NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022580

Metagenome / Metatranscriptome Family F022580

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022580
Family Type Metagenome / Metatranscriptome
Number of Sequences 213
Average Sequence Length 99 residues
Representative Sequence MACSGSWPLIDYLVSNDNGSIEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Number of Associated Samples 141
Number of Associated Scaffolds 213

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.35 %
% of genes near scaffold ends (potentially truncated) 90.61 %
% of genes from short scaffolds (< 2000 bps) 99.06 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.775 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(54.460 % of family members)
Environment Ontology (ENVO) Unclassified
(76.526 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(64.319 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.94%    β-sheet: 6.50%    Coil/Unstructured: 84.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 213 Family Scaffolds
PF13650Asp_protease_2 7.04
PF13975gag-asp_proteas 3.29
PF00078RVT_1 0.47



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.24 %
UnclassifiedrootN/A3.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005330|Ga0070690_100680062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii788Open in IMG/M
3300005335|Ga0070666_10285089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1174Open in IMG/M
3300005347|Ga0070668_100546756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1007Open in IMG/M
3300005347|Ga0070668_101154794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii700Open in IMG/M
3300005347|Ga0070668_101266610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii669Open in IMG/M
3300005347|Ga0070668_102166373Not Available513Open in IMG/M
3300005353|Ga0070669_101772475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii538Open in IMG/M
3300005355|Ga0070671_101644484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii569Open in IMG/M
3300005365|Ga0070688_100305899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum1150Open in IMG/M
3300005365|Ga0070688_100495646All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii920Open in IMG/M
3300005438|Ga0070701_10235965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1098Open in IMG/M
3300005467|Ga0070706_102116987Not Available509Open in IMG/M
3300005548|Ga0070665_102358899Not Available535Open in IMG/M
3300005549|Ga0070704_101152780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii706Open in IMG/M
3300005615|Ga0070702_100534142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii867Open in IMG/M
3300005617|Ga0068859_101670264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii703Open in IMG/M
3300005618|Ga0068864_100882453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii882Open in IMG/M
3300005618|Ga0068864_101511492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii674Open in IMG/M
3300005719|Ga0068861_100649245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii974Open in IMG/M
3300005719|Ga0068861_101910871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii591Open in IMG/M
3300005841|Ga0068863_102074957Not Available578Open in IMG/M
3300005842|Ga0068858_101646493Not Available633Open in IMG/M
3300005843|Ga0068860_101392297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta722Open in IMG/M
3300005843|Ga0068860_102460090Not Available540Open in IMG/M
3300009092|Ga0105250_10475796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300009092|Ga0105250_10606289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum508Open in IMG/M
3300009177|Ga0105248_13019839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum536Open in IMG/M
3300009553|Ga0105249_12031392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300009553|Ga0105249_12895185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii551Open in IMG/M
3300009553|Ga0105249_13354072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii515Open in IMG/M
3300009976|Ga0105128_110531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum635Open in IMG/M
3300009977|Ga0105141_108308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta891Open in IMG/M
3300009980|Ga0105135_105742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum833Open in IMG/M
3300009980|Ga0105135_117172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida614Open in IMG/M
3300009980|Ga0105135_122085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum567Open in IMG/M
3300009981|Ga0105133_104492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum871Open in IMG/M
3300009994|Ga0105126_1028671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum645Open in IMG/M
3300009995|Ga0105139_1100769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii555Open in IMG/M
3300009995|Ga0105139_1102352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum551Open in IMG/M
3300010371|Ga0134125_10880516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum984Open in IMG/M
3300010371|Ga0134125_12583920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum552Open in IMG/M
3300010371|Ga0134125_12685382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum541Open in IMG/M
3300010396|Ga0134126_11365415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum784Open in IMG/M
3300010399|Ga0134127_12809990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300010400|Ga0134122_13051979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum523Open in IMG/M
3300010403|Ga0134123_12863392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii551Open in IMG/M
3300014325|Ga0163163_12135464All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum619Open in IMG/M
3300014325|Ga0163163_12426492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum583Open in IMG/M
3300014325|Ga0163163_13059419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum522Open in IMG/M
3300014326|Ga0157380_12312945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum602Open in IMG/M
3300014968|Ga0157379_12501971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii516Open in IMG/M
3300014968|Ga0157379_12612100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015270|Ga0182183_1014135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum886Open in IMG/M
3300015273|Ga0182102_1012426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum713Open in IMG/M
3300015280|Ga0182100_1090353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii521Open in IMG/M
3300015284|Ga0182101_1042061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum675Open in IMG/M
3300015284|Ga0182101_1077207Not Available552Open in IMG/M
3300015284|Ga0182101_1094357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii513Open in IMG/M
3300015284|Ga0182101_1097646All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii507Open in IMG/M
