NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022542

Metagenome / Metatranscriptome Family F022542

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022542
Family Type Metagenome / Metatranscriptome
Number of Sequences 214
Average Sequence Length 39 residues
Representative Sequence MDKKEINSPKLTANFLFWICGVGGLLLLGFLGHYVWKIF
Number of Associated Samples 168
Number of Associated Scaffolds 214

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.80 %
% of genes near scaffold ends (potentially truncated) 18.22 %
% of genes from short scaffolds (< 2000 bps) 66.36 %
Associated GOLD sequencing projects 151
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.364 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil
(12.149 % of family members)
Environment Ontology (ENVO) Unclassified
(25.234 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.140 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.78%    β-sheet: 0.00%    Coil/Unstructured: 55.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 214 Family Scaffolds
PF01425Amidase 2.80
PF13545HTH_Crp_2 2.34
PF01878EVE 2.34
PF01850PIN 1.87
PF12706Lactamase_B_2 1.87
PF00196GerE 1.40
PF13620CarboxypepD_reg 1.40
PF00144Beta-lactamase 0.93
PF01594AI-2E_transport 0.93
PF06172Cupin_5 0.93
PF13502AsmA_2 0.93
PF07238PilZ 0.93
PF12697Abhydrolase_6 0.93
PF05977MFS_3 0.93
PF13361UvrD_C 0.93
PF01175Urocanase 0.93
PF00575S1 0.93
PF10101DUF2339 0.47
PF13298LigD_N 0.47
PF00156Pribosyltran 0.47
PF12787EcsC 0.47
PF00118Cpn60_TCP1 0.47
PF03279Lip_A_acyltrans 0.47
PF01165Ribosomal_S21 0.47
PF01494FAD_binding_3 0.47
PF00005ABC_tran 0.47
PF00691OmpA 0.47
PF05036SPOR 0.47
PF01872RibD_C 0.47
PF02518HATPase_c 0.47
PF00291PALP 0.47
PF04366Ysc84 0.47
PF04014MazE_antitoxin 0.47
PF00474SSF 0.47
PF01527HTH_Tnp_1 0.47
PF00364Biotin_lipoyl 0.47
PF08281Sigma70_r4_2 0.47
PF02239Cytochrom_D1 0.47
PF069833-dmu-9_3-mt 0.47
PF01627Hpt 0.47
PF01326PPDK_N 0.47
PF12700HlyD_2 0.47
PF13546DDE_5 0.47
PF14534DUF4440 0.47
PF14602Hexapep_2 0.47
PF13807GNVR 0.47
PF01987AIM24 0.47
PF13924Lipocalin_5 0.47
PF00072Response_reg 0.47
PF01804Penicil_amidase 0.47
PF13432TPR_16 0.47
PF00962A_deaminase 0.47
PF00275EPSP_synthase 0.47
PF07228SpoIIE 0.47
PF13646HEAT_2 0.47
PF16363GDP_Man_Dehyd 0.47
PF13466STAS_2 0.47
PF04972BON 0.47
PF09335SNARE_assoc 0.47
PF00479G6PD_N 0.47
PF03631Virul_fac_BrkB 0.47
PF08240ADH_N 0.47
PF10397ADSL_C 0.47
PF13245AAA_19 0.47
PF04185Phosphoesterase 0.47
PF01380SIS 0.47
PF13185GAF_2 0.47
PF03726PNPase 0.47
PF00213OSCP 0.47
PF12705PDDEXK_1 0.47
PF00892EamA 0.47
PF00135COesterase 0.47
PF04191PEMT 0.47
PF00069Pkinase 0.47
PF00202Aminotran_3 0.47
PF00132Hexapep 0.47
PF00702Hydrolase 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 214 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 2.80
COG1673Predicted RNA-binding protein, contains PUA-like EVE domainGeneral function prediction only [R] 2.34
COG2947Predicted RNA-binding protein, contains EVE domainGeneral function prediction only [R] 2.34
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.87
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.93
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.93
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.93
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.93
COG2367Beta-lactamase class ADefense mechanisms [V] 0.93
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.93
COG2987Urocanate hydrataseAmino acid transport and metabolism [E] 0.93
COG3542Predicted sugar epimerase, cupin superfamilyGeneral function prediction only [R] 0.93
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.47
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.47
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.47
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.47
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.47
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.47
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.47
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.47
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.47
COG0712FoF1-type ATP synthase, delta subunitEnergy production and conversion [C] 0.47
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.47
COG1185Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)Translation, ribosomal structure and biogenesis [J] 0.47
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.47
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.47
COG1560Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis)Lipid transport and metabolism [I] 0.47
COG1816Adenosine/6-amino-6-deoxyfutalosine deaminaseNucleotide transport and metabolism [F] 0.47
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.47
COG2013AIM24 protein, required for mitochondrial respirationEnergy production and conversion [C] 0.47
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.47
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.47
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.47
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.47
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.47
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.47
COG4261Predicted acyltransferase, LPLAT superfamilyGeneral function prediction only [R] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.36 %
UnclassifiedrootN/A26.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig183555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300000567|JGI12270J11330_10060519All Organisms → cellular organisms → Bacteria1956Open in IMG/M
