


| Basic Information | |
|---|---|
| Family ID | F023008 |
| Family Type | Metagenome |
| Number of Sequences | 212 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 212 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.37 % |
| % of genes near scaffold ends (potentially truncated) | 96.70 % |
| % of genes from short scaffolds (< 2000 bps) | 84.91 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.547 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (41.509 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.698 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.811 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 212 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 1.89 |
| PF00106 | adh_short | 1.89 |
| PF00294 | PfkB | 1.89 |
| PF08028 | Acyl-CoA_dh_2 | 1.42 |
| PF04748 | Polysacc_deac_2 | 1.42 |
| PF07859 | Abhydrolase_3 | 1.42 |
| PF09084 | NMT1 | 1.42 |
| PF03401 | TctC | 0.94 |
| PF13565 | HTH_32 | 0.94 |
| PF04199 | Cyclase | 0.94 |
| PF01040 | UbiA | 0.94 |
| PF01799 | Fer2_2 | 0.94 |
| PF00459 | Inositol_P | 0.94 |
| PF00903 | Glyoxalase | 0.94 |
| PF02551 | Acyl_CoA_thio | 0.94 |
| PF03454 | MoeA_C | 0.94 |
| PF08592 | Anthrone_oxy | 0.94 |
| PF00753 | Lactamase_B | 0.94 |
| PF08240 | ADH_N | 0.94 |
| PF11953 | DUF3470 | 0.94 |
| PF01734 | Patatin | 0.94 |
| PF00892 | EamA | 0.94 |
| PF04191 | PEMT | 0.94 |
| PF12860 | PAS_7 | 0.94 |
| PF00083 | Sugar_tr | 0.47 |
| PF00941 | FAD_binding_5 | 0.47 |
| PF03918 | CcmH | 0.47 |
| PF02515 | CoA_transf_3 | 0.47 |
| PF00072 | Response_reg | 0.47 |
| PF05430 | Methyltransf_30 | 0.47 |
| PF00206 | Lyase_1 | 0.47 |
| PF00293 | NUDIX | 0.47 |
| PF07372 | DUF1491 | 0.47 |
| PF00583 | Acetyltransf_1 | 0.47 |
| PF12792 | CSS-motif | 0.47 |
| PF00334 | NDK | 0.47 |
| PF04434 | SWIM | 0.47 |
| PF13089 | PP_kinase_N | 0.47 |
| PF05199 | GMC_oxred_C | 0.47 |
| PF04290 | DctQ | 0.47 |
| PF12146 | Hydrolase_4 | 0.47 |
| PF03738 | GSP_synth | 0.47 |
| PF00871 | Acetate_kinase | 0.47 |
| PF05930 | Phage_AlpA | 0.47 |
| PF07687 | M20_dimer | 0.47 |
| PF00227 | Proteasome | 0.47 |
| PF07883 | Cupin_2 | 0.47 |
| PF04073 | tRNA_edit | 0.47 |
| PF07690 | MFS_1 | 0.47 |
| PF07732 | Cu-oxidase_3 | 0.47 |
| PF00543 | P-II | 0.47 |
| PF01790 | LGT | 0.47 |
| PF13527 | Acetyltransf_9 | 0.47 |
| PF10755 | DUF2585 | 0.47 |
| PF00496 | SBP_bac_5 | 0.47 |
| PF04392 | ABC_sub_bind | 0.47 |
| PF00953 | Glycos_transf_4 | 0.47 |
| PF04879 | Molybdop_Fe4S4 | 0.47 |
| PF01042 | Ribonuc_L-PSP | 0.47 |
| PF15919 | HicB_lk_antitox | 0.47 |
| PF01575 | MaoC_dehydratas | 0.47 |
| PF13744 | HTH_37 | 0.47 |
| PF06568 | DUF1127 | 0.47 |
| PF00664 | ABC_membrane | 0.47 |
| PF12897 | Asp_aminotransf | 0.47 |
| PF00296 | Bac_luciferase | 0.47 |
| PF01261 | AP_endonuc_2 | 0.47 |
| PF02738 | MoCoBD_1 | 0.47 |
| PF07730 | HisKA_3 | 0.47 |
| PF08386 | Abhydrolase_4 | 0.47 |
| PF01047 | MarR | 0.47 |
| PF00015 | MCPsignal | 0.47 |
| PF09587 | PGA_cap | 0.47 |
| PF13419 | HAD_2 | 0.47 |
| PF00501 | AMP-binding | 0.47 |
| PF00579 | tRNA-synt_1b | 0.47 |
| PF00873 | ACR_tran | 0.47 |
| PF01081 | Aldolase | 0.47 |
| PF00196 | GerE | 0.47 |
| PF13412 | HTH_24 | 0.47 |
| PF02775 | TPP_enzyme_C | 0.47 |
| PF00155 | Aminotran_1_2 | 0.47 |
| PF13525 | YfiO | 0.47 |
| PF01522 | Polysacc_deac_1 | 0.47 |
| PF07264 | EI24 | 0.47 |
| PF01494 | FAD_binding_3 | 0.47 |
| PF03965 | Penicillinase_R | 0.47 |
| PF00762 | Ferrochelatase | 0.47 |
| PF13416 | SBP_bac_8 | 0.47 |
| PF08883 | DOPA_dioxygen | 0.47 |
| PF04909 | Amidohydro_2 | 0.47 |
| PF13358 | DDE_3 | 0.47 |
| PF01872 | RibD_C | 0.47 |
| PF13417 | GST_N_3 | 0.47 |
| PF00771 | FHIPEP | 0.47 |
| PF13193 | AMP-binding_C | 0.47 |
| PF01370 | Epimerase | 0.47 |
| PF03450 | CO_deh_flav_C | 0.47 |
| PF08843 | AbiEii | 0.47 |
| PF01126 | Heme_oxygenase | 0.47 |
| PF13847 | Methyltransf_31 | 0.47 |
| PF00162 | PGK | 0.47 |
| PF00571 | CBS | 0.47 |
| PF13493 | DUF4118 | 0.47 |
| PF01746 | tRNA_m1G_MT | 0.47 |
| PF04966 | OprB | 0.47 |
| PF01656 | CbiA | 0.47 |
| PF00596 | Aldolase_II | 0.47 |
| PF01339 | CheB_methylest | 0.47 |
| PF07238 | PilZ | 0.47 |
| PF02547 | Queuosine_synth | 0.47 |
| PF00271 | Helicase_C | 0.47 |
| PF00378 | ECH_1 | 0.47 |
| PF12706 | Lactamase_B_2 | 0.47 |
| PF02142 | MGS | 0.47 |
| PF09821 | AAA_assoc_C | 0.47 |
| PF07995 | GSDH | 0.47 |
| PF01612 | DNA_pol_A_exo1 | 0.47 |
| PF13546 | DDE_5 | 0.47 |
| PF00570 | HRDC | 0.47 |
| PF03741 | TerC | 0.47 |
| PF16861 | Carbam_trans_C | 0.47 |
| PF12840 | HTH_20 | 0.47 |
| PF09594 | GT87 | 0.47 |
| PF13505 | OMP_b-brl | 0.47 |
| PF12697 | Abhydrolase_6 | 0.47 |
| PF01207 | Dus | 0.47 |
| COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
|---|---|---|---|
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.42 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.42 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.42 |
| COG2861 | Uncharacterized conserved protein YibQ, putative polysaccharide deacetylase 2 family | Carbohydrate transport and metabolism [G] | 1.42 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.42 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.94 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.94 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 0.94 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.94 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.94 |
| COG1946 | Acyl-CoA thioesterase | Lipid transport and metabolism [I] | 0.94 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 0.94 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.94 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.94 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.94 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 0.47 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.47 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.47 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.47 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 0.47 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.47 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.47 |
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.47 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.47 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.47 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0754 | Glutathionylspermidine synthase, CHAP domain | Amino acid transport and metabolism [E] | 0.47 |
| COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.47 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.47 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.47 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.47 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.47 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.47 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.47 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.47 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.47 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.47 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.47 |
| COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG3230 | Heme oxygenase | Inorganic ion transport and metabolism [P] | 0.47 |
| COG3311 | DNA-binding transcriptional regulator AlpA | Transcription [K] | 0.47 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.47 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.47 |
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.47 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.47 |
| COG4121 | tRNA U34 5-methylaminomethyl-2-thiouridine-forming methyltransferase MnmC | Translation, ribosomal structure and biogenesis [J] | 0.47 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.47 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.47 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.47 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.47 |
| COG5398 | Heme oxygenase | Coenzyme transport and metabolism [H] | 0.47 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.47 |
| COG5447 | Uncharacterized conserved protein, DUF1491 domain | Function unknown [S] | 0.47 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.96 % |
| Unclassified | root | N/A | 16.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918024|NODE_247811_length_1976_cov_8.525304 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2026 | Open in IMG/M |
| 3300000912|JGI12032J12867_1006625 | Not Available | 686 | Open in IMG/M |
| 3300001661|JGI12053J15887_10013912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4447 | Open in IMG/M |
| 3300001661|JGI12053J15887_10023702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3437 | Open in IMG/M |
| 3300001661|JGI12053J15887_10052121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2286 | Open in IMG/M |
| 3300001661|JGI12053J15887_10083683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1752 | Open in IMG/M |
| 3300001661|JGI12053J15887_10136333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1301 | Open in IMG/M |
| 3300001661|JGI12053J15887_10156428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300001661|JGI12053J15887_10478058 | Not Available | 595 | Open in IMG/M |
| 3300001661|JGI12053J15887_10580415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300001661|JGI12053J15887_10587159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 530 | Open in IMG/M |
| 3300001661|JGI12053J15887_10632884 | Not Available | 508 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101039467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 705 | Open in IMG/M |
| 3300002568|C688J35102_120509130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1129 | Open in IMG/M |
| 3300002886|JGI25612J43240_1009316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1428 | Open in IMG/M |
| 3300002886|JGI25612J43240_1018569 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1028 | Open in IMG/M |
| 3300002886|JGI25612J43240_1051695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis | 610 | Open in IMG/M |
| 3300005176|Ga0066679_10441955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 851 | Open in IMG/M |
| 3300005355|Ga0070671_100408163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1162 | Open in IMG/M |
| 3300005578|Ga0068854_102039386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 529 | Open in IMG/M |
| 3300005598|Ga0066706_10719948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 792 | Open in IMG/M |
| 3300005660|Ga0073904_10061856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2354 | Open in IMG/M |
| 3300005844|Ga0068862_101329463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 720 | Open in IMG/M |
| 3300005994|Ga0066789_10003142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7234 | Open in IMG/M |
| 3300006038|Ga0075365_10465884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 892 | Open in IMG/M |
| 3300006047|Ga0075024_100012074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 3461 | Open in IMG/M |
| 3300006047|Ga0075024_100907711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300006050|Ga0075028_100056830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1897 | Open in IMG/M |
| 3300006354|Ga0075021_11156465 | Not Available | 508 | Open in IMG/M |
| 3300006800|Ga0066660_10347678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium | 1203 | Open in IMG/M |
| 3300006864|Ga0066797_1004679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4451 | Open in IMG/M |
| 3300006864|Ga0066797_1041659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
| 3300006864|Ga0066797_1058097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1361 | Open in IMG/M |
| 3300006864|Ga0066797_1067148 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300006949|Ga0075528_10094196 | Not Available | 786 | Open in IMG/M |
| 3300006950|Ga0075524_10352322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300006950|Ga0075524_10395768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 610 | Open in IMG/M |
| 3300006950|Ga0075524_10445432 | Not Available | 573 | Open in IMG/M |
| 3300007255|Ga0099791_10045738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1951 | Open in IMG/M |
| 3300007255|Ga0099791_10057643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1745 | Open in IMG/M |
| 3300007255|Ga0099791_10119808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1220 | Open in IMG/M |
| 3300007255|Ga0099791_10411779 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300007258|Ga0099793_10009634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3698 | Open in IMG/M |
| 3300007258|Ga0099793_10060972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1686 | Open in IMG/M |
| 3300007258|Ga0099793_10079600 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 1493 | Open in IMG/M |