3300015284|Ga0182101_1099038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii504Open in IMG/M
3300015297|Ga0182104_1047082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum699Open in IMG/M
3300015297|Ga0182104_1117714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015301|Ga0182184_1057192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum612Open in IMG/M
3300015301|Ga0182184_1069476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum574Open in IMG/M
3300015306|Ga0182180_1039647All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300015306|Ga0182180_1043208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum666Open in IMG/M
3300015306|Ga0182180_1067073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum570Open in IMG/M
3300015306|Ga0182180_1070757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii559Open in IMG/M
3300015306|Ga0182180_1094175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii504Open in IMG/M
3300015310|Ga0182162_1120807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum517Open in IMG/M
3300015310|Ga0182162_1121372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300015312|Ga0182168_1021456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum963Open in IMG/M
3300015312|Ga0182168_1099744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum570Open in IMG/M
3300015313|Ga0182164_1083584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum610Open in IMG/M
3300015313|Ga0182164_1090808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum591Open in IMG/M
3300015318|Ga0182181_1091628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum547Open in IMG/M
3300015319|Ga0182130_1075382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum628Open in IMG/M
3300015320|Ga0182165_1100801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum586Open in IMG/M
3300015320|Ga0182165_1123440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum541Open in IMG/M
3300015324|Ga0182134_1071969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum665Open in IMG/M
3300015325|Ga0182148_1124965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum535Open in IMG/M
3300015326|Ga0182166_1088005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum609Open in IMG/M
3300015326|Ga0182166_1127588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300015327|Ga0182114_1140332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum535Open in IMG/M
3300015327|Ga0182114_1152205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum516Open in IMG/M
3300015327|Ga0182114_1159970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum504Open in IMG/M
3300015328|Ga0182153_1125571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum544Open in IMG/M
3300015329|Ga0182135_1138310All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300015330|Ga0182152_1090106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum624Open in IMG/M
3300015331|Ga0182131_1119736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii560Open in IMG/M
3300015331|Ga0182131_1140442All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii525Open in IMG/M
3300015334|Ga0182132_1081234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii680Open in IMG/M
3300015334|Ga0182132_1105749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum613Open in IMG/M
3300015334|Ga0182132_1131805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum560Open in IMG/M
3300015335|Ga0182116_1117655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300015335|Ga0182116_1120569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum599Open in IMG/M
3300015336|Ga0182150_1158781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300015337|Ga0182151_1084474All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum659Open in IMG/M
3300015337|Ga0182151_1136259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum546Open in IMG/M
3300015339|Ga0182149_1093727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum650Open in IMG/M
3300015340|Ga0182133_1140266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum577Open in IMG/M
3300015340|Ga0182133_1186292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii509Open in IMG/M
3300015348|Ga0182115_1286768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum520Open in IMG/M
3300015348|Ga0182115_1301842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii505Open in IMG/M
3300015349|Ga0182185_1118489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum772Open in IMG/M
3300015349|Ga0182185_1143693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300015349|Ga0182185_1192599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum615Open in IMG/M
3300015349|Ga0182185_1200342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum604Open in IMG/M
3300015350|Ga0182163_1204801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum618Open in IMG/M
3300015350|Ga0182163_1251554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum554Open in IMG/M
3300015350|Ga0182163_1256801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta548Open in IMG/M
3300015352|Ga0182169_1250437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum576Open in IMG/M
3300015352|Ga0182169_1275673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii545Open in IMG/M
3300015352|Ga0182169_1289959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum529Open in IMG/M
3300015353|Ga0182179_1183619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum662Open in IMG/M
3300015353|Ga0182179_1193852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum645Open in IMG/M
3300015353|Ga0182179_1241018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum582Open in IMG/M
3300015354|Ga0182167_1275394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300015354|Ga0182167_1292658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum579Open in IMG/M
3300015354|Ga0182167_1343138All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii523Open in IMG/M
3300017408|Ga0182197_1073759All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii662Open in IMG/M
3300017412|Ga0182199_1134986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum593Open in IMG/M
3300017414|Ga0182195_1172546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum558Open in IMG/M
3300017414|Ga0182195_1185713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum541Open in IMG/M
3300017421|Ga0182213_1255441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum501Open in IMG/M
3300017422|Ga0182201_1009319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1216Open in IMG/M
3300017422|Ga0182201_1059179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum684Open in IMG/M
3300017422|Ga0182201_1128820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii524Open in IMG/M
3300017432|Ga0182196_1092531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum604Open in IMG/M
3300017439|Ga0182200_1135724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum539Open in IMG/M