3300001082|JGI12664J13189_1000016All Organisms → cellular organisms → Bacteria22243Open in IMG/M
3300001082|JGI12664J13189_1001664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2628Open in IMG/M
3300001154|JGI12636J13339_1001479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3965Open in IMG/M
3300001471|JGI12712J15308_10022760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1637Open in IMG/M
3300001593|JGI12635J15846_10236067All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300001593|JGI12635J15846_10878910All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300001661|JGI12053J15887_10024066All Organisms → cellular organisms → Bacteria3411Open in IMG/M
3300002245|JGIcombinedJ26739_100063501All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3391Open in IMG/M
3300002245|JGIcombinedJ26739_101523438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae564Open in IMG/M
3300002911|JGI25390J43892_10035224All Organisms → cellular organisms → Bacteria → Acidobacteria1204Open in IMG/M
3300004091|Ga0062387_100072385Not Available1750Open in IMG/M
3300004092|Ga0062389_101498355Not Available858Open in IMG/M
3300004102|Ga0058888_1334228Not Available583Open in IMG/M
3300004103|Ga0058903_1000278Not Available1145Open in IMG/M
3300004139|Ga0058897_11053271Not Available1113Open in IMG/M
3300004635|Ga0062388_101425965Not Available696Open in IMG/M
3300005171|Ga0066677_10338346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium862Open in IMG/M
3300005174|Ga0066680_10062213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2219Open in IMG/M
3300005434|Ga0070709_11093062Not Available637Open in IMG/M
3300005436|Ga0070713_100026540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4549Open in IMG/M
3300005446|Ga0066686_10958342All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005467|Ga0070706_100001557All Organisms → cellular organisms → Bacteria23929Open in IMG/M
3300005468|Ga0070707_100076443All Organisms → cellular organisms → Bacteria → Acidobacteria3230Open in IMG/M
3300005518|Ga0070699_100184675All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300005529|Ga0070741_10000530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae135757Open in IMG/M
3300005536|Ga0070697_100157780All Organisms → cellular organisms → Bacteria → Acidobacteria1916Open in IMG/M
3300005536|Ga0070697_101490152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300005536|Ga0070697_101676928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300005537|Ga0070730_10606087Not Available698Open in IMG/M
3300005538|Ga0070731_10690859Not Available678Open in IMG/M
3300005541|Ga0070733_10004909All Organisms → cellular organisms → Bacteria → Acidobacteria8869Open in IMG/M
3300005591|Ga0070761_10062383Not Available2106Open in IMG/M
3300005610|Ga0070763_10535472Not Available673Open in IMG/M
3300005891|Ga0075283_1010858Not Available1360Open in IMG/M
3300005921|Ga0070766_10467645Not Available834Open in IMG/M
3300005993|Ga0080027_10090070All Organisms → cellular organisms → Bacteria → Acidobacteria1142Open in IMG/M
3300005994|Ga0066789_10001250All Organisms → cellular organisms → Bacteria10949Open in IMG/M
3300005994|Ga0066789_10038498All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300005995|Ga0066790_10100049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1245Open in IMG/M
3300005995|Ga0066790_10226300All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300006028|Ga0070717_10244323All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300006028|Ga0070717_10525293Not Available1071Open in IMG/M
3300006028|Ga0070717_10737056All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300006041|Ga0075023_100569804Not Available521Open in IMG/M
3300006052|Ga0075029_100256977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1105Open in IMG/M
3300006052|Ga0075029_100388125Not Available905Open in IMG/M
3300006059|Ga0075017_100645109All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300006086|Ga0075019_10416820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae824Open in IMG/M
3300006162|Ga0075030_100855915Not Available717Open in IMG/M
3300006163|Ga0070715_10375669Not Available783Open in IMG/M
3300006173|Ga0070716_101256844All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300006176|Ga0070765_100148214All Organisms → cellular organisms → Bacteria → Acidobacteria2090Open in IMG/M
3300006176|Ga0070765_101768309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300006176|Ga0070765_102175516All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006797|Ga0066659_10406607All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1072Open in IMG/M
3300006893|Ga0073928_10013093All Organisms → cellular organisms → Bacteria9371Open in IMG/M
3300006893|Ga0073928_10104843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2364Open in IMG/M
3300006893|Ga0073928_10375207Not Available1047Open in IMG/M
3300006893|Ga0073928_10939324Not Available591Open in IMG/M
3300007982|Ga0102924_1288361Not Available658Open in IMG/M
3300009143|Ga0099792_10018957All Organisms → cellular organisms → Bacteria → Acidobacteria3038Open in IMG/M
3300009143|Ga0099792_10558726Not Available724Open in IMG/M
3300009644|Ga0116121_1000014All Organisms → cellular organisms → Bacteria82456Open in IMG/M
3300009683|Ga0116224_10037906All Organisms → cellular organisms → Bacteria2365Open in IMG/M