| 3300007258|Ga0099793_10129742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas oryzae | 1184 | Open in IMG/M |
| 3300007258|Ga0099793_10227081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
| 3300007265|Ga0099794_10032398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2454 | Open in IMG/M |
| 3300007788|Ga0099795_10033397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1787 | Open in IMG/M |
| 3300007788|Ga0099795_10107163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1103 | Open in IMG/M |
| 3300007788|Ga0099795_10165141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 916 | Open in IMG/M |
| 3300009038|Ga0099829_10304408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1307 | Open in IMG/M |
| 3300009143|Ga0099792_10288423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 970 | Open in IMG/M |
| 3300009143|Ga0099792_10741156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis | 639 | Open in IMG/M |
| 3300009143|Ga0099792_11147121 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009176|Ga0105242_12627004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 553 | Open in IMG/M |
| 3300009540|Ga0073899_10263052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1299 | Open in IMG/M |
| 3300010159|Ga0099796_10197975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 814 | Open in IMG/M |
| 3300012096|Ga0137389_11421333 | Not Available | 589 | Open in IMG/M |
| 3300012199|Ga0137383_10045405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3128 | Open in IMG/M |
| 3300012199|Ga0137383_10410988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
| 3300012199|Ga0137383_10491928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 898 | Open in IMG/M |
| 3300012200|Ga0137382_10058786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2427 | Open in IMG/M |
| 3300012200|Ga0137382_10183367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1433 | Open in IMG/M |
| 3300012200|Ga0137382_10198333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1378 | Open in IMG/M |
| 3300012200|Ga0137382_10863601 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012202|Ga0137363_10219480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1534 | Open in IMG/M |
| 3300012202|Ga0137363_11775824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300012203|Ga0137399_10563102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 957 | Open in IMG/M |
| 3300012203|Ga0137399_10965907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300012203|Ga0137399_11727691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 514 | Open in IMG/M |
| 3300012205|Ga0137362_10010082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 6857 | Open in IMG/M |
| 3300012205|Ga0137362_10066635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2972 | Open in IMG/M |
| 3300012205|Ga0137362_10138532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2074 | Open in IMG/M |
| 3300012205|Ga0137362_10948153 | Not Available | 734 | Open in IMG/M |
| 3300012207|Ga0137381_10092204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2558 | Open in IMG/M |
| 3300012207|Ga0137381_10477099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1088 | Open in IMG/M |
| 3300012207|Ga0137381_11118808 | Not Available | 677 | Open in IMG/M |
| 3300012208|Ga0137376_10483378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1075 | Open in IMG/M |
| 3300012208|Ga0137376_11094512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 681 | Open in IMG/M |
| 3300012211|Ga0137377_10489880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1168 | Open in IMG/M |
| 3300012211|Ga0137377_10598311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300012350|Ga0137372_10443894 | Not Available | 974 | Open in IMG/M |
| 3300012351|Ga0137386_10157366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1626 | Open in IMG/M |
| 3300012351|Ga0137386_10239294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1305 | Open in IMG/M |
| 3300012359|Ga0137385_10972490 | Not Available | 701 | Open in IMG/M |
| 3300012361|Ga0137360_10420936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
| 3300012361|Ga0137360_11101961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 686 | Open in IMG/M |
| 3300012362|Ga0137361_10429743 | Not Available | 1213 | Open in IMG/M |
| 3300012363|Ga0137390_10968100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300012582|Ga0137358_10609000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300012582|Ga0137358_10643236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300012683|Ga0137398_10143863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1542 | Open in IMG/M |
| 3300012683|Ga0137398_10975749 | Not Available | 588 | Open in IMG/M |
| 3300012683|Ga0137398_11196804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300012685|Ga0137397_10125042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1896 | Open in IMG/M |
| 3300012685|Ga0137397_10453018 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300012685|Ga0137397_11067841 | Not Available | 590 | Open in IMG/M |
| 3300012898|Ga0157293_10267496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
| 3300012917|Ga0137395_11069895 | Not Available | 573 | Open in IMG/M |
| 3300012918|Ga0137396_10339291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1112 | Open in IMG/M |
| 3300012918|Ga0137396_11058360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 583 | Open in IMG/M |
| 3300012922|Ga0137394_10816251 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012922|Ga0137394_11360978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 571 | Open in IMG/M |
| 3300012923|Ga0137359_11747958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 509 | Open in IMG/M |
| 3300012924|Ga0137413_10182246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1398 | Open in IMG/M |
| 3300012924|Ga0137413_10667318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
| 3300012925|Ga0137419_10191354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1509 | Open in IMG/M |
| 3300012925|Ga0137419_10617625 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300012925|Ga0137419_11515682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 568 | Open in IMG/M |