3300017440|Ga0182214_1112791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum586Open in IMG/M
3300017440|Ga0182214_1137996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii537Open in IMG/M
3300017445|Ga0182198_1061253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum789Open in IMG/M
3300017446|Ga0182217_1074203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum794Open in IMG/M
3300017446|Ga0182217_1122983All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum610Open in IMG/M
3300017446|Ga0182217_1140741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum568Open in IMG/M
3300017691|Ga0182212_1159626Not Available515Open in IMG/M
3300017692|Ga0182210_1082578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum681Open in IMG/M
3300017693|Ga0182216_1149359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii592Open in IMG/M
3300017693|Ga0182216_1197895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum529Open in IMG/M
3300017694|Ga0182211_1060695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum870Open in IMG/M
3300020023|Ga0182178_1004240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum888Open in IMG/M
3300020033|Ga0182146_105225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum546Open in IMG/M
3300025903|Ga0207680_11354174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300025925|Ga0207650_10931284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum738Open in IMG/M
3300025931|Ga0207644_11615873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum544Open in IMG/M
3300026035|Ga0207703_12036789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum550Open in IMG/M
3300026088|Ga0207641_12324996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum535Open in IMG/M
3300026095|Ga0207676_11912536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii592Open in IMG/M
3300028050|Ga0268328_1006237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1106Open in IMG/M
3300028050|Ga0268328_1041261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum616Open in IMG/M
3300028050|Ga0268328_1058489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii543Open in IMG/M
3300028051|Ga0268344_1008668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum703Open in IMG/M
3300028053|Ga0268346_1033102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum554Open in IMG/M
3300028054|Ga0268306_1033367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum511Open in IMG/M
3300028056|Ga0268330_1014128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum834Open in IMG/M
3300028056|Ga0268330_1042794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum578Open in IMG/M
3300028057|Ga0268352_1037943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum536Open in IMG/M
3300028058|Ga0268332_1034269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum681Open in IMG/M
3300028058|Ga0268332_1040048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum646Open in IMG/M
3300028062|Ga0268342_1034829All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300028064|Ga0268340_1051327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum611Open in IMG/M
3300028064|Ga0268340_1061452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum572Open in IMG/M
3300028064|Ga0268340_1074748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum531Open in IMG/M
3300028147|Ga0268303_103166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum677Open in IMG/M
3300028148|Ga0268354_1020669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum539Open in IMG/M
3300028152|Ga0268336_1007717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum762Open in IMG/M
3300028153|Ga0268320_1015293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300028153|Ga0268320_1019188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum579Open in IMG/M
3300028153|Ga0268320_1021987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300028154|Ga0268341_1017175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum610Open in IMG/M
3300028154|Ga0268341_1021585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum570Open in IMG/M
3300028155|Ga0268349_1038381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum623Open in IMG/M
3300028157|Ga0268318_101405All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300028246|Ga0268351_1013711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum792Open in IMG/M
3300028248|Ga0268312_1019190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum628Open in IMG/M
3300028262|Ga0268310_1042132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum542Open in IMG/M
3300028379|Ga0268266_11972997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum557Open in IMG/M
3300028465|Ga0268301_103230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum602Open in IMG/M
3300028467|Ga0268333_1012402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum528Open in IMG/M
3300028468|Ga0268317_1001798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum904Open in IMG/M
3300028469|Ga0268337_1012268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum581Open in IMG/M
3300028471|Ga0268323_1020067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum519Open in IMG/M
3300028472|Ga0268315_1025456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum517Open in IMG/M
3300028475|Ga0268327_1016755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum586Open in IMG/M
3300028526|Ga0268339_1002216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum936Open in IMG/M
3300028529|Ga0268311_1024803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum533Open in IMG/M
3300030772|Ga0061013_12661343All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300032465|Ga0214493_1110182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum651Open in IMG/M
3300032465|Ga0214493_1163721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300032467|Ga0214488_1042853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum992Open in IMG/M
3300032469|Ga0214491_1160049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum521Open in IMG/M
3300032490|Ga0214495_1018581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1488Open in IMG/M
3300032502|Ga0214490_1131574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum568Open in IMG/M
3300032502|Ga0214490_1148651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300032548|Ga0214483_1035040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum843Open in IMG/M
3300032589|Ga0214500_1181521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum597Open in IMG/M
3300032625|Ga0214501_1218956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum605Open in IMG/M
3300032697|Ga0214499_1172084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii671Open in IMG/M
3300032698|Ga0214485_1042350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum872Open in IMG/M