3300010341|Ga0074045_10424530Not Available860Open in IMG/M
3300010343|Ga0074044_10026152All Organisms → cellular organisms → Bacteria4156Open in IMG/M
3300010371|Ga0134125_10179918All Organisms → cellular organisms → Bacteria → Acidobacteria2355Open in IMG/M
3300010373|Ga0134128_13070910Not Available513Open in IMG/M
3300010376|Ga0126381_101748990All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300010379|Ga0136449_100142783All Organisms → cellular organisms → Bacteria4726Open in IMG/M
3300010379|Ga0136449_100354944All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2632Open in IMG/M
3300010876|Ga0126361_10302587All Organisms → cellular organisms → Bacteria → Acidobacteria1899Open in IMG/M
3300011120|Ga0150983_15266532Not Available570Open in IMG/M
3300012208|Ga0137376_10182664All Organisms → cellular organisms → Bacteria → Acidobacteria1811Open in IMG/M
3300012208|Ga0137376_11416324All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300012361|Ga0137360_11258554All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300012582|Ga0137358_10034836All Organisms → cellular organisms → Bacteria3320Open in IMG/M
3300012685|Ga0137397_10156479Not Available1690Open in IMG/M
3300012685|Ga0137397_11142668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300012922|Ga0137394_10337182All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1287Open in IMG/M
3300012922|Ga0137394_10700327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300012927|Ga0137416_10832633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300012929|Ga0137404_10304573All Organisms → cellular organisms → Bacteria → Acidobacteria1383Open in IMG/M
3300012931|Ga0153915_10042172All Organisms → cellular organisms → Bacteria4642Open in IMG/M
3300012944|Ga0137410_10010972All Organisms → cellular organisms → Bacteria6138Open in IMG/M
3300012944|Ga0137410_10060634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2721Open in IMG/M
3300012957|Ga0164303_11154420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300012989|Ga0164305_10110803All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300013770|Ga0120123_1073461Not Available756Open in IMG/M
3300013832|Ga0120132_1072878Not Available692Open in IMG/M
3300014169|Ga0181531_10011182All Organisms → cellular organisms → Bacteria5155Open in IMG/M
3300014169|Ga0181531_10211220All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1180Open in IMG/M
3300014201|Ga0181537_10038633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3265Open in IMG/M
3300014201|Ga0181537_10151506All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300014489|Ga0182018_10001004All Organisms → cellular organisms → Bacteria34078Open in IMG/M
3300014491|Ga0182014_10001063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae37356Open in IMG/M
3300014491|Ga0182014_10001166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae35556Open in IMG/M
3300014494|Ga0182017_10535407Not Available716Open in IMG/M
3300014501|Ga0182024_10000563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae95761Open in IMG/M
3300014501|Ga0182024_10068813All Organisms → cellular organisms → Bacteria → Acidobacteria5382Open in IMG/M
3300014501|Ga0182024_11024258Not Available982Open in IMG/M
3300014501|Ga0182024_11082672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium948Open in IMG/M
3300014657|Ga0181522_10236400Not Available1079Open in IMG/M
3300015082|Ga0167662_1022921Not Available799Open in IMG/M
3300015264|Ga0137403_10317477All Organisms → cellular organisms → Bacteria → Acidobacteria1450Open in IMG/M
3300017934|Ga0187803_10058616All Organisms → cellular organisms → Bacteria → Acidobacteria1517Open in IMG/M
3300017943|Ga0187819_10666853All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300017948|Ga0187847_10029993All Organisms → cellular organisms → Bacteria3245Open in IMG/M
3300017955|Ga0187817_10945116All Organisms → cellular organisms → Bacteria → Proteobacteria552Open in IMG/M
3300018009|Ga0187884_10377211Not Available571Open in IMG/M
3300018027|Ga0184605_10209401All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8885Open in IMG/M
3300018027|Ga0184605_10371862All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300018034|Ga0187863_10865668All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300018037|Ga0187883_10186530All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300018038|Ga0187855_10866176Not Available527Open in IMG/M
3300018061|Ga0184619_10074093All Organisms → cellular organisms → Bacteria → Acidobacteria1507Open in IMG/M
3300018433|Ga0066667_11941319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300019879|Ga0193723_1146438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300019885|Ga0193747_1009108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2385Open in IMG/M
3300019888|Ga0193751_1026288All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300019888|Ga0193751_1266228All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300020579|Ga0210407_10030688All Organisms → cellular organisms → Bacteria → Acidobacteria3997Open in IMG/M
3300020580|Ga0210403_10010633All Organisms → cellular organisms → Bacteria → Acidobacteria7482Open in IMG/M
3300020580|Ga0210403_10176617Not Available1750Open in IMG/M
3300020583|Ga0210401_10512443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1062Open in IMG/M
3300021046|Ga0215015_10344284Not Available4590Open in IMG/M