| 3300012925|Ga0137419_11749363 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012925|Ga0137419_11940754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 506 | Open in IMG/M |
| 3300012927|Ga0137416_10520034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1027 | Open in IMG/M |
| 3300012929|Ga0137404_11397779 | Not Available | 646 | Open in IMG/M |
| 3300012929|Ga0137404_12040812 | Not Available | 535 | Open in IMG/M |
| 3300012944|Ga0137410_10457403 | Not Available | 1037 | Open in IMG/M |
| 3300012944|Ga0137410_11775572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300012961|Ga0164302_10902196 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300014160|Ga0181517_10202493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1085 | Open in IMG/M |
| 3300014167|Ga0181528_10050192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2313 | Open in IMG/M |
| 3300014168|Ga0181534_10546518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300014502|Ga0182021_13223832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300014658|Ga0181519_10129421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1619 | Open in IMG/M |
| 3300014838|Ga0182030_10353913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1567 | Open in IMG/M |
| 3300014838|Ga0182030_10481086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1249 | Open in IMG/M |
| 3300015052|Ga0137411_1137822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1613 | Open in IMG/M |
| 3300015053|Ga0137405_1248921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 989 | Open in IMG/M |
| 3300015053|Ga0137405_1283155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2138 | Open in IMG/M |
| 3300015241|Ga0137418_10016381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6852 | Open in IMG/M |
| 3300015242|Ga0137412_10348005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1154 | Open in IMG/M |
| 3300015242|Ga0137412_10377186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1101 | Open in IMG/M |
| 3300015264|Ga0137403_10055544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4063 | Open in IMG/M |
| 3300018028|Ga0184608_10013907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 2801 | Open in IMG/M |
| 3300018469|Ga0190270_11754223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 675 | Open in IMG/M |
| 3300018476|Ga0190274_12716795 | Not Available | 592 | Open in IMG/M |
| 3300019877|Ga0193722_1029308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1424 | Open in IMG/M |
| 3300019878|Ga0193715_1025982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1271 | Open in IMG/M |
| 3300019882|Ga0193713_1001428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7938 | Open in IMG/M |
| 3300019882|Ga0193713_1150658 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300019883|Ga0193725_1048008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300019883|Ga0193725_1147671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300019885|Ga0193747_1041622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1144 | Open in IMG/M |
| 3300019885|Ga0193747_1042070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1138 | Open in IMG/M |
| 3300019887|Ga0193729_1197545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C-145 | 688 | Open in IMG/M |
| 3300019890|Ga0193728_1111674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1250 | Open in IMG/M |
| 3300020004|Ga0193755_1178284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300020010|Ga0193749_1012159 | Not Available | 1679 | Open in IMG/M |
| 3300020015|Ga0193734_1068240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 629 | Open in IMG/M |
| 3300020018|Ga0193721_1026365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1540 | Open in IMG/M |
| 3300020018|Ga0193721_1093416 | Not Available | 774 | Open in IMG/M |
| 3300020021|Ga0193726_1000457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 42948 | Open in IMG/M |
| 3300020062|Ga0193724_1000184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 15648 | Open in IMG/M |
| 3300020062|Ga0193724_1000353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10995 | Open in IMG/M |
| 3300020170|Ga0179594_10252256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 665 | Open in IMG/M |
| 3300021086|Ga0179596_10305383 | Not Available | 794 | Open in IMG/M |
| 3300021344|Ga0193719_10160652 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300021363|Ga0193699_10403799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 566 | Open in IMG/M |
| 3300021405|Ga0210387_11728431 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300021407|Ga0210383_11044335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300022694|Ga0222623_10031771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2005 | Open in IMG/M |
| 3300022908|Ga0247779_1183637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300024288|Ga0179589_10147599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1001 | Open in IMG/M |
| 3300024330|Ga0137417_1167437 | Not Available | 1314 | Open in IMG/M |
| 3300026273|Ga0209881_1005337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2880 | Open in IMG/M |
| 3300026273|Ga0209881_1030633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1304 | Open in IMG/M |
| 3300026273|Ga0209881_1102601 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300026273|Ga0209881_1143000 | Not Available | 597 | Open in IMG/M |
| 3300026273|Ga0209881_1175352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 535 | Open in IMG/M |
| 3300026304|Ga0209240_1015539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2905 | Open in IMG/M |
| 3300026340|Ga0257162_1015184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 913 | Open in IMG/M |
| 3300026341|Ga0257151_1014243 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 830 | Open in IMG/M |
| 3300026345|Ga0257148_1006501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 848 | Open in IMG/M |
| 3300026358|Ga0257166_1004926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1496 | Open in IMG/M |
| 3300026374|Ga0257146_1036594 | Not Available | 796 | Open in IMG/M |
| 3300026481|Ga0257155_1020206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 951 | Open in IMG/M |
| 3300026481|Ga0257155_1044702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 684 | Open in IMG/M |
| 3300026490|Ga0257153_1056134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 803 | Open in IMG/M |
