193755_1178284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300020010|Ga0193749_1012159Not Available1679Open in IMG/M
3300020015|Ga0193734_1068240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae629Open in IMG/M
3300020018|Ga0193721_1026365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1540Open in IMG/M
3300020018|Ga0193721_1093416Not Available774Open in IMG/M
3300020021|Ga0193726_1000457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium42948Open in IMG/M
3300020062|Ga0193724_1000184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium15648Open in IMG/M
3300020062|Ga0193724_1000353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium10995Open in IMG/M
3300020170|Ga0179594_10252256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae665Open in IMG/M
3300021086|Ga0179596_10305383Not Available794Open in IMG/M
3300021344|Ga0193719_10160652All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300021363|Ga0193699_10403799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium566Open in IMG/M
3300021405|Ga0210387_11728431All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300021407|Ga0210383_11044335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria692Open in IMG/M
3300022694|Ga0222623_10031771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2005Open in IMG/M
3300022908|Ga0247779_1183637All Organisms → cellular organisms → Bacteria → Proteobacteria549Open in IMG/M
3300024288|Ga0179589_10147599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1001Open in IMG/M
3300024330|Ga0137417_1167437Not Available1314Open in IMG/M
3300026273|Ga0209881_1005337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2880Open in IMG/M
3300026273|Ga0209881_1030633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium1304Open in IMG/M
3300026273|Ga0209881_1102601All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300026273|Ga0209881_1143000Not Available597Open in IMG/M
3300026273|Ga0209881_1175352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae535Open in IMG/M
3300026304|Ga0209240_1015539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2905Open in IMG/M
3300026340|Ga0257162_1015184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium913Open in IMG/M
3300026341|Ga0257151_1014243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum830Open in IMG/M
3300026345|Ga0257148_1006501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium848Open in IMG/M
3300026358|Ga0257166_1004926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1496Open in IMG/M
3300026374|Ga0257146_1036594Not Available796Open in IMG/M
3300026481|Ga0257155_1020206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium951Open in IMG/M
3300026481|Ga0257155_1044702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae684Open in IMG/M
3300026490|Ga0257153_1056134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium803Open in IMG/M
3300026494|Ga0257159_1028253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae930Open in IMG/M
3300026496|Ga0257157_1017575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1156Open in IMG/M
3300026497|Ga0257164_1012181Not Available1119Open in IMG/M
3300026498|Ga0257156_1010759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1744Open in IMG/M
3300026498|Ga0257156_1057486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales802Open in IMG/M
3300026507|Ga0257165_1011116All Organisms → cellular organisms → Bacteria → Proteobacteria1416Open in IMG/M
3300026507|Ga0257165_1063112Not Available673Open in IMG/M
3300026515|Ga0257158_1013365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1300Open in IMG/M
3300027381|Ga0208983_1001062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4125Open in IMG/M
3300027383|Ga0209213_1013531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1499Open in IMG/M
3300027383|Ga0209213_1015405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1416Open in IMG/M
3300027528|Ga0208985_1057099Not Available756Open in IMG/M
3300027616|Ga0209106_1047944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi952Open in IMG/M
3300027633|Ga0208988_1016654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1874Open in IMG/M
3300027633|Ga0208988_1043471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1152Open in IMG/M
3300027633|Ga0208988_1063189Not Available937Open in IMG/M
3300027663|Ga0208990_1080980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae924Open in IMG/M
3300027671|Ga0209588_1081894Not Available1042Open in IMG/M