3300021170|Ga0210400_10819127All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300021181|Ga0210388_10247028All Organisms → cellular organisms → Bacteria → Acidobacteria1566Open in IMG/M
3300021401|Ga0210393_10087708All Organisms → cellular organisms → Bacteria → Acidobacteria2470Open in IMG/M
3300021401|Ga0210393_10306246Not Available1291Open in IMG/M
3300021405|Ga0210387_10182504All Organisms → cellular organisms → Bacteria1813Open in IMG/M
3300021407|Ga0210383_10010097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8064Open in IMG/M
3300021407|Ga0210383_10090911All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2564Open in IMG/M
3300021413|Ga0193750_1001450Not Available6434Open in IMG/M
3300021420|Ga0210394_10537663Not Available1028Open in IMG/M
3300021420|Ga0210394_10787736Not Available831Open in IMG/M
3300021433|Ga0210391_10066346All Organisms → cellular organisms → Bacteria → Acidobacteria2859Open in IMG/M
3300021433|Ga0210391_10310650Not Available1237Open in IMG/M
3300021433|Ga0210391_10726551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300021475|Ga0210392_11279069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300021477|Ga0210398_10646029All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300021477|Ga0210398_11022995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4658Open in IMG/M
3300021478|Ga0210402_10000845All Organisms → cellular organisms → Bacteria → Acidobacteria32997Open in IMG/M
3300021478|Ga0210402_10088879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2760Open in IMG/M
3300021478|Ga0210402_10416136Not Available1248Open in IMG/M
3300021479|Ga0210410_11227385All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300021559|Ga0210409_10073391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3179Open in IMG/M
3300022557|Ga0212123_10004974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24210Open in IMG/M
3300022557|Ga0212123_10098620All Organisms → cellular organisms → Bacteria2394Open in IMG/M
3300022557|Ga0212123_10875653Not Available531Open in IMG/M
3300023090|Ga0224558_1000514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae44492Open in IMG/M
3300025922|Ga0207646_10853444All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300026215|Ga0209849_1036785All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300026294|Ga0209839_10187139All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300026320|Ga0209131_1086902All Organisms → cellular organisms → Bacteria → Acidobacteria1674Open in IMG/M
3300026326|Ga0209801_1028695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2651Open in IMG/M
3300027073|Ga0208366_1001157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2073Open in IMG/M
3300027117|Ga0209732_1015807All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300027370|Ga0209010_1000219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae20695Open in IMG/M
3300027432|Ga0209421_1059279All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300027535|Ga0209734_1086179Not Available601Open in IMG/M
3300027545|Ga0209008_1020458All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300027565|Ga0209219_1048642Not Available1058Open in IMG/M
3300027575|Ga0209525_1001308All Organisms → cellular organisms → Bacteria5449Open in IMG/M
3300027674|Ga0209118_1000019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae134138Open in IMG/M
3300027824|Ga0209040_10118880Not Available1468Open in IMG/M
3300027853|Ga0209274_10291570All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300027854|Ga0209517_10005095All Organisms → cellular organisms → Bacteria → Acidobacteria16896Open in IMG/M
3300027857|Ga0209166_10618401Not Available549Open in IMG/M
3300027867|Ga0209167_10003831All Organisms → cellular organisms → Bacteria → Acidobacteria7743Open in IMG/M
3300027879|Ga0209169_10638083All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300027894|Ga0209068_10091968All Organisms → cellular organisms → Bacteria1591Open in IMG/M
3300027903|Ga0209488_10004705All Organisms → cellular organisms → Bacteria10593Open in IMG/M
3300027908|Ga0209006_10001289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae22749Open in IMG/M
3300027908|Ga0209006_11133456All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300027910|Ga0209583_10453479Not Available623Open in IMG/M
3300027911|Ga0209698_10015326All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium7471Open in IMG/M
3300027915|Ga0209069_10271581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium890Open in IMG/M
3300028047|Ga0209526_10006230All Organisms → cellular organisms → Bacteria → Acidobacteria8157Open in IMG/M
3300028047|Ga0209526_10728400Not Available622Open in IMG/M
3300028646|Ga0302159_10001667All Organisms → cellular organisms → Bacteria → Acidobacteria5029Open in IMG/M
3300028678|Ga0302165_10084304Not Available843Open in IMG/M
3300028906|Ga0308309_11864898All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300029943|Ga0311340_10164189All Organisms → cellular organisms → Bacteria → Acidobacteria2300Open in IMG/M
3300029987|Ga0311334_11694625All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300030007|Ga0311338_10018411All Organisms → cellular organisms → Bacteria → Acidobacteria10188Open in IMG/M
3300030052|Ga0302217_10085502Not Available709Open in IMG/M
3300030618|Ga0311354_11321596Not Available646Open in IMG/M
3300030991|Ga0073994_10009344All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300031234|Ga0302325_13076304All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300031241|Ga0265325_10004875All Organisms → cellular organisms → Bacteria8386Open in IMG/M