| 3300026494|Ga0257159_1028253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 930 | Open in IMG/M |
| 3300026496|Ga0257157_1017575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1156 | Open in IMG/M |
| 3300026497|Ga0257164_1012181 | Not Available | 1119 | Open in IMG/M |
| 3300026498|Ga0257156_1010759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1744 | Open in IMG/M |
| 3300026498|Ga0257156_1057486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 802 | Open in IMG/M |
| 3300026507|Ga0257165_1011116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300026507|Ga0257165_1063112 | Not Available | 673 | Open in IMG/M |
| 3300026515|Ga0257158_1013365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1300 | Open in IMG/M |
| 3300027381|Ga0208983_1001062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4125 | Open in IMG/M |
| 3300027383|Ga0209213_1013531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1499 | Open in IMG/M |
| 3300027383|Ga0209213_1015405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1416 | Open in IMG/M |
| 3300027528|Ga0208985_1057099 | Not Available | 756 | Open in IMG/M |
| 3300027616|Ga0209106_1047944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 952 | Open in IMG/M |
| 3300027633|Ga0208988_1016654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1874 | Open in IMG/M |
| 3300027633|Ga0208988_1043471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1152 | Open in IMG/M |
| 3300027633|Ga0208988_1063189 | Not Available | 937 | Open in IMG/M |
| 3300027663|Ga0208990_1080980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 924 | Open in IMG/M |
| 3300027671|Ga0209588_1081894 | Not Available | 1042 | Open in IMG/M |
| 3300027678|Ga0209011_1029892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis | 1735 | Open in IMG/M |
| 3300027778|Ga0209464_10372759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300027802|Ga0209476_10046032 | Not Available | 2344 | Open in IMG/M |
| 3300027802|Ga0209476_10281836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 729 | Open in IMG/M |
| 3300027894|Ga0209068_10358711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 826 | Open in IMG/M |
| 3300027915|Ga0209069_10011267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4312 | Open in IMG/M |
| 3300027915|Ga0209069_10282480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 875 | Open in IMG/M |
| 3300028047|Ga0209526_10478479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 815 | Open in IMG/M |
| 3300028565|Ga0302145_10262958 | Not Available | 572 | Open in IMG/M |
| 3300028787|Ga0307323_10081939 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300028807|Ga0307305_10291917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300028807|Ga0307305_10393725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 626 | Open in IMG/M |
| 3300031232|Ga0302323_101666678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300031548|Ga0307408_101364937 | Not Available | 666 | Open in IMG/M |
| 3300032722|Ga0316231_1356952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8 | 556 | Open in IMG/M |
| 3300033408|Ga0316605_12129284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 546 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 41.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 4.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.30% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.42% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.47% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.47% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.47% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.47% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.47% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.47% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300000912 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
| 3300026345 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027802 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes) | Engineered | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B_all_v_00038280 | 2140918024 | Soil | IGIAAHPSRRPLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASD |
| JGI12032J12867_10066251 | 3300000912 | Forest Soil | DARKGALLRMRSNSLKHNDLMLRSERRERLEAWTASDSQI* |
| JGI12053J15887_100139121 | 3300001661 | Forest Soil | MRSNLLKHNNLMLRSERRERLEAWAASDSPISLSQY* |
| JGI12053J15887_100237024 | 3300001661 | Forest Soil | PLRDLLRMRSNSLKHNNLMLRSERRERLEAWAANDSQI* |
| JGI12053J15887_100521211 | 3300001661 | Forest Soil | RGARKGALLRMRSNSLKHNXLMLRSERRERLEAWXASDSQI* |
| JGI12053J15887_100836831 | 3300001661 | Forest Soil | RGARKGALLRMRSNSLKHNNLMLRSERRERLEAWTASDSQI* |
| JGI12053J15887_101363331 | 3300001661 | Forest Soil | PLRDLLRMRSNSLKHNNLMLRSERRERLEAWAESGSQI* |
| JGI12053J15887_101564281 | 3300001661 | Forest Soil | RRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| JGI12053J15887_104780581 | 3300001661 | Forest Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQIYHSRY* |
| JGI12053J15887_105804151 | 3300001661 | Forest Soil | GDLLRMRSNSLKHNNLMLRSERRERLEAWAASDS* |
| JGI12053J15887_105871592 | 3300001661 | Forest Soil | LLKHNNLMLRSERRERLEAWAASDSSISHSQYQIMIRLD* |
| JGI12053J15887_106328843 | 3300001661 | Forest Soil | PLRMRSNSLKHNNLMLRSERRERLEAWAASDSQT* |
| JGIcombinedJ26739_1010394672 | 3300002245 | Forest Soil | TRLLRMRSKVLKQNNLMLRSERRERLEAWAASDPLILHSQY* |
| C688J35102_1205091301 | 3300002568 | Soil | GLLRMRSNLLIHNNLMLRSERRERLEAWAISDSPISHSQY* |
| JGI25612J43240_10093161 | 3300002886 | Grasslands Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY* |
| JGI25612J43240_10185691 | 3300002886 | Grasslands Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHSQY* |
| JGI25612J43240_10516951 | 3300002886 | Grasslands Soil | SNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD* |
| Ga0066679_104419551 | 3300005176 | Soil | LLRRRSNLLKHNNLMLKCERRERLEAWAASDSPISHSQY* |
| Ga0070671_1004081631 | 3300005355 | Switchgrass Rhizosphere | LLRMRSNLLKHNNLMLRSEHRERLEAWAVSDFPISHGQHELRGDISS* |
| Ga0068854_1020393861 | 3300005578 | Corn Rhizosphere | GIAAHPSRRPLRGLLRMRFYLLKHNSLMLRSEQRERLDAWATSDLSP* |
| Ga0066706_107199481 | 3300005598 | Soil | LRRRSNLLKHNNLMLKCERRERLEAWAASDSPISHSQY* |
| Ga0073904_100618561 | 3300005660 | Activated Sludge | RMRFTLLKRHNLMLRSERRERLEAWAASDSPISDSRY* |