3300032698|Ga0214485_1046085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum837Open in IMG/M
3300032699|Ga0214494_1004653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2001Open in IMG/M
3300032758|Ga0314746_1053428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum936Open in IMG/M
3300032791|Ga0314748_1037106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1025Open in IMG/M
3300032811|Ga0314718_1008665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1189Open in IMG/M
3300032916|Ga0314734_1041032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii930Open in IMG/M
3300032959|Ga0314738_1002770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2236Open in IMG/M
3300033523|Ga0314768_1336525All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum525Open in IMG/M
3300033526|Ga0314761_1132753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum549Open in IMG/M
3300033530|Ga0314760_1141457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum589Open in IMG/M
3300033531|Ga0314756_1054504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum704Open in IMG/M
3300033534|Ga0314757_1153765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii553Open in IMG/M
3300033535|Ga0314759_1037684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1400Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere54.46%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere17.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.63%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated4.23%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.88%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.41%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.41%
Fungi-Associated Bovine RumenHost-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300020033Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028051Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028057Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028147Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028148Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028154Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028155Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028157Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028246Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028248Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028465Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028467Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028468Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028469Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028472Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028475Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300030772Coassembly of Cow X SwitchgrassHost-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032811Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032916Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033531Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070690_10068006213300005330Switchgrass RhizosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFIS
Ga0070666_1028508913300005335Switchgrass RhizosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRP
Ga0070668_10054675623300005347Switchgrass RhizosphereMACSGSWLLIDYLVSNDNGSIETASPCGWPNNFSCHLPVFAADLVDNEDSSAFAAGFSDDGKLGYGFTSANDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALL
Ga0070668_10115479413300005347Switchgrass RhizosphereMMASSSSWLSIDYLALRNDRSIEAASPCGWPNSFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDP
Ga0070668_10126661023300005347Switchgrass RhizosphereMACSGSWPLIDYLVSNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIALL
Ga0070668_10216637313300005347Switchgrass RhizosphereMMACSGSWPLIDYLVSDDDGSIEAASPCGWPNNFSCHLPVFAADLVDSEDSPAFAAGFSDDGKLGYGFMSADDLEEVDIGPGDKPRPTFISKKLDPVLRE
Ga0070669_10177247513300005353Switchgrass RhizosphereMMASSSSWLSIDYLALRNDRSIEAASPCGWPNNFSCHLPVFAADIVDKEDSLAFTVDFLDDGKLGYGFTSADDLEEVDIGPGDK
Ga0070671_10164448423300005355Switchgrass RhizosphereMASSSSWLSIDYLALRNNRSIEAASPCGWPSNLSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVD
Ga0070688_10030589923300005365Switchgrass RhizosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKE
Ga0070688_10049564613300005365Switchgrass RhizosphereMMASSSSWLSIDYLALRNDRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLD
Ga0070701_1023596523300005438Corn, Switchgrass And Miscanthus RhizosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSTDDLEEVDIGPGDKPRPTFISSK
Ga0070706_10211698713300005467Corn, Switchgrass And Miscanthus RhizosphereMACSGSWLLIDYLVSNDDGIIEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIALL
Ga0070665_10235889923300005548Switchgrass RhizosphereMACSGSWPLIDYLISNYNGSVEAASPRGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEM
Ga0070704_10115278013300005549Corn, Switchgrass And Miscanthus RhizosphereMACSGSWPLIDYLVSNDNGSIEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0070702_10053414223300005615Corn, Switchgrass And Miscanthus RhizosphereMACSGSWPLIDYLVPNDNGSIEAASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMI
Ga0068859_10167026423300005617Switchgrass RhizosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAADFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPALR
Ga0068864_10088245313300005618Switchgrass RhizosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTF
Ga0068864_10151149223300005618Switchgrass RhizosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSPAFAVGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0068861_10064924513300005719Switchgrass RhizosphereMACSGSWPLIDYLISNYNGSVEAASPRGWPNNFSCHLPVFAADLADNEDSPAFAASFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0068861_10191087113300005719Switchgrass RhizosphereMMACSGSWPLVDYSALSDNRSIEAASPCGWPNNFSCHLPVFAADLVDNGDPSAFAAGLSDDGKLGYGFTLANDLEEIDIGTGDKPRP
Ga0068863_10207495713300005841Switchgrass RhizosphereVACSGSWLLVDYLVSNDNGSIETTSPCGWPNNFSCHLPVFAADLVDNENSPAFAVGFSDDGKLGYGFTSADNLEEVDIGPGDKPRPTFISKKVGSDLA*
Ga0068858_10164649323300005842Switchgrass RhizosphereMACSGSWPLIDYLVPNDNGSIEAANPCGWPNNFSCHLPVFAADLVDNEDSPALAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPILREEMIALLK
Ga0068860_10139229723300005843Switchgrass RhizosphereVACSGSWLLVDYLVSNDNGSIETTSPCGWPNNFSCHLPVFAADLVDNENSPAFAVGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKVGSDLA*
Ga0068860_10246009013300005843Switchgrass RhizosphereMMASSSSWLSIDYLALRNNRSIEAASPCGWLNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALL
Ga0105250_1047579623300009092Switchgrass RhizosphereMASSSSWLSIDYLALKNNRSIEAASPCGWPNNLSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIG
Ga0105250_1060628923300009092Switchgrass RhizosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALL
Ga0105248_1301983923300009177Switchgrass RhizosphereMMASSSSWLSIDYLALRNDRSIEAASPCGWPNNFSCHLPVFVADIVDREDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPWPIFISSKLDPALREEMITLLKEYR