3300031344|Ga0265316_10813844Not Available655Open in IMG/M
3300031708|Ga0310686_104189802Not Available535Open in IMG/M
3300031708|Ga0310686_113050780All Organisms → cellular organisms → Bacteria2518Open in IMG/M
3300031715|Ga0307476_10064294All Organisms → cellular organisms → Bacteria2529Open in IMG/M
3300031720|Ga0307469_10816550Not Available857Open in IMG/M
3300031720|Ga0307469_11558194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300031740|Ga0307468_100208663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1330Open in IMG/M
3300032160|Ga0311301_10074939All Organisms → cellular organisms → Bacteria7058Open in IMG/M
3300032160|Ga0311301_10339411All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2362Open in IMG/M
3300032180|Ga0307471_100378391All Organisms → cellular organisms → Bacteria → Acidobacteria1536Open in IMG/M
3300032205|Ga0307472_101169356All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300032783|Ga0335079_12117370All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300032805|Ga0335078_10687286Not Available1271Open in IMG/M
3300032805|Ga0335078_11196007All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300032829|Ga0335070_10830375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales858Open in IMG/M
3300032896|Ga0335075_11263429All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300033433|Ga0326726_10360014All Organisms → cellular organisms → Bacteria → Acidobacteria1374Open in IMG/M
3300033888|Ga0334792_157584All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300034163|Ga0370515_0002097All Organisms → cellular organisms → Bacteria9999Open in IMG/M
3300034199|Ga0370514_163915Not Available575Open in IMG/M
3300034282|Ga0370492_0202596All Organisms → cellular organisms → Bacteria → Acidobacteria809Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil12.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.54%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.21%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring3.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.27%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.34%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.34%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.34%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.87%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.87%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.40%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.40%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.40%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.47%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.47%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.47%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.47%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.47%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.47%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.47%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.47%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.47%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001082Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3EnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004102Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004103Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015082Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2EnvironmentalOpen in IMG/M
3300028678Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030052Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_017981402140918007SoilMDKKEINSPKLTANFLFWVAGVGGVLLVAFLGHYVWKIF
JGI12270J11330_1006051943300000567Peatlands SoilMDKKEINSPRLTLDFLFWICGVGGFVLLILLAHFVWKVL*
JGI12664J13189_1000016193300001082Forest SoilMDKKEINSPKLTANFLIWVGGVGGLLLLLLLAHFVWKIR*
JGI12664J13189_100166423300001082Forest SoilMDKKEINSPKATANFLIWICGVGGLLLLIFLAHFVWKIL*
JGI12636J13339_100147913300001154Forest SoilMDKKEINSPKLTVNFLIWICGVGGLLLFTCLAHFVWKIL*
JGI12712J15308_1002276023300001471Forest SoilMDKKEINSPKLTANFLFWVAGVGGVLLVAFLGHYVWKIF*
JGI12635J15846_1023606723300001593Forest SoilMDKKEINSPKLTANFVIWICGVGGLLLAYLLAHFIWRVI*
JGI12635J15846_1087891023300001593Forest SoilMDKKEINSPKLTAKFLFWIAGVGGVLLVALLAHYVWKIF*
JGI12053J15887_1002406623300001661Forest SoilMDKREINSPRLTANYLFWVCGVGGLLVIALLGHYVWRAF*
JGIcombinedJ26739_10006350143300002245Forest SoilMDKKEINSPKLTANFIFWICGVGVLLLFALLAHYVWRVF*
JGIcombinedJ26739_10152343823300002245Forest SoilMDKKEINSPKLTANFLFWVAGVGGVLLVAFLGHYVWRIF*
JGI25390J43892_1003522413300002911Grasslands SoilMDKKEINSPKLTANFLIWICGVGALLLVAFLAHFVWKIL*
Ga0062387_10007238513300004091Bog Forest SoilTMDRKEINSPKLTVNFLIWVCGVGGLLLVIFLAHFVWKII*
Ga0062389_10149835513300004092Bog Forest SoilMDKKEINSPKLTANFLIWVGGVGGLLLLLFLAHFVWKIR*
Ga0058888_133422823300004102Forest SoilMDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYVWKIF*
Ga0058903_100027833300004103Forest SoilMDKKEINSPNLTANFLFWVCGVGGLLLFALLGPFVWKAF*
Ga0058897_1105327133300004139Forest SoilAAMDKKEINSPNLTANFLFWVCGVGGLLLFALLGPFVWKAF*
Ga0062388_10142596523300004635Bog Forest SoilMDKKKINSPKLTANFLIWVGGVGGLLLLLFLAHFVWKIR*
Ga0066677_1033834623300005171SoilMDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVWKIL*
Ga0066680_1006221323300005174SoilMDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVRKIL*
Ga0070709_1109306213300005434Corn, Switchgrass And Miscanthus RhizosphereAAMDKKEINSPNLTANFLFWVCGVGGLLLLALLGAFVWKTF*