| Ga0068862_1013294633 | 3300005844 | Switchgrass Rhizosphere | DLLRMRSNLLQHNNLMLRSERRERLEAWTASDSHISPS* |
| Ga0066789_100031421 | 3300005994 | Soil | GLLRMRSNLLKHNNLMLRSEPRERLEAWAASDSPISHSGY* |
| Ga0075365_104658842 | 3300006038 | Populus Endosphere | MRFNSLKHNNRMLRSEHRERLEAWAASDSHISKLSVS* |
| Ga0075024_1000120741 | 3300006047 | Watersheds | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQISHSQY* |
| Ga0075024_1009077111 | 3300006047 | Watersheds | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0075028_1000568304 | 3300006050 | Watersheds | SNLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0075021_111564651 | 3300006354 | Watersheds | LLRMRSNLLKHNNLMLRSERRERLEAWAASDYRSRIGQY* |
| Ga0066660_103476781 | 3300006800 | Soil | GLLRRRSNLLKHNNLMLKCERRERLEAWAASDSPISHSQY* |
| Ga0066797_10046793 | 3300006864 | Soil | MRSNLLNHDNLMLRSERRERLEAWAASDALTYHTWSALD* |
| Ga0066797_10416591 | 3300006864 | Soil | FARPVGGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPNSHSQY* |
| Ga0066797_10580971 | 3300006864 | Soil | AHPSRRPLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDEPISHRQY* |
| Ga0066797_10671483 | 3300006864 | Soil | ARPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASDKPISHSQY* |
| Ga0075528_100941961 | 3300006949 | Arctic Peat Soil | SKVLKQNNLMLRSERRERLEAWATSGSLISDSQY* |
| Ga0075524_103523222 | 3300006950 | Arctic Peat Soil | YKVLKQNNLMLRSERRERLEAWATSGSLISDSQY* |
| Ga0075524_103957681 | 3300006950 | Arctic Peat Soil | LRMRSNLLKHNGLMLRSEQRERLEAWAVPICDSRY* |
| Ga0075524_104454321 | 3300006950 | Arctic Peat Soil | RRPLRGLLRMRSKVLKQNNLMLRSERRERLEAWATSGSLTSDSQY* |
| Ga0099791_100457381 | 3300007255 | Vadose Zone Soil | LRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY* |
| Ga0099791_100576435 | 3300007255 | Vadose Zone Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0099791_101198083 | 3300007255 | Vadose Zone Soil | RDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0099791_104117791 | 3300007255 | Vadose Zone Soil | LRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0099793_100096345 | 3300007258 | Vadose Zone Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0099793_100609721 | 3300007258 | Vadose Zone Soil | PPLRDLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0099793_100796001 | 3300007258 | Vadose Zone Soil | QIGIAAHPSRRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0099793_101297422 | 3300007258 | Vadose Zone Soil | GLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0099793_102270811 | 3300007258 | Vadose Zone Soil | LLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0099794_100323981 | 3300007265 | Vadose Zone Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0099795_100333973 | 3300007788 | Vadose Zone Soil | VGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0099795_101071631 | 3300007788 | Vadose Zone Soil | LLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0099795_101651412 | 3300007788 | Vadose Zone Soil | PLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0099829_103044081 | 3300009038 | Vadose Zone Soil | LRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDFPISHSLY* |
| Ga0099792_102884231 | 3300009143 | Vadose Zone Soil | RPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0099792_107411561 | 3300009143 | Vadose Zone Soil | LRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD* |
| Ga0099792_111471212 | 3300009143 | Vadose Zone Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWASGDSPISHSQY* |
| Ga0105242_126270042 | 3300009176 | Miscanthus Rhizosphere | MRSDLLKYNNLMLRSERRERLEAWAASGLSISQSRY* |
| Ga0073899_102630523 | 3300009540 | Activated Sludge | EVNLLKHNNLMLRSERRERLEAWAASDSPILHRRY* |
| Ga0099796_101979751 | 3300010159 | Vadose Zone Soil | LRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137389_114213331 | 3300012096 | Vadose Zone Soil | GLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQV* |
| Ga0137383_100454051 | 3300012199 | Vadose Zone Soil | LRRRSNLLKHNNLMLKCERRERLEAWTASDSPISHSQY* |
| Ga0137383_104109882 | 3300012199 | Vadose Zone Soil | RYAGMRSNSLKHNNLMLRSERRERLEARAASDSQI* |
| Ga0137383_104919281 | 3300012199 | Vadose Zone Soil | LLKHNNLMLRSERRERLEAWAAGDSPISHIQYQSTLHG |
| Ga0137382_100587861 | 3300012200 | Vadose Zone Soil | DASLLKHNNLMLRSEQRERLEAWAASDSPISHSRY* |
| Ga0137382_101833671 | 3300012200 | Vadose Zone Soil | RPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137382_101983331 | 3300012200 | Vadose Zone Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0137382_108636011 | 3300012200 | Vadose Zone Soil | RYAGMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137363_102194801 | 3300012202 | Vadose Zone Soil | RDLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0137363_117758241 | 3300012202 | Vadose Zone Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY* |
| Ga0137399_105631022 | 3300012203 | Vadose Zone Soil | RDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0137399_109659071 | 3300012203 | Vadose Zone Soil | LRDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0137399_117276911 | 3300012203 | Vadose Zone Soil | PVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSPSSHSQYYLF* |
| Ga0137362_100100821 | 3300012205 | Vadose Zone Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0137362_100666354 | 3300012205 | Vadose Zone Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSRI* |
| Ga0137362_101385321 | 3300012205 | Vadose Zone Soil | FARPVGGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY* |
| Ga0137362_109481532 | 3300012205 | Vadose Zone Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAASGSQI* |
| Ga0137381_100922041 | 3300012207 | Vadose Zone Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWAASESPISHSQY* |
| Ga0137381_104770992 | 3300012207 | Vadose Zone Soil | LRGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137381_111188081 | 3300012207 | Vadose Zone Soil | PVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDPQI* |
| Ga0137376_104833781 | 3300012208 | Vadose Zone Soil | SQKTNLLKHNNLMLKCERRERLEAWAASDSPISHSQY* |
| Ga0137376_110945123 | 3300012208 | Vadose Zone Soil | RGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0137377_104898801 | 3300012211 | Vadose Zone Soil | ARPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0137377_105983111 | 3300012211 | Vadose Zone Soil | MRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0137372_104438941 | 3300012350 | Vadose Zone Soil | MRSNLLKHNNLMLRSERRERLEAWAASDSLLSHSQY |