3300027678|Ga0209011_1029892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis1735Open in IMG/M
3300027778|Ga0209464_10372759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium525Open in IMG/M
3300027802|Ga0209476_10046032Not Available2344Open in IMG/M
3300027802|Ga0209476_10281836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei729Open in IMG/M
3300027894|Ga0209068_10358711All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae826Open in IMG/M
3300027915|Ga0209069_10011267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4312Open in IMG/M
3300027915|Ga0209069_10282480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium875Open in IMG/M
3300028047|Ga0209526_10478479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales815Open in IMG/M
3300028565|Ga0302145_10262958Not Available572Open in IMG/M
3300028787|Ga0307323_10081939All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300028807|Ga0307305_10291917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria742Open in IMG/M
3300028807|Ga0307305_10393725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae626Open in IMG/M
3300031232|Ga0302323_101666678All Organisms → cellular organisms → Bacteria → Proteobacteria720Open in IMG/M
3300031548|Ga0307408_101364937Not Available666Open in IMG/M
3300032722|Ga0316231_1356952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8556Open in IMG/M
3300033408|Ga0316605_12129284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium546Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil41.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil10.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil4.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.30%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.89%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.42%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.47%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.47%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.47%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.47%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.47%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.47%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.47%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.47%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918024Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300000912Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005660Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitateEngineeredOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006949Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16BEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009540Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-PhEngineeredOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022908Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300026341Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-AEnvironmentalOpen in IMG/M
3300026345Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-AEnvironmentalOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027528Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027802Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes)EngineeredOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300032722Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B_all_v_000382802140918024SoilIGIAAHPSRRPLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASD
JGI12032J12867_100662513300000912Forest SoilDARKGALLRMRSNSLKHNDLMLRSERRERLEAWTASDSQI*
JGI12053J15887_1001391213300001661Forest SoilMRSNLLKHNNLMLRSERRERLEAWAASDSPISLSQY*
JGI12053J15887_1002370243300001661Forest SoilPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAANDSQI*
JGI12053J15887_1005212113300001661Forest SoilRGARKGALLRMRSNSLKHNXLMLRSERRERLEAWXASDSQI*
JGI12053J15887_1008368313300001661Forest SoilRGARKGALLRMRSNSLKHNNLMLRSERRERLEAWTASDSQI*
JGI12053J15887_1013633313300001661Forest SoilPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAESGSQI*
JGI12053J15887_1015642813300001661Forest SoilRRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
JGI12053J15887_1047805813300001661Forest SoilGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQIYHSRY*
JGI12053J15887_1058041513300001661Forest SoilGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDS*
JGI12053J15887_1058715923300001661Forest SoilLLKHNNLMLRSERRERLEAWAASDSSISHSQYQIMIRLD*
JGI12053J15887_1063288433300001661Forest SoilPLRMRSNSLKHNNLMLRSERRERLEAWAASDSQT*
JGIcombinedJ26739_10103946723300002245Forest SoilTRLLRMRSKVLKQNNLMLRSERRERLEAWAASDPLILHSQY*