Ga0070713_10002654053300005436Corn, Switchgrass And Miscanthus RhizosphereMDKKEINSPNLTANFLFWVCGVGGLLLLALLGAFVWKTF*
Ga0066686_1095834223300005446SoilMDKKEINSPKLTANFLFWICGVGALLLVVFLAHFVWKIL*
Ga0070706_100001557283300005467Corn, Switchgrass And Miscanthus RhizosphereMDKKEINSPKLTANFLFWICGAGALLLAAFLAHFVWKIL*
Ga0070707_10007644323300005468Corn, Switchgrass And Miscanthus RhizosphereMDKKEINSPKLTANFLFWVCGVGGVLLIALLGHYVWRVF*
Ga0070699_10018467533300005518Corn, Switchgrass And Miscanthus RhizosphereMDKKEINSPKLTANFLFWVCGVGGVLLVGFLGHYVWKVF*
Ga0070741_10000530343300005529Surface SoilMDKKEINSPKLTENFLFWICGVGGVILIGLLGHFVWKIF*
Ga0070697_10015778033300005536Corn, Switchgrass And Miscanthus RhizosphereMDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVWKIL*
Ga0070697_10149015213300005536Corn, Switchgrass And Miscanthus RhizosphereMGKKEINSPKLTANFLFWICGVGTLLLVAFLAPFVWTIL*
Ga0070697_10167692823300005536Corn, Switchgrass And Miscanthus RhizosphereMDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVWKIF*
Ga0070730_1060608733300005537Surface SoilMDKKEINSPTLTLNFVFWICGVGGLVLLILSAHFVWKVL*
Ga0070731_1069085923300005538Surface SoilMNKKEISSPKVTVNFLIWVCGVGGLLLLIVFAHFVWKIM*
Ga0070733_1000490993300005541Surface SoilMDKKEINSPKATANFIVWVCGVGGLLLLIFLANFVWKIL*
Ga0070761_1006238323300005591SoilMDKKEINSPKLTANFIVWVCGVGGLLLLVFLAHFVWKIL*
Ga0070763_1053547223300005610SoilMDKKEINSRKLTANFLIWVGGVGGLLLLLFLAHFVWKIR*
Ga0075283_101085813300005891Rice Paddy SoilMDKKEINSPKLTANFLFWICGVGGLLLLGFLGHYVWKIF*
Ga0070766_1046764533300005921SoilMDKKEINSPRLTLNFVFWICGVGGLVLLLLLAHFVWKVL*
Ga0080027_1009007033300005993Prmafrost SoilMDKKEINSPKLTGNFLFWICGVGGLILVGLLGHFVWRIF*
Ga0066789_1000125023300005994SoilMNKKQINSPKLTANFLLWVGGAGGIVILLAHYVWKVF*
Ga0066789_1003849833300005994SoilMDKKEINSPKLTANFLFWVAGVGGVLLVALLHYVWKIF*
Ga0066790_1010004923300005995SoilMDKKEINSPKLTINFLIWVCGVGGLLLAYLLVHFVFHLV*
Ga0066790_1022630023300005995SoilMDKKEINSPKLTAHFLIWVCGVGGLLLAYLFAHVIFHVL*
Ga0070717_1024432323300006028Corn, Switchgrass And Miscanthus RhizosphereMVREASTMDKKQINSPKLTAHFLFWVCGVGGVFVLLLGHYVWKVF*
Ga0070717_1052529323300006028Corn, Switchgrass And Miscanthus RhizosphereMDKKQINSPKLTANFLFWVCGVGGVFVVLLGHYVWKVF*
Ga0070717_1073705613300006028Corn, Switchgrass And Miscanthus RhizosphereMDKKEINSPKLTANFLFWVGGVGGVLLVAFWGHYVWKIF*
Ga0075023_10056980423300006041WatershedsTMDKKEINSSKLTANFLFWICGVGGVLMIGLLGHYIWRVF*
Ga0075029_10025697723300006052WatershedsMDKKEIYSPNLTANFLFWVCGVGGLLLFALFGHYVWRLFEQS*
Ga0075029_10038812523300006052WatershedsVDKKEINSPWLTARFLFWVCGVGGVAVLALLGHYVWKTF*
Ga0075017_10064510933300006059WatershedsMGKKEINSPKLAADFLFWVSSVGGELLIALLRQYLWKIS*
Ga0075019_1041682033300006086WatershedsVDKKEINSPWLTARFLFWVCGVGGVAVLALLGHYVWK
Ga0075030_10085591513300006162WatershedsMDKKEINSPQLTARFLFWICGVGGVALLALLGHYVWKIL*
Ga0070715_1037566923300006163Corn, Switchgrass And Miscanthus RhizosphereMDKKQINSPKLTANFLFWVCGVGGVFVLLLGHYVWKVF*
Ga0070716_10125684423300006173Corn, Switchgrass And Miscanthus RhizosphereRQPAGRRRYMDKKEINSPKLTANFLFWICGVGALLMVALLAHFVWKIF*
Ga0070765_10014821423300006176SoilMHPSSAMDKKEINSPKLTANFLFWICGVGGLLLAIFLAHYVWRVF*
Ga0070765_10176830923300006176SoilMNKKEINSPKLTANFLFWVGGVGGALLIAFLGHFIWKVF*
Ga0070765_10217551623300006176SoilMDKKEINSPKLTINFLIWICGVGGLLMFALLGHYVWRIF*
Ga0066659_1040660723300006797SoilMDKKEINSPKLTANFLFWICGAGSLLLVAFLAHFVWKIL*
Ga0073928_1001309343300006893Iron-Sulfur Acid SpringMDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYIWKIF*
Ga0073928_1010484323300006893Iron-Sulfur Acid SpringMDKKEINSPKLTANFLFWIAGVGGAVLVALLGHYVWKIF*
Ga0073928_1037520733300006893Iron-Sulfur Acid SpringMDKKEINSPKLTANFLFWVCGVGGVFVFGLLGHYVWKVF*
Ga0073928_1093932413300006893Iron-Sulfur Acid SpringMDKKQINSPKLTANFLFWVCGAGGMAILLAHYLWKVF*
Ga0102924_128836113300007982Iron-Sulfur Acid SpringMNKKEINSPKLTANFLFWVVGVGGVLLVVFLGHFVWKIF*
Ga0099792_1001895753300009143Vadose Zone SoilMEKKEINSSRLSADFLFWICGVGGLLIIALLGHYVWRVF*
Ga0099792_1055872613300009143Vadose Zone SoilRETSTMDKREINSPRLTANFLFWVCGVGGLLVIAFLGHYVWRAF*
Ga0116121_1000014263300009644PeatlandMDKKEINSPKLTANFLFWICGVGGLLMAALLGHYLWKIF*
Ga0116224_1003790653300009683Peatlands SoilMDKKEINSPRLTLNFVFWICGVGGSVLLILLAHFVWKVL*
Ga0074045_1042453013300010341Bog Forest SoilMDKKEINSPKLTENFLFWICGVGVLLLVALFSHFVWHLY*
Ga0074044_1002615243300010343Bog Forest SoilMDKKEINSSRLTLNFVFWICGVGGSVLLILLAHFVWKVL*
Ga0134125_1017991823300010371Terrestrial SoilMDKKEINSPKLTGNFLFWICGVGGVILIVFFGHFVWKIF*
Ga0134128_1307091013300010373Terrestrial SoilHTMDKKEINSPKLTGNFLFWICGVGGVILIVFFGHFVWKIF*
Ga0126381_10174899023300010376Tropical Forest SoilMEKKEINSPKLTASFVFRILGVGGLLLAFFLAYFVWKIV*
Ga0136449_10014278353300010379Peatlands SoilMDKKEINSPKLTANFLIWVCGVGGLLLLIFLAHFVWKIL*
Ga0136449_10035494433300010379Peatlands SoilMDKKEINSPKLTENFLFWICGVGGLLLLVMLAHFVWHLY*
Ga0126361_1030258733300010876Boreal Forest SoilMDKKEINSPKLTANFLFWVVGVGGILLVAFLAHYVWKIF*
Ga0150983_1526653213300011120Forest SoilMDKKEINSPNLTAAFLFWVCGVGGLLLFALLGHYLWKAF*
Ga0137376_1018266453300012208Vadose Zone SoilMDKKEINSPKLTANFLFWICGAGALLLVAFLVHFVWKIL*
Ga0137376_1141632423300012208Vadose Zone SoilMDKKEINSPKLTANFLFWICGVGALLLVAFLAHFVWKIL*
Ga0137360_1125855423300012361Vadose Zone SoilDKKEINSPKLTANFLIWICGVGALLLVAFLAHVVWKIL*
Ga0137358_1003483623300012582Vadose Zone SoilMEKKEINSPRLSADFVFWICGVGGLLIIALLGHYVWRVF*
Ga0137397_1015647943300012685Vadose Zone SoilMEKREINSPRLTANYLFWVCGVGGLLVIALLGHYVWRAF*
Ga0137397_1114266813300012685Vadose Zone SoilMDKKEINSPKLTANFLFWICGIGALLLIAFLAHFVWRIL*