| Ga0137386_101573661 | 3300012351 | Vadose Zone Soil | GPLRRRSNLLKHNNLMLKCERRERLEAWAASDSPISHSQY* |
| Ga0137386_102392941 | 3300012351 | Vadose Zone Soil | GRAFARPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDPQI* |
| Ga0137385_109724902 | 3300012359 | Vadose Zone Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137360_104209362 | 3300012361 | Vadose Zone Soil | GGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0137360_111019613 | 3300012361 | Vadose Zone Soil | DLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0137361_104297431 | 3300012362 | Vadose Zone Soil | RMRFSLLKHNNLMLRSERRERLEAWATSDSPISYSQY* |
| Ga0137390_109681001 | 3300012363 | Vadose Zone Soil | VEAHPSRRPLRGLLRMRSTLLKQKHLMLRSARSARLEAWAKSEAIVSDSLY* |
| Ga0137358_106090004 | 3300012582 | Vadose Zone Soil | RAFARPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137358_106432361 | 3300012582 | Vadose Zone Soil | PSRRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137398_101438631 | 3300012683 | Vadose Zone Soil | LRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0137398_109757492 | 3300012683 | Vadose Zone Soil | RDLLRMRSNSLKHNNLMLRSERRERLESWAASDSPI* |
| Ga0137398_111968041 | 3300012683 | Vadose Zone Soil | ARPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASNSQI* |
| Ga0137397_101250421 | 3300012685 | Vadose Zone Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD* |
| Ga0137397_104530181 | 3300012685 | Vadose Zone Soil | LRGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY* |
| Ga0137397_110678412 | 3300012685 | Vadose Zone Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHGQY* |
| Ga0157293_102674962 | 3300012898 | Soil | MRSNPLKHDNLMLRSEHRERHEASAASDSQITHSQY* |
| Ga0137395_110698951 | 3300012917 | Vadose Zone Soil | LLRMRSNSLKHNNLMLRSERRERLEAWAASDSQT* |
| Ga0137396_103392911 | 3300012918 | Vadose Zone Soil | GLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY* |
| Ga0137396_110583601 | 3300012918 | Vadose Zone Soil | LRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY* |
| Ga0137394_108162512 | 3300012922 | Vadose Zone Soil | RMRSNLLKHNSLMLRSERRERLEAWTASDSPISHSQY* |
| Ga0137394_113609781 | 3300012922 | Vadose Zone Soil | LRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHGQY* |
| Ga0137359_117479581 | 3300012923 | Vadose Zone Soil | GLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137413_101822464 | 3300012924 | Vadose Zone Soil | MRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0137413_106673183 | 3300012924 | Vadose Zone Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQT* |
| Ga0137419_101913541 | 3300012925 | Vadose Zone Soil | LRGLLRMRSNLLKHNNLMLRSERSERLEAWAASDSPISHSQY* |
| Ga0137419_106176251 | 3300012925 | Vadose Zone Soil | RPVGGLLRMRSSLLKHNNLMLRSERRERLEAWTASDSPISHSQY* |
| Ga0137419_115156821 | 3300012925 | Vadose Zone Soil | RPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSPSSHSQYYLF* |
| Ga0137419_117493631 | 3300012925 | Vadose Zone Soil | RGLLRMRSNSLKHNNLMLRSERRERLEAWAASDSPISHSQC* |
| Ga0137419_119407541 | 3300012925 | Vadose Zone Soil | LRMRSNLLKHNNLMLRSERRERLEAWAASDQPISHRQG* |
| Ga0137416_105200341 | 3300012927 | Vadose Zone Soil | PLRGLLRMRSNLSKHNNLMLRSERRERLEAWAASDSPISHRYWS* |
| Ga0137404_113977791 | 3300012929 | Vadose Zone Soil | RGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHSQY* |
| Ga0137404_120408121 | 3300012929 | Vadose Zone Soil | LLRMRSNSLKHNNLMLRSERRERLEAWAASDSHI* |
| Ga0137410_104574032 | 3300012944 | Vadose Zone Soil | FARPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSLSSQYYLF* |
| Ga0137410_117755721 | 3300012944 | Vadose Zone Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSRY* |
| Ga0164302_109021962 | 3300012961 | Soil | RGLLRMRSDLLKHNDLMLRSERRERLEAWAASRY* |
| Ga0181517_102024933 | 3300014160 | Bog | GLLRMRSYPLKHNNLMLRSERRERLEAWAASDSPISHSQS* |
| Ga0181528_100501922 | 3300014167 | Bog | MRFNLLIQDNLMLRSEQRERLEAWAASDSPVSHVS* |
| Ga0181534_105465182 | 3300014168 | Bog | RSNLLKHNNLMLRSERRERLEAWAASDLSISHRQY* |
| Ga0182021_132238321 | 3300014502 | Fen | GLLRMRSKVLKQNNLMLRSERRERLEAWAATDSPN* |
| Ga0181519_101294211 | 3300014658 | Bog | RMRSNLLKHNNLMLRSERRERLEAWAASDSPISHRQY* |
| Ga0182030_103539133 | 3300014838 | Bog | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPVSHHQH* |
| Ga0182030_104810861 | 3300014838 | Bog | IGIAAHPSRRPLRGLLRMRSNLLKHNTLMLRSERRERLEAWAASDSPISHRQY* |
| Ga0137411_11378223 | 3300015052 | Vadose Zone Soil | LRGLLRMRSSLLKHNNLMLRSEQRERLEAWAASDSPISHSRY* |
| Ga0137405_12489211 | 3300015053 | Vadose Zone Soil | GDLLRMRSNPLKHNNLMLRSERRERLEAWAASDSQI* |
| Ga0137405_12831554 | 3300015053 | Vadose Zone Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSRN* |
| Ga0137418_100163815 | 3300015241 | Vadose Zone Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI* |
| Ga0137412_103480052 | 3300015242 | Vadose Zone Soil | GGLLRMRSKVLKQHNLMLRSERRERLEAWATSDSLISHSRY* |
| Ga0137412_103771861 | 3300015242 | Vadose Zone Soil | FNLLKHNNLMLRSERRERLEAWAATDSPISHSQY* |
| Ga0137403_100555441 | 3300015264 | Vadose Zone Soil | RRPLRDLLRMRSNSLKHNNLMLRSERRERLEAWR* |
| Ga0184608_100139074 | 3300018028 | Groundwater Sediment | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0190270_117542233 | 3300018469 | Soil | WPPQDEVNLLKRKNLMLRREQRERLEAWAASDLPISHSQY |
| Ga0190274_127167952 | 3300018476 | Soil | MRLKLLKHNNLMLRSEHRERLEAWAASDSLTHGRP |
| Ga0193722_10293081 | 3300019877 | Soil | MRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0193715_10259821 | 3300019878 | Soil | RMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0193713_10014281 | 3300019882 | Soil | RDLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI |
| Ga0193713_11506581 | 3300019882 | Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0193725_10480081 | 3300019883 | Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI |
| Ga0193725_11476711 | 3300019883 | Soil | LRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY |
| Ga0193747_10416221 | 3300019885 | Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSQISHSRY |
| Ga0193747_10420704 | 3300019885 | Soil | GNLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI |
| Ga0193729_11975451 | 3300019887 | Soil | RMMSNLLKHNNLMLRSERRERLEAWAASDSQISHSRY |
| Ga0193728_11116741 | 3300019890 | Soil | SRYAGMRSNLLKHNNLMLRSERRERLEAWAASDSPISQY |