C688J35102_12050913013300002568SoilGLLRMRSNLLIHNNLMLRSERRERLEAWAISDSPISHSQY*
JGI25612J43240_100931613300002886Grasslands SoilGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY*
JGI25612J43240_101856913300002886Grasslands SoilGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHSQY*
JGI25612J43240_105169513300002886Grasslands SoilSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD*
Ga0066679_1044195513300005176SoilLLRRRSNLLKHNNLMLKCERRERLEAWAASDSPISHSQY*
Ga0070671_10040816313300005355Switchgrass RhizosphereLLRMRSNLLKHNNLMLRSEHRERLEAWAVSDFPISHGQHELRGDISS*
Ga0068854_10203938613300005578Corn RhizosphereGIAAHPSRRPLRGLLRMRFYLLKHNSLMLRSEQRERLDAWATSDLSP*
Ga0066706_1071994813300005598SoilLRRRSNLLKHNNLMLKCERRERLEAWAASDSPISHSQY*
Ga0073904_1006185613300005660Activated SludgeRMRFTLLKRHNLMLRSERRERLEAWAASDSPISDSRY*
Ga0068862_10132946333300005844Switchgrass RhizosphereDLLRMRSNLLQHNNLMLRSERRERLEAWTASDSHISPS*
Ga0066789_1000314213300005994SoilGLLRMRSNLLKHNNLMLRSEPRERLEAWAASDSPISHSGY*
Ga0075365_1046588423300006038Populus EndosphereMRFNSLKHNNRMLRSEHRERLEAWAASDSHISKLSVS*
Ga0075024_10001207413300006047WatershedsGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQISHSQY*
Ga0075024_10090771113300006047WatershedsGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0075028_10005683043300006050WatershedsSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0075021_1115646513300006354WatershedsLLRMRSNLLKHNNLMLRSERRERLEAWAASDYRSRIGQY*
Ga0066660_1034767813300006800SoilGLLRRRSNLLKHNNLMLKCERRERLEAWAASDSPISHSQY*
Ga0066797_100467933300006864SoilMRSNLLNHDNLMLRSERRERLEAWAASDALTYHTWSALD*
Ga0066797_104165913300006864SoilFARPVGGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPNSHSQY*
Ga0066797_105809713300006864SoilAHPSRRPLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDEPISHRQY*
Ga0066797_106714833300006864SoilARPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASDKPISHSQY*
Ga0075528_1009419613300006949Arctic Peat SoilSKVLKQNNLMLRSERRERLEAWATSGSLISDSQY*
Ga0075524_1035232223300006950Arctic Peat SoilYKVLKQNNLMLRSERRERLEAWATSGSLISDSQY*
Ga0075524_1039576813300006950Arctic Peat SoilLRMRSNLLKHNGLMLRSEQRERLEAWAVPICDSRY*
Ga0075524_1044543213300006950Arctic Peat SoilRRPLRGLLRMRSKVLKQNNLMLRSERRERLEAWATSGSLTSDSQY*
Ga0099791_1004573813300007255Vadose Zone SoilLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY*
Ga0099791_1005764353300007255Vadose Zone SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0099791_1011980833300007255Vadose Zone SoilRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0099791_1041177913300007255Vadose Zone SoilLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0099793_1000963453300007258Vadose Zone SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0099793_1006097213300007258Vadose Zone SoilPPLRDLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0099793_1007960013300007258Vadose Zone SoilQIGIAAHPSRRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0099793_1012974223300007258Vadose Zone SoilGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0099793_1022708113300007258Vadose Zone SoilLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0099794_1003239813300007265Vadose Zone SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0099795_1003339733300007788Vadose Zone SoilVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0099795_1010716313300007788Vadose Zone SoilLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0099795_1016514123300007788Vadose Zone SoilPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0099829_1030440813300009038Vadose Zone SoilLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDFPISHSLY*
Ga0099792_1028842313300009143Vadose Zone SoilRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0099792_1074115613300009143Vadose Zone SoilLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD*
Ga0099792_1114712123300009143Vadose Zone SoilGLLRMRSNLLKHNNLMLRSERRERLEAWASGDSPISHSQY*
Ga0105242_1262700423300009176Miscanthus RhizosphereMRSDLLKYNNLMLRSERRERLEAWAASGLSISQSRY*
Ga0073899_1026305233300009540Activated SludgeEVNLLKHNNLMLRSERRERLEAWAASDSPILHRRY*
Ga0099796_1019797513300010159Vadose Zone SoilLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137389_1142133313300012096Vadose Zone SoilGLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQV*
Ga0137383_1004540513300012199Vadose Zone SoilLRRRSNLLKHNNLMLKCERRERLEAWTASDSPISHSQY*
Ga0137383_1041098823300012199Vadose Zone SoilRYAGMRSNSLKHNNLMLRSERRERLEARAASDSQI*