Ga0105249_1203139223300009553Switchgrass RhizosphereMACSGSWPLIDYLVPNANGRTEAASPCGWPSNFSCHLSVFAADLVDNEDSPAFAAGFSDNGKLGYGFTSADDLEEVDIGPGD
Ga0105249_1289518513300009553Switchgrass RhizosphereESCLGSELLHHVHTMACSGSWPLIDYLVQNDDGSIEAASPCGWPHNFSCHLPVFAADLEDNEDSPAFATGFLDDGKLGYGFTSADDLEEVDIGPGDKPHPTFISKKLDPVLREEMIALLKE*
Ga0105249_1335407213300009553Switchgrass RhizosphereMACSGSWPLIDYLVSNDNGSVEAASPCGWPNNFSCHLPVFAADLVDNRNSPAFADGFSDDGKLGYGFTSADDLEEVDIGPGDKPWPTFISKKLDPALREEMIALLKEYRD
Ga0105128_11053123300009976Switchgrass AssociatedMAYSGSWPLIDYLISNDNGIMEAASPCGWSNNFSCHLPVFAADLVDNEDSIAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISRKL
Ga0105141_10830813300009977Switchgrass AssociatedMACSGSWLLIDYLVSNDNGSIKTASPGGWPNNFSCHLPVFAADLMDSEDSPAFAAGFSDDGKMGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIALLKEHRDARTG*
Ga0105135_10574223300009980Switchgrass AssociatedMACSASWPLVDYLVPNANGRTEAASPCGWPSNFSCHLPVFAADLVDNKDSPAFAAGFSDDGKLGYGFTSADDLEEIDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDCFA
Ga0105135_11717213300009980Switchgrass AssociatedHHVHTMACSGSWPLINYLISNDNGSIEAASPRGWPNNFSCHLPVFAADLADDEDSLAFAVDFSDDGKLGYGFTSADDLEEIDIGPRDKPRPTFISKKLDPALREEMIELLKEYQDCFA*
Ga0105135_12208513300009980Switchgrass AssociatedMACSSSWPLIDYLVSNDNGSVEAASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGA
Ga0105133_10449223300009981Switchgrass AssociatedMMACSGSWPLIDYLALNDNRSIEAASPCGWPNNFSCHLPVFAADLVDNGDSPAFAAGFSDDSKLGYGFMSADDLEEVDIGPGDKPRPTFISKKLDPVLRKEMIVLLKE*
Ga0105126_102867113300009994Switchgrass AssociatedMACSGSWPLVDYLVSNDNGSIEAASPCGWPNNFSRHHPVFVADLVDNENSLAFTAGFSDDGKLGYRFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0105139_110076923300009995Switchgrass AssociatedMLVERPVPAMCSEFLHHVHTMACSGSWPLIDYLVPNDNGSMEAASPCGWLNNFSCHLPMFAADLVDNEDSPAFAAGFSDDGKLGYGFTS
Ga0105139_110235213300009995Switchgrass AssociatedMMASSSSWLSIDYLALRNDRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFIS
Ga0134125_1088051623300010371Terrestrial SoilMASSSSWLSIDYLALKNNRSIEAASPCGWPNNLSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISRKLDLVLREEMITLLKE
Ga0134125_1258392013300010371Terrestrial SoilMACSGSWPLIHYLISNYNGSIEAASPCGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLR
Ga0134125_1268538223300010371Terrestrial SoilMASSGRWPLIDYLVLDNNGSIEAASPCDWPNNFSCHLPVFAANLVDNEDSPAFAAGFSDDGNLGYGFTSADDLEEVDIGAGDKPRLTFISKKLDPVLREEMITLLKE
Ga0134126_1136541523300010396Terrestrial SoilMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIA
Ga0134127_1280999023300010399Terrestrial SoilMACSGSWPLIDYLVLNANGRIETASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFIS
Ga0134122_1305197923300010400Terrestrial SoilLGSELLHDEYTMACSGSWPLIDYLVPNDNGSIEAASPCGLPNNFSCHLLVFAADLVDNEDSPTFAAGFSDDGKLGYGFTSADELEEVDIGPVDKPRPTFISK*
Ga0134123_1286339213300010403Terrestrial SoilMACSGSWPLIHYLISNYNGSVEAASPRGWPNIFSRHLPVFAADLEDDEDSLAFAANFSDDGKLGYGFTSADDLEEIDIGPGDKPWPTFISKKLDPALREEMIALLSVAEPPKLSRLKCAG
Ga0163163_1213546413300014325Switchgrass RhizosphereMACSGSWPLIDYLVPNANGRTEAASPCGWPSNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREE
Ga0163163_1242649223300014325Switchgrass RhizosphereMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLLVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALRE
Ga0163163_1305941913300014325Switchgrass RhizosphereMACSGSWPLIDCLISNDNGSVEAANPRGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREE
Ga0157380_1231294513300014326Switchgrass RhizosphereMACSGSWPLIDYLVLNDNGSIETASPCGWPNNFSSHLPVFATDLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLSEEIIALLKEYR
Ga0157379_1250197113300014968Switchgrass RhizosphereMACSGSWPLIDYLVSNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPILREEMIALLKEY
Ga0157379_1261210013300014968Switchgrass RhizosphereMACSGSWPLIDYLVPNDNGSIEAAIPCGWPNNFSCHIPVFAADLVYNEDSPAFAASFSDDGKLGYGFTSADDLEEVDIGPGDKP
Ga0182183_101413523300015270Switchgrass PhyllosphereMACSGSWLLIDYLVSNDNGSIETASPCGWPNNFSCHLPVFATNLVDNEDSPAFAAGFSDDGKLGYGFTLADDLEEVDISPGDKPRLTFISKKMDPVLHEEMISLLKEYRDCFA*
Ga0182102_101242613300015273Switchgrass PhyllosphereMACSGSWPLIDYLISNYNGSVEAASPRGWPNNFSCHLPVFAVDLADDKDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPR
Ga0182100_109035313300015280Switchgrass PhyllosphereMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALRE
Ga0182101_104206113300015284Switchgrass PhyllosphereMACSGSWPSSEYSVPNDNGNTETASPCDWLNNFSYHLSVFAVNIAHDDESPAFALDFLDDGKIGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREKMIAL
Ga0182101_107720713300015284Switchgrass PhyllosphereMACSGSWPLVDYLVPNANGRTEAASPCGWPSNFSCHLPVFAADLVDNEDSPKFAAGFLDDGKLGYGFTLADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDCF
Ga0182101_109435713300015284Switchgrass PhyllosphereMACSGSWPLIDYLIVNDNGSIEAASPFGWPNNFCCHLPVFAADLVDNEDSPAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMI
Ga0182101_109764623300015284Switchgrass PhyllosphereMYIRWPALAVWPLIDYLVPNGNGSIEVVSPCGWPNNFSCHLPVFATDLVDNEDSPAFAAGFSDNGKLGYGFTSADDLEEVDIGPGDKPQSTFISKKLDPAL*
Ga0182101_109903813300015284Switchgrass PhyllosphereMACSGSWPVIDYLISNDNGSTETASPCGWPNNFSCHLSVFAANLEDNEDSPAFAAGFSDDGKLGSGFTSADGLEEVDIGTWDKPQPTFISKKLDRIWRKRMI
Ga0182104_104708223300015297Switchgrass PhyllosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKL
Ga0182104_111771413300015297Switchgrass PhyllosphereMACSGSWPLIDYLVPNANGRTEAASPCGWPSNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPG
Ga0182184_105719213300015301Switchgrass PhyllosphereMACSGSWPLVDYLISNDNGSVEAANPCNWPNNFSCHLPVFAADLVDNKDSLAFATGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREDHIAERVPGFRV*
Ga0182184_106947623300015301Switchgrass PhyllosphereMACSRPLIDYLVSNDNGSTETASPCGWQNNFSCHLAVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKP
Ga0182180_103964713300015306Switchgrass PhyllosphereMACSGSWPFVDYLVPNANGRTEAASPCGWPSNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEIDIGPGDKPR
Ga0182180_104320823300015306Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGIIEAASPCGWPHNFSCRLPVFAAGLEDNEDSPAFAAGFSDDGKLGYGFTLADDLEEVDIGPGDKPRPTFISK
Ga0182180_106707323300015306Switchgrass PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFVSKKLDPVLREEMIALLKE
Ga0182180_107075713300015306Switchgrass PhyllosphereMACSCSWPVIDYLVSNDNGSMETASPCGWPNNFSCHLPVFATDLVDNEDLPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKSRPTFISKTLDPVLREEMISLLKVYRDCFA*
Ga0182180_109417513300015306Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGSIETASPCSWPNNFSCHIPAFAADLMDSEDSPAFAAGFSDDGKMGYGFTSADDLEEVDISPGDKPRPTFISKNLDPILREEMIALLK
Ga0182162_112080723300015310Switchgrass PhyllosphereMACSGSWPLIDYLVSDDNGSIEAASPCGWPNNFSCHLPVFAADLVDSEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLD
Ga0182162_112137213300015310Switchgrass PhyllosphereMACSGSWPLIGYLISNDNGSVEAANPCGWPNNFSCHLPVFAADLVDNEDSLAFATGFSDDGKLRYGFTSADDLEEVDIDPRD
Ga0182168_102145623300015312Switchgrass PhyllosphereMACSGSWPLIDYLISNDNRSVEAASPRGWPNNFSCHLPVFAADLVHNEDSPAFAAGFSDDGKLGYGFTLADDLEEVDIGPGDKPRPTFISKKLDPVLR
