Basic Information | |
---|---|
Family ID | F022542 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 214 |
Average Sequence Length | 39 residues |
Representative Sequence | MDKKEINSPKLTANFLFWICGVGGLLLLGFLGHYVWKIF |
Number of Associated Samples | 168 |
Number of Associated Scaffolds | 214 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 52.80 % |
% of genes near scaffold ends (potentially truncated) | 18.22 % |
% of genes from short scaffolds (< 2000 bps) | 66.36 % |
Associated GOLD sequencing projects | 151 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.364 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (12.149 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.234 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.140 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 214 Family Scaffolds |
---|---|---|
PF01425 | Amidase | 2.80 |
PF13545 | HTH_Crp_2 | 2.34 |
PF01878 | EVE | 2.34 |
PF01850 | PIN | 1.87 |
PF12706 | Lactamase_B_2 | 1.87 |
PF00196 | GerE | 1.40 |
PF13620 | CarboxypepD_reg | 1.40 |
PF00144 | Beta-lactamase | 0.93 |
PF01594 | AI-2E_transport | 0.93 |
PF06172 | Cupin_5 | 0.93 |
PF13502 | AsmA_2 | 0.93 |
PF07238 | PilZ | 0.93 |
PF12697 | Abhydrolase_6 | 0.93 |
PF05977 | MFS_3 | 0.93 |
PF13361 | UvrD_C | 0.93 |
PF01175 | Urocanase | 0.93 |
PF00575 | S1 | 0.93 |
PF10101 | DUF2339 | 0.47 |
PF13298 | LigD_N | 0.47 |
PF00156 | Pribosyltran | 0.47 |
PF12787 | EcsC | 0.47 |
PF00118 | Cpn60_TCP1 | 0.47 |
PF03279 | Lip_A_acyltrans | 0.47 |
PF01165 | Ribosomal_S21 | 0.47 |
PF01494 | FAD_binding_3 | 0.47 |
PF00005 | ABC_tran | 0.47 |
PF00691 | OmpA | 0.47 |
PF05036 | SPOR | 0.47 |
PF01872 | RibD_C | 0.47 |
PF02518 | HATPase_c | 0.47 |
PF00291 | PALP | 0.47 |
PF04366 | Ysc84 | 0.47 |
PF04014 | MazE_antitoxin | 0.47 |
PF00474 | SSF | 0.47 |
PF01527 | HTH_Tnp_1 | 0.47 |
PF00364 | Biotin_lipoyl | 0.47 |
PF08281 | Sigma70_r4_2 | 0.47 |
PF02239 | Cytochrom_D1 | 0.47 |
PF06983 | 3-dmu-9_3-mt | 0.47 |
PF01627 | Hpt | 0.47 |
PF01326 | PPDK_N | 0.47 |
PF12700 | HlyD_2 | 0.47 |
PF13546 | DDE_5 | 0.47 |
PF14534 | DUF4440 | 0.47 |
PF14602 | Hexapep_2 | 0.47 |
PF13807 | GNVR | 0.47 |
PF01987 | AIM24 | 0.47 |
PF13924 | Lipocalin_5 | 0.47 |
PF00072 | Response_reg | 0.47 |
PF01804 | Penicil_amidase | 0.47 |
PF13432 | TPR_16 | 0.47 |
PF00962 | A_deaminase | 0.47 |
PF00275 | EPSP_synthase | 0.47 |
PF07228 | SpoIIE | 0.47 |
PF13646 | HEAT_2 | 0.47 |
PF16363 | GDP_Man_Dehyd | 0.47 |
PF13466 | STAS_2 | 0.47 |
PF04972 | BON | 0.47 |
PF09335 | SNARE_assoc | 0.47 |
PF00479 | G6PD_N | 0.47 |
PF03631 | Virul_fac_BrkB | 0.47 |
PF08240 | ADH_N | 0.47 |
PF10397 | ADSL_C | 0.47 |
PF13245 | AAA_19 | 0.47 |
PF04185 | Phosphoesterase | 0.47 |
PF01380 | SIS | 0.47 |
PF13185 | GAF_2 | 0.47 |
PF03726 | PNPase | 0.47 |
PF00213 | OSCP | 0.47 |
PF12705 | PDDEXK_1 | 0.47 |
PF00892 | EamA | 0.47 |
PF00135 | COesterase | 0.47 |
PF04191 | PEMT | 0.47 |
PF00069 | Pkinase | 0.47 |
PF00202 | Aminotran_3 | 0.47 |
PF00132 | Hexapep | 0.47 |
PF00702 | Hydrolase | 0.47 |
COG ID | Name | Functional Category | % Frequency in 214 Family Scaffolds |
---|---|---|---|
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.80 |
COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 2.34 |
COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 2.34 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.87 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.93 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.93 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.93 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.93 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.93 |
COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 0.93 |
COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 0.93 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.47 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.47 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.47 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.47 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.47 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.47 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.47 |
COG0712 | FoF1-type ATP synthase, delta subunit | Energy production and conversion [C] | 0.47 |
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.47 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.47 |
COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.47 |
COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.47 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.47 |
COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.47 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.47 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.47 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.47 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.47 |
COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.36 % |
Unclassified | root | N/A | 26.64 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918007|ConsensusfromContig183555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300000567|JGI12270J11330_10060519 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
3300001082|JGI12664J13189_1000016 | All Organisms → cellular organisms → Bacteria | 22243 | Open in IMG/M |
3300001082|JGI12664J13189_1001664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2628 | Open in IMG/M |
3300001154|JGI12636J13339_1001479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3965 | Open in IMG/M |
3300001471|JGI12712J15308_10022760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1637 | Open in IMG/M |
3300001593|JGI12635J15846_10236067 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300001593|JGI12635J15846_10878910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300001661|JGI12053J15887_10024066 | All Organisms → cellular organisms → Bacteria | 3411 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100063501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3391 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101523438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 564 | Open in IMG/M |
3300002911|JGI25390J43892_10035224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
3300004091|Ga0062387_100072385 | Not Available | 1750 | Open in IMG/M |
3300004092|Ga0062389_101498355 | Not Available | 858 | Open in IMG/M |
3300004102|Ga0058888_1334228 | Not Available | 583 | Open in IMG/M |
3300004103|Ga0058903_1000278 | Not Available | 1145 | Open in IMG/M |
3300004139|Ga0058897_11053271 | Not Available | 1113 | Open in IMG/M |
3300004635|Ga0062388_101425965 | Not Available | 696 | Open in IMG/M |
3300005171|Ga0066677_10338346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
3300005174|Ga0066680_10062213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2219 | Open in IMG/M |
3300005434|Ga0070709_11093062 | Not Available | 637 | Open in IMG/M |
3300005436|Ga0070713_100026540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4549 | Open in IMG/M |
3300005446|Ga0066686_10958342 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005467|Ga0070706_100001557 | All Organisms → cellular organisms → Bacteria | 23929 | Open in IMG/M |
3300005468|Ga0070707_100076443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3230 | Open in IMG/M |
3300005518|Ga0070699_100184675 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
3300005529|Ga0070741_10000530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 135757 | Open in IMG/M |
3300005536|Ga0070697_100157780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1916 | Open in IMG/M |
3300005536|Ga0070697_101490152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300005536|Ga0070697_101676928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300005537|Ga0070730_10606087 | Not Available | 698 | Open in IMG/M |
3300005538|Ga0070731_10690859 | Not Available | 678 | Open in IMG/M |
3300005541|Ga0070733_10004909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8869 | Open in IMG/M |
3300005591|Ga0070761_10062383 | Not Available | 2106 | Open in IMG/M |
3300005610|Ga0070763_10535472 | Not Available | 673 | Open in IMG/M |
3300005891|Ga0075283_1010858 | Not Available | 1360 | Open in IMG/M |
3300005921|Ga0070766_10467645 | Not Available | 834 | Open in IMG/M |
3300005993|Ga0080027_10090070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
3300005994|Ga0066789_10001250 | All Organisms → cellular organisms → Bacteria | 10949 | Open in IMG/M |
3300005994|Ga0066789_10038498 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
3300005995|Ga0066790_10100049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1245 | Open in IMG/M |
3300005995|Ga0066790_10226300 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300006028|Ga0070717_10244323 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
3300006028|Ga0070717_10525293 | Not Available | 1071 | Open in IMG/M |
3300006028|Ga0070717_10737056 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300006041|Ga0075023_100569804 | Not Available | 521 | Open in IMG/M |
3300006052|Ga0075029_100256977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
3300006052|Ga0075029_100388125 | Not Available | 905 | Open in IMG/M |
3300006059|Ga0075017_100645109 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300006086|Ga0075019_10416820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 824 | Open in IMG/M |
3300006162|Ga0075030_100855915 | Not Available | 717 | Open in IMG/M |
3300006163|Ga0070715_10375669 | Not Available | 783 | Open in IMG/M |