Ga0137383_1049192813300012199Vadose Zone SoilLLKHNNLMLRSERRERLEAWAAGDSPISHIQYQSTLHG
Ga0137382_1005878613300012200Vadose Zone SoilDASLLKHNNLMLRSEQRERLEAWAASDSPISHSRY*
Ga0137382_1018336713300012200Vadose Zone SoilRPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137382_1019833313300012200Vadose Zone SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0137382_1086360113300012200Vadose Zone SoilRYAGMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137363_1021948013300012202Vadose Zone SoilRDLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0137363_1177582413300012202Vadose Zone SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY*
Ga0137399_1056310223300012203Vadose Zone SoilRDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0137399_1096590713300012203Vadose Zone SoilLRDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0137399_1172769113300012203Vadose Zone SoilPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSPSSHSQYYLF*
Ga0137362_1001008213300012205Vadose Zone SoilLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0137362_1006663543300012205Vadose Zone SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSRI*
Ga0137362_1013853213300012205Vadose Zone SoilFARPVGGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY*
Ga0137362_1094815323300012205Vadose Zone SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAASGSQI*
Ga0137381_1009220413300012207Vadose Zone SoilGLLRMRSNLLKHNNLMLRSERRERLEAWAASESPISHSQY*
Ga0137381_1047709923300012207Vadose Zone SoilLRGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137381_1111880813300012207Vadose Zone SoilPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDPQI*
Ga0137376_1048337813300012208Vadose Zone SoilSQKTNLLKHNNLMLKCERRERLEAWAASDSPISHSQY*
Ga0137376_1109451233300012208Vadose Zone SoilRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0137377_1048988013300012211Vadose Zone SoilARPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0137377_1059831113300012211Vadose Zone SoilMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0137372_1044389413300012350Vadose Zone SoilMRSNLLKHNNLMLRSERRERLEAWAASDSLLSHSQY
Ga0137386_1015736613300012351Vadose Zone SoilGPLRRRSNLLKHNNLMLKCERRERLEAWAASDSPISHSQY*
Ga0137386_1023929413300012351Vadose Zone SoilGRAFARPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDPQI*
Ga0137385_1097249023300012359Vadose Zone SoilGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137360_1042093623300012361Vadose Zone SoilGGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0137360_1110196133300012361Vadose Zone SoilDLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0137361_1042974313300012362Vadose Zone SoilRMRFSLLKHNNLMLRSERRERLEAWATSDSPISYSQY*
Ga0137390_1096810013300012363Vadose Zone SoilVEAHPSRRPLRGLLRMRSTLLKQKHLMLRSARSARLEAWAKSEAIVSDSLY*
Ga0137358_1060900043300012582Vadose Zone SoilRAFARPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137358_1064323613300012582Vadose Zone SoilPSRRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137398_1014386313300012683Vadose Zone SoilLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0137398_1097574923300012683Vadose Zone SoilRDLLRMRSNSLKHNNLMLRSERRERLESWAASDSPI*
Ga0137398_1119680413300012683Vadose Zone SoilARPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASNSQI*
Ga0137397_1012504213300012685Vadose Zone SoilGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD*
Ga0137397_1045301813300012685Vadose Zone SoilLRGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY*
Ga0137397_1106784123300012685Vadose Zone SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHGQY*
Ga0157293_1026749623300012898SoilMRSNPLKHDNLMLRSEHRERHEASAASDSQITHSQY*
Ga0137395_1106989513300012917Vadose Zone SoilLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQT*
Ga0137396_1033929113300012918Vadose Zone SoilGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY*
Ga0137396_1105836013300012918Vadose Zone SoilLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY*
Ga0137394_1081625123300012922Vadose Zone SoilRMRSNLLKHNSLMLRSERRERLEAWTASDSPISHSQY*
Ga0137394_1136097813300012922Vadose Zone SoilLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHGQY*
Ga0137359_1174795813300012923Vadose Zone SoilGLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137413_1018224643300012924Vadose Zone SoilMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0137413_1066731833300012924Vadose Zone SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQT*
Ga0137419_1019135413300012925Vadose Zone SoilLRGLLRMRSNLLKHNNLMLRSERSERLEAWAASDSPISHSQY*