| Ga0193755_11782841 | 3300020004 | Soil | LLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHRQY |
| Ga0193749_10121591 | 3300020010 | Soil | RPLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI |
| Ga0193734_10682401 | 3300020015 | Soil | PLRDLLRMRSDSLKHNNLMLRSEQRERLEAWAASGSQI |
| Ga0193721_10263651 | 3300020018 | Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISLSQY |
| Ga0193721_10934161 | 3300020018 | Soil | PVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASGSQI |
| Ga0193726_10004571 | 3300020021 | Soil | PLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASEQPISHSQY |
| Ga0193724_100018416 | 3300020062 | Soil | RGLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0193724_10003531 | 3300020062 | Soil | RDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI |
| Ga0179594_102522561 | 3300020170 | Vadose Zone Soil | FARPVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSPSSHSQYYLF |
| Ga0179596_103053831 | 3300021086 | Vadose Zone Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY |
| Ga0193719_101606521 | 3300021344 | Soil | GMRYSLLKHNDLMLRSERRERLEAWAASDSPISHSRY |
| Ga0193699_104037991 | 3300021363 | Soil | RMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD |
| Ga0210387_117284311 | 3300021405 | Soil | VLKQNNLMLRSERSERLEAWAASDSLILHSRHQTNR |
| Ga0210383_110443352 | 3300021407 | Soil | PSFETALTRLLRMRSKVLKQNNLMLRSERRERLEAWAASDSLILHSQY |
| Ga0222623_100317712 | 3300022694 | Groundwater Sediment | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQD |
| Ga0247779_11836372 | 3300022908 | Plant Litter | MRSNPLKHHNLMLRSEQRERLEAWAAGDSLVIHIQ |
| Ga0179589_101475992 | 3300024288 | Vadose Zone Soil | LRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0137417_11674371 | 3300024330 | Vadose Zone Soil | LRDLLRMRSNSLKHNSLMLRSERRERLEAWAASDSQI |
| Ga0209881_10053374 | 3300026273 | Soil | MRSNLLKHNNLMLRSERRERLEAWAASDEPISHRQY |
| Ga0209881_10306332 | 3300026273 | Soil | GLLRMRSNLLKHHNLMLRSEQRERLEAWAASDSPISHRQY |
| Ga0209881_11026011 | 3300026273 | Soil | PVGGLLRMRSNLLKHNNLMLRSERRERLEAWAASDKPISHSQY |
| Ga0209881_11430001 | 3300026273 | Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPVSQSQY |
| Ga0209881_11753522 | 3300026273 | Soil | GGLLRMRSNLLIHNNLMLRSERRERLEALATSDSPISHSQY |
| Ga0209240_10155391 | 3300026304 | Grasslands Soil | LRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0257162_10151841 | 3300026340 | Soil | PLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0257151_10142432 | 3300026341 | Soil | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHSQY |
| Ga0257148_10065011 | 3300026345 | Soil | RGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD |
| Ga0257166_10049261 | 3300026358 | Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAASDSPISHSRY |
| Ga0257146_10365942 | 3300026374 | Soil | LRGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY |
| Ga0257155_10202061 | 3300026481 | Soil | RSRYAGMRSNSLKHNNLMLRSERRERLEAWAVSDITGNF |
| Ga0257155_10447022 | 3300026481 | Soil | RPVGDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI |
| Ga0257153_10561341 | 3300026490 | Soil | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD |
| Ga0257159_10282531 | 3300026494 | Soil | DLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI |
| Ga0257157_10175751 | 3300026496 | Soil | LRMRSNLLKHNNLMLRSERRERLEAWAASDSRISHSQY |
| Ga0257164_10121811 | 3300026497 | Soil | IGIAAHPSRRPLRGLLRMRSNSLKHNNLMLRSERRERLEAWAVSDSQI |
| Ga0257156_10107591 | 3300026498 | Soil | GLLRMRSSLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0257156_10574861 | 3300026498 | Soil | LRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI |
| Ga0257165_10111161 | 3300026507 | Soil | DLLRMRSNLLKHNNLMLRSERRERLEAWAVSDSQI |
| Ga0257165_10631122 | 3300026507 | Soil | GLLRMRSNLLKHDNLMLRSERRERLEAWAASDQPISPSEY |
| Ga0257161_10308331 | 3300026508 | Soil | VNQFEVWYNSLKHNNLMLRSERRERLEAGAVSDSQI |
| Ga0257158_10133651 | 3300026515 | Soil | RGLLRMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0208983_10010625 | 3300027381 | Forest Soil | PLRDLLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI |
| Ga0209213_10135314 | 3300027383 | Forest Soil | LGDLLRMRSNSLKHNNLMLRSERRERLEAWAASNSQI |
| Ga0209213_10154051 | 3300027383 | Forest Soil | RDLLRMRSNSLKHNNLMLRSERRERLEAWAASGSQI |
| Ga0208985_10570991 | 3300027528 | Forest Soil | GRLLRCNELKHNNLMLRSEHRERLEAWATGDWLISHSQF |
| Ga0209106_10479441 | 3300027616 | Forest Soil | RSNLLKHNNLMLRSERRERLEAWAASDSPISHGQY |
| Ga0208988_10166541 | 3300027633 | Forest Soil | MAAAKTIVNRKSIFLRMRSNSLKHNNLMLRSERRERLEAWAASDSQI |
| Ga0208988_10434714 | 3300027633 | Forest Soil | RGLLRMRSNLLKHNNLMLRSERRERLEASAASDSPISHSQY |
| Ga0208988_10631891 | 3300027633 | Forest Soil | RGLLRMRSNLLKHNNLMLRSERRERLEAWAASESPISHSQY |
| Ga0208990_10809801 | 3300027663 | Forest Soil | LLKHNNLMLRSERRERLEAWAASDSPISHSQYWAVMAWD |
| Ga0209588_10818941 | 3300027671 | Vadose Zone Soil | VGGLLRMRSNLLKHNNLMLRSERRERLEAWAASNSPSSHSQYYLF |
| Ga0209011_10298921 | 3300027678 | Forest Soil | RPLRGLLRMRSNLLKHNNLMLRSERRERLEAWAASEQPISHSQYY |
| Ga0209464_103727592 | 3300027778 | Wetland Sediment | RSNLLKHNNLMLRSEQRERLEAWAASDSRISHGRY |
| Ga0209476_100460321 | 3300027802 | Activated Sludge | TLDMGHKRMRFTLLKRHNLMLRSERRERLEAWAASDSPISDSRY |
| Ga0209476_102818363 | 3300027802 | Activated Sludge | RMRFTLLKRHNLMLRSERRERLEAWAASDSPISDSRY |
| Ga0209068_103587112 | 3300027894 | Watersheds | GLLRMRSNLLKHNNLMLRSERRERLEAWAASDSQISHSQY |
| Ga0209069_100112671 | 3300027915 | Watersheds | LLRMRSNLLKHNNLMLRSERRERLEAWAASDSQISHSQY |
| Ga0209069_102824801 | 3300027915 | Watersheds | DLLRMRSNSLKHNNLMLRSERRERLEAWAASDSPI |
| Ga0209526_104784791 | 3300028047 | Forest Soil | RMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSEY |
| Ga0302145_102629581 | 3300028565 | Bog | MRSNVLKHNYLMLRSEQRERLEAWAASDSPISHRQ |
| Ga0307323_100819391 | 3300028787 | Soil | LKHNNLMLRSERRERLEAWAASDSPISHRQYQVSG |
| Ga0307305_102919171 | 3300028807 | Soil | AGMRSNLLKHNNLMLRSERRERLEAWAASDSPISHSQY |
| Ga0307305_103937252 | 3300028807 | Soil | DLLRMRSDSLKHNNLMLRSEQRERLEAWAASGSQI |
| Ga0302323_1016666781 | 3300031232 | Fen | LLRMRSNLLQHNNLMLRSERRERLEASAASDSPISHRQY |
| Ga0307408_1013649371 | 3300031548 | Rhizosphere | MRFNLLQHDNLMLRSEHRERLEAWATSDSPISHVL |
| Ga0316231_13569522 | 3300032722 | Freshwater | GLLRMRSNLLKHNNLMLRSEQRERLEAWATSDSPISHR |
| Ga0316605_121292841 | 3300033408 | Soil | MRFNLVKHDNLMLRSERRERLEAWAASDSPISHSQY |
| ⦗Top⦘ |