Ga0182168_109974423300015312Switchgrass PhyllosphereMACSGSWPLIEYLILNGNGSIEAASPCGWPNNFYCHLPVFAADLVDNEDSPAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFIS
Ga0182164_108358423300015313Switchgrass PhyllosphereMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0182164_109080813300015313Switchgrass PhyllosphereMACSGSWPFLDYLVLNGNGSIEAASPCGWPNNFSCHLPVFAADLADDEGSSAFATDFSDDGKLGYGFTSADDLEEVDIGPGDKP
Ga0182181_109162823300015318Switchgrass PhyllosphereMMACSGSWPLIDYLVLNDNGSIETASPCGWPNNFSSHLPVFATDLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIA
Ga0182130_107538213300015319Switchgrass PhyllosphereMMACSGSWPLIDYLVLNDNGSIETASPCGWPNNFSSHLLVFATDLVDNEDSPAFAAGFSDDGKLGYGFRSADDLEEVDIGPGD
Ga0182165_110080123300015320Switchgrass PhyllosphereMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAANFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALR
Ga0182165_112344013300015320Switchgrass PhyllosphereMACSGSWPLIDYLVPNDNGSIKAASPCGWPNNLSCHLPVFVADIVDSEDSLAFAIDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTF
Ga0182134_107196923300015324Switchgrass PhyllosphereMACSGSWPVIDYLVSNDNGSTETASPCGWPNNFSCHLSVFAADLEDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIALLKDTFWRV
Ga0182148_112496523300015325Switchgrass PhyllosphereMACSGSWPLIDYLVSDDNGSIEAASPCGWPDNFSYHLPVFAADLVDNKDSPAFAAGFSDNGKLGYGFTSADDLEEVDIGPGDKPRPTFIS
Ga0182166_108800513300015326Switchgrass PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFPSANDLEEVDIGPGDKPRPTFISKKLDPVLRKEMIALLKEYRDCF
Ga0182166_112758823300015326Switchgrass PhyllosphereMACSGSWPLIHYLISNYNGSIEVASPCGWPNNFSCHLPVFAADLADHEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFI
Ga0182114_114033213300015327Switchgrass PhyllosphereMACSASWPLIDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEY
Ga0182114_115220513300015327Switchgrass PhyllosphereMACSGSWPLIDYLISNYNGSVEAASPRGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0182114_115997023300015327Switchgrass PhyllosphereMACSSSWPLIDYLVLNDNGSIETASPCSWPNNFSCHFPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVL
Ga0182153_112557123300015328Switchgrass PhyllosphereMACSGSWPLIDYLVSNDDRSIEAASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMI
Ga0182135_113831013300015329Switchgrass PhyllosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVNNKDSPAFAAGFSDDGKLGYGFTLADDLEEVDIGPGDKPRPTFI
Ga0182152_109010613300015330Switchgrass PhyllosphereMACSSSWPLIDYLVSNDNGSVEAASPCGWPNNFSCHLPVFAANLVDNRNSPAFADGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKKY
Ga0182131_111973613300015331Switchgrass PhyllosphereMACSGSWPLINYVVSNNDRSIEAASPCNWPYNFSCHRPVFAADLVDNEDSPEFAAGFLDDGKLGYGFTSADDLEEVDICPGDKPQPTFISKKLDPALREEMIALLK*
Ga0182131_114044213300015331Switchgrass PhyllosphereMACSSSWPLIDYLVSDDDGSIEAASPCGWPNNFSCHLPVFAADLVDNEDSPVFAAGFSDDGKLGYEFTSANDLEEVDIGPGDKPRPTFISKKLDPVLREEM
Ga0182132_108123423300015334Switchgrass PhyllosphereMACSGSWPFIDYLVSNDDKSIEAASPCGWPNNFSCHFPMFAADLVDNEDSPAFAAGFLDDGKLGYGFTSADDLEEVDIGPGGKPRPTFIRKKLDPILR*
Ga0182132_110574923300015334Switchgrass PhyllosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPTFAAGFSDDGKLGYGFTSAYDLEEVDIGPGD
Ga0182132_113180513300015334Switchgrass PhyllosphereMACSSSWPLIDYLISNDNGSVEEASPRGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSANDLEEVDIGPGDKPRPTF
Ga0182116_111765513300015335Switchgrass PhyllosphereMACSGSWPLIDYLVLNDNGSIETASPCGWPNNFSSHLPVFATDLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDK
Ga0182116_112056923300015335Switchgrass PhyllosphereMACSGSWPLVDYLVSNDNGSIEAASPCGWPNNFSRHLPVFAADLVDNENSLAFAASFSDDGKLGYRFTSADDLEEVDIGPGDKPRPTFISKKLDPTLR
Ga0182150_115878123300015336Switchgrass PhyllosphereMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEIDIGPGDKP
Ga0182151_108447413300015337Switchgrass PhyllosphereMACSGSWLLIDYLVSNDNGSIETASPCGWPNNFSCHLPVFAADLVDNEDSPAFAASFSNDGKLGYGFTSADDLEEVDIGPGDKPRPTFINKKLDPVLREEMIALLKEYRD
Ga0182151_113625923300015337Switchgrass PhyllosphereMACSASWPLIDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADELEEVDIGPGDKPRSTFISKKLDPVLREEMIALLKE
Ga0182149_109372713300015339Switchgrass PhyllosphereMACSGSWPSSEYSVPNDNGNTETASPCDWLNNFSYHLPVFAVNIAHDDESPAFALDFSDDGKIGYGFTSADDLEEVDIGPGEKPRPTFISKKLDPVL
Ga0182133_114026613300015340Switchgrass PhyllosphereMACSGSWPLVDYLVPNANGRTEAASPCGWPSNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEIDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDCF
Ga0182133_118629213300015340Switchgrass PhyllosphereMACSGSWPLIDFWVSNDNGRVEAASPRGWPNNFSYHLSVFAADLVDNGDSLAFAADISDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISRKLDPAL*
Ga0182115_128676813300015348Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGIIEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAAGFSDDGKLGYGFTSADDLKEVDIGPGDKPRLTFISKKLDP
Ga0182115_130184213300015348Switchgrass PhyllosphereMACYGSWPLIDYLVSNDNGSIETASPCGWQNNFSCHFPVFAADLVDNEDSPAFAAGFSDDGKLRYGFTSADDLEDVDIGPGDKPRPIFISKKLDPV
Ga0182185_111848923300015349Switchgrass PhyllosphereMACSGCWPLINYLVSDDDGSIEAASPCGWPNNFSCHLPVFAADLVDNEDSPVFAAGFSDDGKLGYEFTSANDLEEVDIGPGDKPRPTFISKKLDPVLREE
Ga0182185_114369323300015349Switchgrass PhyllosphereMACSGGWPLIDYLVSNDNGIMESASPCSWPNNISCHLSVFATDLAGDEDSLAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKP
Ga0182185_119259923300015349Switchgrass PhyllosphereMACSGSWPLINYLVSDDNGSIEAASPCGWPNNFSCHLPVFTADLVDNEDLLAFATGFSDDDKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIALLKE
Ga0182185_120034213300015349Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGIIKAASPCGWPNIFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKL
Ga0182163_120480113300015350Switchgrass PhyllosphereMASSSSWLSIDYLALKNNRSIEAASPCGWPNNLSCHLPVFPADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRLTFINSKLDPA
Ga0182163_125155413300015350Switchgrass PhyllosphereMTGPKKIEKSCVGSELLHHVYTMACSSSWPLIDYLVSNDNGSVEAASPCGWPNNFSCHLPVFAADLVDNRNSPAFADGFSDDSKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPILREEMIA
Ga0182163_125680113300015350Switchgrass PhyllosphereNDNGSIETASPCGWPNNFSCHLPVFAADLVDNENSPAFAAGFSDDGKLGYGFKSANDLEEVDIGPGDKPRPTFISKKVGSDLA*
Ga0182169_125043723300015352Switchgrass PhyllosphereMMACSGSGPLIDYLVSDYNGSIEAASPCGWPNNFSCHLPVFTANLVNNEDSPAFTAGFSDNGKLGYGFTSADDLEEVDIGPGDKPRPTFIS
Ga0182169_127567323300015352Switchgrass PhyllosphereVYTMACSSSWPLIDYLVSNDNESVEAASSCGWPNNFSCHLPVFAADLVDNRNSPAFADGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPIFISKKLDPV*
Ga0182169_128995913300015352Switchgrass PhyllosphereMACSGSWPLIDFWVSNDNGRVEAASPRGWPNNFSYHLSVFAADLVDNGDSLAFAADISDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIA
Ga0182179_118361913300015353Switchgrass PhyllosphereMACSGSWLLIDYLVSNDNGSIETASPCGWPNNFSCYLPVFVADLVDNEDSPAFAAGFSNDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLRE
Ga0182179_119385213300015353Switchgrass PhyllosphereMACSGSWPLIDYLVPNDNGSIEAASPCGWPNNFSCHLPVFATDLVVNEDSPAFAVGFSYDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVL
Ga0182179_124101813300015353Switchgrass PhyllosphereMACSGSWPLIDYLAPNDNRSIEAASPCGWPNNFSCHLPVFAADLADDESSSAFATDFSDDGKLGYGFTSADDLEEVDIGPGDKPQPTFISKKLDPAL*