Ga0137394_1033718223300012922Vadose Zone SoilMDKKEINSPKLTANFLFWVCGVGGVLLIALLGHYVWRIF*
Ga0137394_1070032713300012922Vadose Zone SoilMDKKEINSPKLTGNFLFWICGVGALLLVGFLAHFVWRIL*
Ga0137416_1083263313300012927Vadose Zone SoilMDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVWKIH*
Ga0137404_1030457313300012929Vadose Zone SoilMDKKEINSPRLTANFLFWVCGVGGVLLIALLEHYVWRIF*
Ga0153915_1004217223300012931Freshwater WetlandsMDKKEINSPKLTANFLFWVCGVGGLLVLIFLAHFVWRIL*
Ga0137410_1001097263300012944Vadose Zone SoilMDKKEINSPKLTANFLFWVCGVGGALLIALLGHYVWRIF*
Ga0137410_1006063453300012944Vadose Zone SoilMDKKEINSAKLTANFLFWVCGVGGLLLIVLLGHFVWKVF*
Ga0164303_1115442013300012957SoilMDKKEINSPKLTANFLFWICGIGALLLIAFLAHFVW
Ga0164305_1011080333300012989SoilMDKKQINSPKLTAHFLFWVCGVGGVFVLLLGHYVWKVF*
Ga0120123_107346123300013770PermafrostPRDQIPSDQGTSTMDKKQINSPKLTANFLFWVCGVGGVVVLLGHYVWKVF*
Ga0120132_107287813300013832PermafrostGYTSNMDKKEINSPKLTGNFLFWICGIGGVVLIGLLGHFVWRIF*
Ga0181531_1001118223300014169BogMDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVWRVI*
Ga0181531_1021122023300014169BogMMAKTKRIKTMDKKEINSPKLTANFLIWICGVGGLLMFALLGHYVWRIF*
Ga0181537_1003863313300014201BogMDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVW
Ga0181537_1015150633300014201BogYSSFMDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVWRVI*
Ga0182018_10001004203300014489PalsaMDKKEINSPKLTANFLFWIAGVGGALLVALLGHYVWKIF*
Ga0182014_10001063373300014491BogMDKKEINSPKLTANFLFWICGIGGLLLFAMLAHFIWRAF*
Ga0182014_10001166333300014491BogMDKKEINSPKLTENFLFWICGVGGLLLVALFSHFVWHLY*
Ga0182017_1053540713300014494FenMDKKEINSPKLTANFLFWICGVGGVLVFGLLGHYIWKIF*
Ga0182024_10000563303300014501PermafrostMDKKEINSPKLTANFLFWVAGVGGVLLVTLLAHFVWKIF*
Ga0182024_10068813123300014501PermafrostVDKKEINSPKLTANFLFWVCGVGGALLLAILAHYVWRIF*
Ga0182024_1102425813300014501PermafrostMDKKEINSPKLTANFLFWVCGVGGAVLIAVLGHYVWKVF*
Ga0182024_1108267223300014501PermafrostMDKKEINSPKLTANFLFWVAGVGGVLLVALLGHYVWKMF*
Ga0181522_1023640013300014657BogMDKKEINSSKLTANFLFWVCGVGVLLLVALLGHFVWKIF*
Ga0167662_102292123300015082Glacier Forefield SoilMEKKEINSPKLTGNFLFWVCGVGGLMLVALLGHFVWHIF*
Ga0137403_1031747723300015264Vadose Zone SoilMDKKEINSPRLTANFLFWVSGVGGVLLIALLEHYV
Ga0187803_1005861623300017934Freshwater SedimentMDKKEINSPKLTANFLFWICGVGGVLLIGLGLLGHYIWKVF
Ga0187819_1066685323300017943Freshwater SedimentMNVTLSATMDKKEINSPQLTANFLFWICGVGGVLLIVLLGHYVWRVL
Ga0187847_1002999333300017948PeatlandMDKKEINSPKLTANFLFWICGVGGLLMAALLGHYLWKIF
Ga0187817_1094511623300017955Freshwater SedimentMDKKEINSPKLTANFLFWVCGVGGVLLVVLLGHYVW
Ga0187884_1037721123300018009PeatlandMDKKEINSPKATANFLIWICGVGGLLLLIFLAHFVWKIL
Ga0184605_1020940123300018027Groundwater SedimentMDKKEINSPKLTANFLIWICGVGALLLVAFLAHFVWKIL
Ga0184605_1037186213300018027Groundwater SedimentMDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVW
Ga0187863_1086566823300018034PeatlandMDKKEINSPKLTENFLFWICGVGGLLLLALFSPFVWHLF
Ga0187883_1018653023300018037PeatlandMDKKEINSPKLTANFLFWICGVGGLLMAALLGHYVWKIF
Ga0187855_1086617623300018038PeatlandMDKKEINSSKLTANFLFWVCGVGVLLLVALLGHFVWK
Ga0184619_1007409323300018061Groundwater SedimentMDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVWKIF
Ga0066667_1194131913300018433Grasslands SoilMDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVWKIL
Ga0193723_114643823300019879SoilMDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVWKIL
Ga0193747_100910843300019885SoilMDKKEINSPKLTANFLFWICGLGALLLVAFLAHFVWKIL
Ga0193751_102628813300019888SoilMDKKEINSPQLTASFLFWICGVGGVAPLALLGHYVWKIF
Ga0193751_126622823300019888SoilMDKKEINSPKLTANFLFWVAGVGGVLLVALLGHYIWKIF
Ga0210407_1003068873300020579SoilMDKKEINSLNLTANFLFWICGVGGLLLFALLGHYVWKAF
Ga0210403_10010633133300020580SoilMDKKEINSPKLTANFLFWIAGVGGALLVALLGHYVWKIF
Ga0210403_1017661743300020580SoilMDKKEINSRALTFNFVFWICGVGGLVLLILLAHFVWKVL
Ga0210401_1051244323300020583SoilLSCALFEPAAMDKKEINSPNLTANFIFWVCGVGGLLLLALLGAFV
Ga0215015_1034428423300021046SoilMDKKEINSPKLTANFLFWVGGVGGVLLVAFWGHYVWKIF
Ga0210400_1081912713300021170SoilMDKKEINSPKLTANFLFWVAGVGGALLVALLGHYVWKIF
Ga0210388_1024702833300021181SoilLAKAEGRKLKTMDKKEINSPRLTANFLFWICGVGGLLVFALLGHYVWKVF
Ga0210393_1008770843300021401SoilMDKKEINSPKLTANFLFWICGVGGLLLAIFLAHYVWRVF
Ga0210393_1030624613300021401SoilMDKKEINSPTLTLNFVFWICGVGGLVLLLLLAHFVWKVL
Ga0210387_1018250433300021405SoilMNKKEINSPKLTANFLFWVGGVGGALLIAFLGHFIWKVF
Ga0210383_1001009733300021407SoilMNKKEISSPKVTVNFLIWVCGVGGLLLLIVLAHFVWKIM
Ga0210383_1009091113300021407SoilMHPSSAMDKKEINSPKLTANFLFWICGVGGLLLAIFLAHYVWR
Ga0193750_100145073300021413SoilMDKKEINSPKLTANFLFWICGVGALLLVAFLAHFVWKIL
Ga0210394_1053766333300021420SoilMDKKEINSPRLTLNFVFWICGVGGLVLLLLLAHFVWKVL
Ga0210394_1078773613300021420SoilMDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYVWKIF
Ga0210391_1006634633300021433SoilMEKKEINSPTLTLNFVFWICGVGGLVLLILLAHFIWKVL
Ga0210391_1031065023300021433SoilMDKKEINSPKLTANFIVWVCGVGGLLLLVFLAHFVWKIL
Ga0210391_1072655113300021433SoilMDKKEIDSPKLTANFIIWICGVGGLLLLNFLGSFRLE
Ga0210392_1127906923300021475SoilKRHLMRCVIRPMNKKEINSPKLTANFLFWVGGVGGALLIAFLGHFIWKVF
Ga0210398_1064602923300021477SoilMDKKEINSPTLALNFVFWICGVGGLVLLLLLAHFVWKVL
Ga0210398_1102299523300021477SoilMDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYTWKIF
Ga0210402_1000084543300021478SoilMDKKDINSPALTANFLFWVCGVGGLLLIALLGRYVWKVF
Ga0210402_1008887943300021478SoilMDKKEINSPALTANFLFWVCGVGGLLLIALLGRYVWKVF
Ga0210402_1041613653300021478SoilMDKKEINSPKLTANFLFWICGVGGLVLFVLLGHYVWRVF
Ga0210410_1122738513300021479SoilMDKKEINSPKLTANFLFWIAGVGGALLVALLGHYVWK