Ga0137419_1061762513300012925Vadose Zone SoilRPVGGLLRMRSSLLKHNNLMLRSERRERLEAWTASDSPISHSQY*
Ga0137419_1151568213300012925Vadose Zone SoilRPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSPSSHSQYYLF*
Ga0137419_1174936313300012925Vadose Zone SoilRGLLRMRSNSLKHNNLMLRSERRERLEAWAASDSPISHSQC*
Ga0137419_1194075413300012925Vadose Zone SoilLRMRSNLLKHNNLMLRSERRERLEAWAASDQPISHRQG*
Ga0137416_1052003413300012927Vadose Zone SoilPLRGLLRMRSNLSKHNNLMLRSERRERLEAWAASDSPISHRYWS*
Ga0137404_1139777913300012929Vadose Zone SoilRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHSQY*
Ga0137404_1204081213300012929Vadose Zone SoilLLRMRSNSLKHNNLMLRSERRERLEAWAASDSHI*
Ga0137410_1045740323300012944Vadose Zone SoilFARPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSLSSQYYLF*
Ga0137410_1177557213300012944Vadose Zone SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSRY*
Ga0164302_1090219623300012961SoilRGLLRMRSDLLKHNDLMLRSERRERLEAWAASRY*
Ga0181517_1020249333300014160BogGLLRMRSYPLKHNNLMLRSERRERLEAWAASDSPISHSQS*
Ga0181528_1005019223300014167BogMRFNLLIQDNLMLRSEQRERLEAWAASDSPVSHVS*
Ga0181534_1054651823300014168BogRSNLLKHNNLMLRSERRERLEAWAASDLSISHRQY*
Ga0182021_1322383213300014502FenGLLRMRSKVLKQNNLMLRSERRERLEAWAATDSPN*
Ga0181519_1012942113300014658BogRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHRQY*
Ga0182030_1035391333300014838BogGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPVSHHQH*
Ga0182030_1048108613300014838BogIGIAAHPSRRPLRGLLRMRSNLLKHNTLMLRSERRERLEAWAASDSPISHRQY*
Ga0137411_113782233300015052Vadose Zone SoilLRGLLRMRSSLLKHNNLMLRSEQRERLEAWAASDSPISHSRY*
Ga0137405_124892113300015053Vadose Zone SoilGDLLRMRSNPLKHNNLMLRSERRERLEAWAASDSQI*
Ga0137405_128315543300015053Vadose Zone SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSRN*
Ga0137418_1001638153300015241Vadose Zone SoilGLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI*
Ga0137412_1034800523300015242Vadose Zone SoilGGLLRMRSKVLKQHNLMLRSERRERLEAWATSDSLISHSRY*
Ga0137412_1037718613300015242Vadose Zone SoilFNLLKHNNLMLRSERRERLEAWAATDSPISHSQY*
Ga0137403_1005554413300015264Vadose Zone SoilRRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWR*
Ga0184608_1001390743300018028Groundwater SedimentGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0190270_1175422333300018469SoilWPPQDEVNLLKRKNLMLRREQRERLEAWAASDLPISHSQY
Ga0190274_1271679523300018476SoilMRLKLLKHNNLMLRSEHRERLEAWAASDSLTHGRP
Ga0193722_102930813300019877SoilMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0193715_102598213300019878SoilRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0193713_100142813300019882SoilRDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI
Ga0193713_115065813300019882SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0193725_104800813300019883SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI
Ga0193725_114767113300019883SoilLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY
Ga0193747_104162213300019885SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQISHSRY
Ga0193747_104207043300019885SoilGNLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI
Ga0193729_119754513300019887SoilRMMSNLLKHNNLMLRSERRERLEAWAASDSQISHSRY
Ga0193728_111167413300019890SoilSRYAGMRSNLLKHNNLMLRSERRERLEAWAASDSPISQY
Ga0193755_117828413300020004SoilLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY
Ga0193749_101215913300020010SoilRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI
Ga0193734_106824013300020015SoilPLRDLLRMRSDSLKHNNLMLRSEQRERLEAWAASGSQI
Ga0193721_102636513300020018SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISLSQY
Ga0193721_109341613300020018SoilPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASGSQI
Ga0193726_100045713300020021SoilPLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASEQPISHSQY
Ga0193724_1000184163300020062SoilRGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0193724_100035313300020062SoilRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI
Ga0179594_1025225613300020170Vadose Zone SoilFARPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSPSSHSQYYLF
Ga0179596_1030538313300021086Vadose Zone SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY
Ga0193719_1016065213300021344SoilGMRYSLLKHNDLMLRSERRERLEAWAASDSPISHSRY
Ga0193699_1040379913300021363SoilRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD
Ga0210387_1172843113300021405SoilVLKQNNLMLRSERSERLEAWAASDSLILHSRHQTNR
Ga0210383_1104433523300021407SoilPSFETALTRLLRMRSKVLKQNNLMLRSERRERLEAWAASDSLILHSQY
Ga0222623_1003177123300022694Groundwater SedimentGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQD
Ga0247779_118363723300022908Plant LitterMRSNPLKHHNLMLRSEQRERLEAWAAGDSLVIHIQ
Ga0179589_1014759923300024288Vadose Zone SoilLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0137417_116743713300024330Vadose Zone SoilLRDLLRMRSNSLKHNSLMLRSERRERLEAWAASDSQI
Ga0209881_100533743300026273SoilMRSNLLKHNNLMLRSERRERLEAWAASDEPISHRQY
Ga0209881_103063323300026273SoilGLLRMRSNLLKHHNLMLRSEQRERLEAWAASDSPISHRQY
Ga0209881_110260113300026273SoilPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASDKPISHSQY
Ga0209881_114300013300026273SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPVSQSQY
Ga0209881_117535223300026273SoilGGLLRMRSNLLIHNNLMLRSERRERLEALATSDSPISHSQY
Ga0209240_101553913300026304Grasslands SoilLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0257162_101518413300026340SoilPLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0257151_101424323300026341SoilGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHSQY
Ga0257148_100650113300026345SoilRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD
Ga0257166_100492613300026358SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSPISHSRY
Ga0257146_103659423300026374SoilLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY
Ga0257155_102020613300026481SoilRSRYAGMRSNSLKHNNLMLRSERRERLEAWAVSDITGNF
Ga0257155_104470223300026481SoilRPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI
Ga0257153_105613413300026490SoilLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD
Ga0257159_102825313300026494SoilDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI
Ga0257157_101757513300026496SoilLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHSQY
Ga0257164_101218113300026497SoilIGIAAHPSRRPLRGLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI
Ga0257156_101075913300026498SoilGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0257156_105748613300026498SoilLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI
Ga0257165_101111613300026507SoilDLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI
Ga0257165_106311223300026507SoilGLLRMRSNLLKHDNLMLRSERRERLEAWAASDQPISPSEY
Ga0257161_103083313300026508SoilVNQFEVWYNSLKHNNLMLRSERRERLEAGAVSDSQI
Ga0257158_101336513300026515SoilRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0208983_100106253300027381Forest SoilPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI
Ga0209213_101353143300027383Forest SoilLGDLLRMRSNSLKHNNLMLRSERRERLEAWAASNSQI
Ga0209213_101540513300027383Forest SoilRDLLRMRSNSLKHNNLMLRSERRERLEAWAASGSQI
Ga0208985_105709913300027528Forest SoilGRLLRCNELKHNNLMLRSEHRERLEAWATGDWLISHSQF
Ga0209106_104794413300027616Forest SoilRSNLLKHNNLMLRSERRERLEAWAASDSPISHGQY
Ga0208988_101665413300027633Forest SoilMAAAKTIVNRKSIFLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI
Ga0208988_104347143300027633Forest SoilRGLLRMRSNLLKHNNLMLRSERRERLEASAASDSPISHSQY
Ga0208988_106318913300027633Forest SoilRGLLRMRSNLLKHNNLMLRSERRERLEAWAASESPISHSQY
Ga0208990_108098013300027663Forest SoilLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD
Ga0209588_108189413300027671Vadose Zone SoilVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSPSSHSQYYLF
Ga0209011_102989213300027678Forest SoilRPLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASEQPISHSQYY
Ga0209464_1037275923300027778Wetland SedimentRSNLLKHNNLMLRSEQRERLEAWAASDSRISHGRY
Ga0209476_1004603213300027802Activated SludgeTLDMGHKRMRFTLLKRHNLMLRSERRERLEAWAASDSPISDSRY
Ga0209476_1028183633300027802Activated SludgeRMRFTLLKRHNLMLRSERRERLEAWAASDSPISDSRY
Ga0209068_1035871123300027894WatershedsGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQISHSQY
Ga0209069_1001126713300027915WatershedsLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQISHSQY
Ga0209069_1028248013300027915WatershedsDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSPI
Ga0209526_1047847913300028047Forest SoilRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY
Ga0302145_1026295813300028565BogMRSNVLKHNYLMLRSEQRERLEAWAASDSPISHRQ
Ga0307323_1008193913300028787SoilLKHNNLMLRSERRERLEAWAASDSPISHRQYQVSG
Ga0307305_1029191713300028807SoilAGMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY
Ga0307305_1039372523300028807SoilDLLRMRSDSLKHNNLMLRSEQRERLEAWAASGSQI
Ga0302323_10166667813300031232FenLLRMRSNLLQHNNLMLRSERRERLEASAASDSPISHRQY
Ga0307408_10136493713300031548RhizosphereMRFNLLQHDNLMLRSEHRERLEAWATSDSPISHVL
Ga0316231_135695223300032722FreshwaterGLLRMRSNLLKHNNLMLRSEQRERLEAWATSDSPISHR
Ga0316605_1212928413300033408SoilMRFNLVKHDNLMLRSERRERLEAWAASDSPISHSQY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.