Ga0182167_127539413300015354Switchgrass PhyllosphereMACSSSWPITEHLILNGNKSLETASPCGWPGNFSCRLPVFAADLADDEDSPAFAAGFSDDGKLGFGFTSADDLEEVDIGPGDKP*
Ga0182167_129265823300015354Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGIIEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSEDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIALLKEYR
Ga0182167_134313813300015354Switchgrass PhyllosphereMACSSSWPLIDYLVSNDNGSVEAASPCSWPNNFSCHLPVFATDLVDNRNSPAFADGFSDNGKLGYGFTSADDLEEVDIGSGDKPWPTFISKKMDPVLREAIIALLKEYRDYFAWD
Ga0182197_107375913300017408Switchgrass PhyllosphereMASSGSWPLIDYLVLNDNGSIETASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVL
Ga0182199_113498623300017412Switchgrass PhyllosphereMACSSSWPITKHLVSNDNKNLETASPCGWPSNFSRHLPVFVADLADDEDSPAFAAGFSDDGKLGYGFTSADNLEEVDICPG
Ga0182195_117254613300017414Switchgrass PhyllosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0182195_118571323300017414Switchgrass PhyllosphereMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALREEMIALL
Ga0182213_125544113300017421Switchgrass PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0182201_100931913300017422Switchgrass PhyllosphereMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKP
Ga0182201_105917923300017422Switchgrass PhyllosphereMASSSSWLSIDYLALRNNRSIEAASPCGWPSNLSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISS
Ga0182201_112882013300017422Switchgrass PhyllosphereMACSSSWPLIDYLVSNDNGSIEAASPCGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDP
Ga0182196_109253113300017432Switchgrass PhyllosphereMACSSSWPLIDYLVLNDNGSIETASPCGWPNNFSSHLPVFAADLVDDEDSPTFAAGFSEDGKLRYGFASADDLEEVDIGPRDKPRPTFISKKLDPVLREEMIALL
Ga0182200_113572423300017439Switchgrass PhyllosphereMMAYSGSWPLVDDSALSNNRSIEVASPCGWPNNFSCHLPVFAAGLVDNGDPSVFAAGFSDDGKLGYGFTSADDLEEIDIGPGDKPRPTFISKKLDP
Ga0182214_111279123300017440Switchgrass PhyllosphereMACSGSWPLIDCLVSNDNGIMEAASPCGWPNNFSCHLPVFAVDLVDNEDSPVFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDCF
Ga0182214_113799613300017440Switchgrass PhyllosphereMSCSGSWPLIDYLVSNDNGIIEAASPCGWPNNFSCHLPVFAADLVDNEDSLVFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPALRE
Ga0182198_106125313300017445Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGSLETASPCGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPRDKPRPTFISKKLDPVLREEMIALLKEYRDCF
Ga0182217_107420323300017446Switchgrass PhyllosphereMACSGSWPLIDYLVSDDNGSIEAASPCGWPNNFSCHLPVFAVDIVDSENSLAFAVDFLDNGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPVLRE
Ga0182217_112298313300017446Switchgrass PhyllosphereMACSGSWPLIDYLISNDNGIMEAASPCGWSNNFSCHLPVFAADLVDNEDSLAFATGFSDDGKLGYGFTSADDLEEVDIGPGDKPWPTFISKKLDPALREEMIALL
Ga0182217_114074123300017446Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGSIEAANPCDWPNNFSRHLPVFAADLVVNKNPLAFAASFSDDGKLGYRFTSADDLEEVDIGPGDKPRPTFISKKLDPTLREEM
Ga0182212_115962623300017691Switchgrass PhyllosphereMACSGSWPLIDYLFSNDNGSIEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLK
Ga0182210_108257813300017692Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGSMKTASPCGWPNNFSCHLPVYAADLVVNEDSPAFAAGFSDDGKLGYRFTSADDLEEVDIGPGDKPRPTFISKKLDPV
Ga0182216_114935913300017693Switchgrass PhyllosphereMMACSGSWPLVDYSALSDNRSIEAASPCGWPNNFSCHLPVFAADLVDNGDPSAFAAGLSDDGKLGYGFTSADDLEEIDIGPGDKPRPTFISKKLDPVLREEMIA
Ga0182216_119789513300017693Switchgrass PhyllosphereMACSGSWLLIDYLFPNDNGSIEAANPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLEYGFTSADDLEEVDIGPGDKPRPTFISKTLDLVLR
Ga0182211_106069523300017694Switchgrass PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFTPADDLEEVDIGPGDKPRPTFISKKLDPIL
Ga0182178_100424013300020023Switchgrass PhyllosphereMACSGSWPLIDYLVPNANGRTEAASLCGWPSNFSCHLPVFAADLVDNEDSPKFAAGFSDDGKLGYGFTLADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDC
Ga0182146_10522513300020033Switchgrass PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPALREEMITLLKEYR
Ga0207680_1135417423300025903Switchgrass RhizosphereMACSGNWLLIDYLVSNDNGSIETASPCGWPNNFSCHLPVFVVDLMDNEDSPAFAAGFSDDGKLGYGFTSADNLEEVDIGP
Ga0207650_1093128413300025925Switchgrass RhizosphereMMASSSSWLSIDYLALRNDRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPVLREEMIALL
Ga0207644_1161587323300025931Switchgrass RhizosphereMAYSSSWPLIDYLVSNDNGSVEAASPCSWPNNFSCHLPVFATDLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGHGDKPRPTFISKKLDLVLREEMI
Ga0207703_1203678913300026035Switchgrass RhizosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPALREEMITLLKEY
Ga0207641_1232499613300026088Switchgrass RhizosphereMSCSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEDSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDLALQEEMIA
Ga0207676_1191253613300026095Switchgrass RhizosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIAL
Ga0268328_100623723300028050PhyllosphereVACSGSWLLVDYLVSNDNGSIETTSPCGWPNNFSCHLPVFAADLVDNENSPAFAVGFSDDGKLGYGFTSADNLEEVDIGPGDKPRPTFISKKVGSDLA
Ga0268328_104126123300028050PhyllosphereMACSGSWLLIDYLVSNDNGSIEMASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKNAGATYQRAMNYIFHDL
Ga0268328_105848913300028050PhyllosphereLGLELLHHVHTIACSGSWPLIDYLVSDDDGSIEAASPCGWPNNFSCHLPIFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDCFAWDYT
Ga0268344_100866823300028051PhyllosphereVACSGSWLLVDYLVSNDNGSIETTSPCGWPNNFSCHLPVFAADLVDKENSPAFAVGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKVGSDLA
Ga0268346_103310223300028053PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAADFLDDGKLGYGFTSADDLEEVNIGPVDKPRPTFISSKLDPALREEMITLLK
Ga0268306_103336723300028054PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAADFLDDGKLGYGFTSADDLEEVVIGPGDKPRPTFISSKLDPALR
Ga0268330_101412813300028056PhyllosphereLGLELLHHVHTIACSGSWPLIDYLVSDDDGSIEAASPCGWPNNFSCHLPIFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPQPTFISKKLDLALREEMIAL
Ga0268330_104279413300028056PhyllosphereMACSCSWPVIDYLVSNDNGSMETASPCGWPNNFSCHLPVFAADLEDNEDSPAFAAGFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPTLREEMIAMLKEYR
Ga0268352_103794323300028057PhyllosphereMMAYSGSWPLVDDSALSNNRSIEAASPCGWPNNFSCHLPVFAAGLVDNGDPSVFAAGFSDDGKLGYGFTSADDLEEIDIGPGDKPRPTFINKKLDPVLREEMIALLKEYRDCF
Ga0268332_103426913300028058PhyllosphereMAGSSSWPLINYLVPNDNGIIEAASLCGWPNNFSCHLPVFAADLEDNEDSPAFAAGFSDDGKLGYGFMSADDLEEVDTGPGD
Ga0268332_104004823300028058PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDCFA
Ga0268342_103482923300028062PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVD
Ga0268340_105132713300028064PhyllosphereMACSGSWPLIDYLVSNDNGSIEAASPCGWPNNFSCHLPVFVADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDISPGDKPRPTFISKKLD
Ga0268340_106145223300028064PhyllosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMI
Ga0268340_107474823300028064PhyllosphereMACSGSWLLIDYLVSNDDGIMEAASPCGWPNNFSCHLPVFAADLVDNEFSLAFAADFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLD
Ga0268303_10316623300028147PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAADFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISS
Ga0268354_102066913300028148PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLRE
Ga0268336_100771713300028152PhyllosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPV
Ga0268320_101529313300028153PhyllosphereMACSGSWLLIDYLVSNDNGSIETASPCGWPNNFSCYLPVFAADHVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFIS
Ga0268320_101918823300028153PhyllosphereMMAYSGSWPLIDYSALSDNRSIEAASPCGWPNNFSRHLPVFAADLVDNGDPSAFAAGLSDDGKLGYGFTSADDLEEIDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDC
Ga0268320_102198713300028153PhyllosphereMACSGSWPLFDYLVSNDNGSIETASPCGWPNNFSCHLPVFAADLVDNEDSPVFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFIS
Ga0268341_101717523300028154PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAADFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDSALRE
Ga0268341_102158513300028154PhyllosphereMACSGSWPLIDYLVSNDDGSIEAASPCGWPNNFSCHLPVFVADLVDNEDSPAFAAGFSDDSKLGYGFTSANDLEEVDIGPGDKPQ
Ga0268349_103838123300028155PhyllosphereMACSGSWPLIDYLVSDDNGSIEAASPCGWPNNFSCHLPVFATDLADNEDSPAFAAVFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPV
Ga0268318_10140513300028157PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFI
Ga0268351_101371123300028246PhyllosphereMMASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAADFLDDGKLGYGFTSADDLEEVDIGPGD
Ga0268312_101919023300028248PhyllosphereMACSSSWPLIDYLVSNDNGSVEAASPCSWPNNFSCHLPVFATDLVDNRNSPAFADGFSDNGKLGYGFTSADDLEEVDIGSGD
Ga0268310_104213213300028262PhyllosphereMACSSSWPLIDYLVSNDNGSVEAASPCSWPNNFSCHLPVFATDLVDNRNSPAFADGFSDNGKLGYGFTSADDLEEVDIGSGDKPWPTFISKKLDPVLREAIIALLKEYR
Ga0268266_1197299723300028379Switchgrass RhizosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPVLREEM
Ga0268301_10323023300028465PhyllosphereMASSSSWLSVDYLALRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPVLREEMIT
Ga0268333_101240223300028467PhyllosphereMACSGSWPLTDYLVLNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTF
Ga0268317_100179823300028468PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRLTFISKKLDPVLREEMIALLKEYRDCF
Ga0268337_101226813300028469PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISR
Ga0268323_102006723300028471PhyllosphereMACSGSWPLIDYLVPNDNGSIEAASPCGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRLTFISKKLDPV
Ga0268315_102545623300028472PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISS
Ga0268327_101675523300028475PhyllosphereMACSGNWLLIDYLVSNDNGSIETASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRLTFISKKLDPVLREEMIALLKEYRDCF
Ga0268339_100221623300028526PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLADNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLD
Ga0268311_102480323300028529PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPVLRE
Ga0061013_1266134313300030772Fungi-Associated Bovine RumenMSNIDLGLELLHHVYTMACSGSWPLIEYLFSNDNGSIETASPCGWPNNFSCHLPVFAADLVDNEDSLAFAAGFSDDGKLGYGFTSADDLEEVDI
Ga0214493_111018213300032465Switchgrass PhyllosphereMKASCSSWLSIDYWVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAADFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDP
Ga0214493_116372123300032465Switchgrass PhyllosphereMMTSSSSWLSIDCLALRNDRSIEAASPCGWPYNFSCHLPVFAADLVDNEDSPAFAASFLDDSKLGYGFTSADDLEEVDIGPVDK
Ga0214488_104285313300032467Switchgrass PhyllosphereMMASSSSWLSIDYLALRNDRSIEAAGPCGWPNNFSCHLPVFAADLVDSENSLAFAADFLDDGKLGYGFTSADDLEEVDIGLGDKPRPTFISSKL
Ga0214491_116004923300032469Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGSIEAASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEY
Ga0214495_101858123300032490Switchgrass PhyllosphereMASSSSWLSIDYLALKNNRSIEAASPCGWPNNLSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPVLREEMITLLKEYRIALHGTTRRCLDWIEA
Ga0214490_113157413300032502Switchgrass PhyllosphereVLDHVYTMACSCSWPVIDYLVSNDNGSMETASPCGWPNNFSCHLPVFAADLVVNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLRE
Ga0214490_114865113300032502Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNGSVEAASPCGWPNNFSCHLPVFAADLVDNRNLPAFTDGFSDDGKLGYGFTSADDLEEVDIGHGDKPR
Ga0214483_103504013300032548Switchgrass PhyllosphereMACSGSWPLIDYLVPNANGRTEAASPCGWPSNFSCHLPVFAADLVDNENSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPR
Ga0214500_118152113300032589Switchgrass PhyllosphereMACSGSWPLIDYLVSNDNRSVEAASPCGWPNNFSCHLPVFAADLVDNEDSPAFAASFSDDGKLGYGFTSADNLEEVDIGPGDKPQPTFISKKLDPILREEM
Ga0214501_121895613300032625Switchgrass PhyllosphereMACSGSWPLIDYLALNDNRSIQAASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFMSADDLEEVDIGPGDNPRPTFISKKLDPVLREEIIALLKE
Ga0214499_117208413300032697Switchgrass PhyllosphereVACSGSWLLVDYLVSNDNGSIEAASPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTLADDLEEVDIGPGDKPRPTFISKKLDPILREEMIALLKEYRDCFA
Ga0214485_104235013300032698Switchgrass PhyllosphereMACSGSWPLIDYLISNDNGSVEAASPRGWPNNFSCHLPVFAADLVDNGDSLAFVADFLDDGKLGYGFTSADDLEEVDIG
Ga0214485_104608513300032698Switchgrass PhyllosphereMACSGSWPLVDYLVPNANGRTEAASPCGWPSNFSCHLPVFAADLVDDEDSPAFAAGFSDDGKLGYGFTSADDLEEIDIGPGDKPRPTFISKKLDPVLREEMIAL
Ga0214494_100465333300032699Switchgrass PhyllosphereMACSGSWPLVDYLVPNANGRTEAASPCGWPSKFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLKEVDIGPGDKPRPTFISKKLDPVLREE
Ga0314746_105342823300032758Switchgrass PhyllosphereMACSSSWPLIDYLVSNDNRSVEAASPCGWPNNFSCHLPVFAANLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEY
Ga0314748_103710623300032791Switchgrass PhyllosphereMKASCSSWLSIDYCVLRNNRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLTFAVDFLDDGKLGYGFTSVDDLEEVDIGP
Ga0314718_100866513300032811Switchgrass PhyllosphereMACSGSWPHIDYLVPDDNGIIEAAIPCGWPNNFSCHLPVFAADLVDNEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDLALREEMIALLKEYRDYF
Ga0314734_104103213300032916Switchgrass PhyllosphereLLHRVHVMASSSSWLSIDYLALKNNRSIEAASPCGWPNNLSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISSKLDPVLREEMITLLKEYRIALHGTTRRCLDWIEA
Ga0314738_100277013300032959Switchgrass PhyllosphereMACSSSWPLTVYLVLDDSGSIEAASPCGWPNNFSCHLPVFAADLVDKEDSPAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKP
Ga0314768_133652513300033523Switchgrass PhyllosphereMKASRSSWLSIDYCVLRNNRSIEAASPCGWPYNFSCHLPVFAADIVDSEDSLVFAVDFLDDGKLGYGFTSAGDLEEVDIGPGDKPRPTFISRKLDPVLREE
Ga0314761_113275323300033526Switchgrass PhyllosphereMASSGSWPFLDYLFSNDDGSIETASPCGWPNNFSCHLPVFAADLVDNEDSPAFTAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLR
Ga0314760_114145713300033530Switchgrass PhyllosphereMASSSSWLSIDYLALRNDRSIEAASPCGWPNNFSCHLPVFAADIVDSEDSLAFAVDFLDDGKLGYGFTSADDLEEVDIGPGDKPQPTFISSKLDPVLREEMITLLKEYR
Ga0314756_105450423300033531Switchgrass PhyllosphereMACSGSWPLIDYLVPNDNGIIEAASPCGWPNNFSCHLPVFATDLVDNEDSTAFAAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRP
Ga0314757_115376513300033534Switchgrass PhyllosphereMACSGSWPLIDYLVPNDNGSIGAASSCGWPNNFSCHLLVFAADLVDNEDSPAFAAGFSDDSKLGYGFTSVDDLEEVDIGPGDKPRPTFISKKLDPALREEMIVLLKEYRDC
Ga0314759_103768433300033535Switchgrass PhyllosphereMACSGSWLLIDYLVSNDNGNIETASPCGRPNNFSCHLFVFAADLADNEDSLAFVAGFSDDGKLGYGFTSADDLEEVDIGPGDKPRPTFISKKLDPVLREEMIALLKEYRDCFA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.