Ga0210409_1007339163300021559SoilMDKKEINSPNLTANFLFWVCGVGGLLLFALLGPFVWKAF
Ga0212123_10004974203300022557Iron-Sulfur Acid SpringMDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYIWKIF
Ga0212123_1009862033300022557Iron-Sulfur Acid SpringMDKKEINSPKLTANFLFWIAGVGGAVLVALLGHYVWKIF
Ga0212123_1087565313300022557Iron-Sulfur Acid SpringMDKKQINSPKLTANFLFWVCGAGGMAILLAHYLWKVF
Ga0224558_1000514123300023090SoilMDKKEINSPKLTANFLFWICGIGGLLLFAMLAHFIWRAF
Ga0207646_1085344423300025922Corn, Switchgrass And Miscanthus RhizosphereMDKKEINSPKLTANFLFWVCGVGGVLLIALLGHYVWRVF
Ga0209849_103678513300026215SoilMDKKEINSPRLTANFLFWVAGIGGVLLVALLHYVWKVF
Ga0209839_1018713923300026294SoilMDKKEINSPKLTAHFLIWVCGVGGLLLAYLFAHVIFHVL
Ga0209131_108690223300026320Grasslands SoilMEKREINSPRLTANFLFWVCGVGGLLVIALLGHYVWRAF
Ga0209801_102869513300026326SoilMDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVRKIL
Ga0208366_100115713300027073Forest SoilLFEAAAMDKKEINSPNLTANFLFWVCGVGGLLLFALWGPFVWKAF
Ga0209732_101580733300027117Forest SoilMNKKEINSPNLTANFLFWIAGVGGVLLVAVLHYVWKVF
Ga0209010_1000219183300027370Forest SoilMDKKEINSPKLTANFLIWVGGVGGLLLLLLLAHFVWKIR
Ga0209421_105927923300027432Forest SoilMDKKEINSPKLTANFLFWICGVGGVLLIGLLGHYVWRIF
Ga0209734_108617923300027535Forest SoilMDKKEINSPKLTANFLFWVAGVGGVLLVALLGHYVWKVF
Ga0209008_102045843300027545Forest SoilMDKKEINSPKLTANFIFWICGVGVLLLFALLAHYVWRVF
Ga0209219_104864213300027565Forest SoilMMDKKEINSPKLTANLLFWVCGVGSVVVVALLGHYVWKIF
Ga0209525_100130823300027575Forest SoilMDKKEINSPKLTINFLIWICGVGGLLLAYLLAHFVLHVV
Ga0209118_1000019323300027674Forest SoilMDKKEINSPKLTVNFLIWICGVGGLLLFTCLAHFVWKIL
Ga0209040_1011888033300027824Bog Forest SoilMDKKEINSPKLTANFLFWIAGVGGVLLVALLHYVWKVF
Ga0209274_1029157023300027853SoilMDKKEINSPKLTANFLIWVGGVGGLLLLLFLAHFVWKIR
Ga0209517_10005095153300027854Peatlands SoilMDKKEINSPRLTLDFLFWICGVGGFVLLILLAHFVWKVL
Ga0209166_1061840123300027857Surface SoilMDKKEINSPTLTLNFVFWICGVGGLVLLILSAHFVWKVL
Ga0209167_1000383153300027867Surface SoilMDKKEINSPKATANFIVWVCGVGGLLLLIFLANFVWKIL
Ga0209169_1063808323300027879SoilTMDKKEINSPKLTINFLIWICGVGGLLMFALLGHYVWRIF
Ga0209068_1009196833300027894WatershedsMDKKEINSPNLTANFLFWVCGVGGLLLFALLGHYVWKAF
Ga0209488_1000470573300027903Vadose Zone SoilMEKKEINSSRLSADFLFWICGVGGLLIIALLGHYVWRVF
Ga0209006_1000128993300027908Forest SoilMDKKEINSPNLTANFLIWVGGVGGLLLLLFLAHFMWKIR
Ga0209006_1113345623300027908Forest SoilMDKKEINSPKLTANFLFWVAGVGGVLLVALLAHYVWKIF
Ga0209583_1045347923300027910WatershedsMDKKEINSPNLTANFLFQVCGVGGLLLFALLGHYVWKAF
Ga0209698_1001532643300027911WatershedsMDKKEIYSPNLTANFLFWVCGVGGLLLFALFGHYVWRLFEQS
Ga0209069_1027158113300027915WatershedsDKKEVNSSNLTANFLFWVCGVGGLLLFALVGHYVWKAF
Ga0209526_1000623063300028047Forest SoilMDKKEINSPKLTANFLFWVCGVGGVVLVALLGHFVWKIF
Ga0209526_1072840023300028047Forest SoilSAMDKKEINSPKLTANFLFWVCGVGGVLLVGFLGHYVWKVF
Ga0302159_1000166793300028646FenMNKKEINSPKLTANFLFWVCGVGGVLVIGLLGHYIWRVF
Ga0302165_1008430423300028678FenMDKKEINSPKLTANFLFWVCGVGGVLLFGVLGHYIWKVF
Ga0308309_1186489823300028906SoilMDKKEINSPKLTINFLIWICGVGGLLMFALLGHYVWRIF
Ga0311340_1016418933300029943PalsaMDKKEINSPKLTANFLIWVGGVGGLLLLLFLAHFVWKIL
Ga0311334_1169462523300029987FenMDKKEINSPKLTANFLFWVCGVGGVLMMALLGRYVWKVF
Ga0311338_1001841193300030007PalsaMDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVWRVV
Ga0302217_1008550223300030052FenMNKKEINSPKLTANFLFWVCGVGGVLVIGLLGHYIW
Ga0311354_1132159623300030618PalsaMDKKEINSPKLTANFLIWVGGVGGLLLLLFLAHFVW
Ga0073994_1000934423300030991SoilMDKKEINSPKLTANFLFWVCGVGGVLLVGFLGHYVWKVF
Ga0302325_1307630423300031234PalsaGTTEYSSFMDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVWRVI
Ga0265325_1000487593300031241RhizosphereMDKKEINSPKLTANFLFWIAGVGGVLLVALLHYVWRVF
Ga0265316_1081384423300031344RhizosphereMDKKEINSPKLTAQFLFWVGGGVLLIAFLIARYVFHVL
Ga0310686_10418980223300031708SoilMDKKEINSPKLTANFLIWVGGVGGLLLLLFLVHFVWKIR
Ga0310686_11305078013300031708SoilMDKKEINSPKLTANFLIWICGVGGLLLFALLGHYVWRIF
Ga0307476_1006429433300031715Hardwood Forest SoilMDKKKINSPKLAANFLFWVAGVGGAVLVAFLAHYVWKIF
Ga0307469_1081655023300031720Hardwood Forest SoilMDKKEINSPKLTASFLFWVCGVGGLLLVALLGHYVWKIF
Ga0307469_1155819423300031720Hardwood Forest SoilMDKKELNSPKLTANFLFWICGVGALLLVAFLAHFVWKIL
Ga0307468_10020866313300031740Hardwood Forest SoilLSCALFEPAAMDKKEINSPNLTANFLFWVCGVGGLLLLALLGAFAWKTF
Ga0311301_1007493993300032160Peatlands SoilMDKKEINSPKLTANFLIWVCGVGGLLLLIFLAHFVWKIL
Ga0311301_1033941123300032160Peatlands SoilMDKKEINSPKLTENFLFWICGVGGLLLLVMLAHFVWHLY
Ga0307471_10037839133300032180Hardwood Forest SoilMDKKEINSPKLTANFLFWVCGVGGVALVVILGHYVWEIF
Ga0307472_10116935613300032205Hardwood Forest SoilPAGRRRYMDKKEINSPKLTANFLFWICGVGALLLVAFLAHFVWKIL
Ga0335079_1211737013300032783SoilMDKKEINSPGLTANFLFWICGVGVTLLVLFLGHYIWKIF
Ga0335078_1068728633300032805SoilMDKKEINSPQLTANFIVWICGVGGLLLFVLLSHFVWRVW
Ga0335078_1119600723300032805SoilMVKKEINSRQLTANFVIWICGVGGLLLFVLLGHFVWRVW
Ga0335070_1083037523300032829SoilGPDHGEKEIKSPKLTANFVFWILGVGGLTLAFLLAHFVWNIV
Ga0335075_1126342933300032896SoilKKEINSPKLTANFLIWVGGVGGLLLIIFLAHFVWKIF
Ga0326726_1036001413300033433Peat SoilMDKKEINSSKLTANFLFWVCGVGGVLLIILLGHYVWKGF
Ga0334792_157584_2_1093300033888SoilEINSPKLTANFLFWVAGVGGVLLVTLLARFVWKIF
Ga0370515_0002097_4030_41493300034163Untreated Peat SoilMMDKKEINSPKLTANFLFWVAGVGAVLLVALLHYVWRVF
Ga0370514_163915_2_1093300034199Untreated Peat SoilMMDKKEINSPKLTANFLFWVAGVGAVLLVALLHYVW
Ga0370492_0202596_43_1623300034282Untreated Peat SoilMDKKEINSPKLTINFLIWVCGVGGLLLAYLLAHFVFHLV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.