3300006173|Ga0070716_101256844 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300006176|Ga0070765_100148214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2090 | Open in IMG/M |
3300006176|Ga0070765_101768309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300006176|Ga0070765_102175516 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006797|Ga0066659_10406607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
3300006893|Ga0073928_10013093 | All Organisms → cellular organisms → Bacteria | 9371 | Open in IMG/M |
3300006893|Ga0073928_10104843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2364 | Open in IMG/M |
3300006893|Ga0073928_10375207 | Not Available | 1047 | Open in IMG/M |
3300006893|Ga0073928_10939324 | Not Available | 591 | Open in IMG/M |
3300007982|Ga0102924_1288361 | Not Available | 658 | Open in IMG/M |
3300009143|Ga0099792_10018957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3038 | Open in IMG/M |
3300009143|Ga0099792_10558726 | Not Available | 724 | Open in IMG/M |
3300009644|Ga0116121_1000014 | All Organisms → cellular organisms → Bacteria | 82456 | Open in IMG/M |
3300009683|Ga0116224_10037906 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
3300010341|Ga0074045_10424530 | Not Available | 860 | Open in IMG/M |
3300010343|Ga0074044_10026152 | All Organisms → cellular organisms → Bacteria | 4156 | Open in IMG/M |
3300010371|Ga0134125_10179918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2355 | Open in IMG/M |
3300010373|Ga0134128_13070910 | Not Available | 513 | Open in IMG/M |
3300010376|Ga0126381_101748990 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300010379|Ga0136449_100142783 | All Organisms → cellular organisms → Bacteria | 4726 | Open in IMG/M |
3300010379|Ga0136449_100354944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2632 | Open in IMG/M |
3300010876|Ga0126361_10302587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1899 | Open in IMG/M |
3300011120|Ga0150983_15266532 | Not Available | 570 | Open in IMG/M |
3300012208|Ga0137376_10182664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1811 | Open in IMG/M |
3300012208|Ga0137376_11416324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300012361|Ga0137360_11258554 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012582|Ga0137358_10034836 | All Organisms → cellular organisms → Bacteria | 3320 | Open in IMG/M |
3300012685|Ga0137397_10156479 | Not Available | 1690 | Open in IMG/M |
3300012685|Ga0137397_11142668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300012922|Ga0137394_10337182 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1287 | Open in IMG/M |
3300012922|Ga0137394_10700327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
3300012927|Ga0137416_10832633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300012929|Ga0137404_10304573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1383 | Open in IMG/M |
3300012931|Ga0153915_10042172 | All Organisms → cellular organisms → Bacteria | 4642 | Open in IMG/M |
3300012944|Ga0137410_10010972 | All Organisms → cellular organisms → Bacteria | 6138 | Open in IMG/M |
3300012944|Ga0137410_10060634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2721 | Open in IMG/M |
3300012957|Ga0164303_11154420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300012989|Ga0164305_10110803 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
3300013770|Ga0120123_1073461 | Not Available | 756 | Open in IMG/M |
3300013832|Ga0120132_1072878 | Not Available | 692 | Open in IMG/M |
3300014169|Ga0181531_10011182 | All Organisms → cellular organisms → Bacteria | 5155 | Open in IMG/M |
3300014169|Ga0181531_10211220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1180 | Open in IMG/M |
3300014201|Ga0181537_10038633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3265 | Open in IMG/M |
3300014201|Ga0181537_10151506 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
3300014489|Ga0182018_10001004 | All Organisms → cellular organisms → Bacteria | 34078 | Open in IMG/M |
3300014491|Ga0182014_10001063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 37356 | Open in IMG/M |
3300014491|Ga0182014_10001166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 35556 | Open in IMG/M |
3300014494|Ga0182017_10535407 | Not Available | 716 | Open in IMG/M |
3300014501|Ga0182024_10000563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 95761 | Open in IMG/M |
3300014501|Ga0182024_10068813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5382 | Open in IMG/M |
3300014501|Ga0182024_11024258 | Not Available | 982 | Open in IMG/M |
3300014501|Ga0182024_11082672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
3300014657|Ga0181522_10236400 | Not Available | 1079 | Open in IMG/M |
3300015082|Ga0167662_1022921 | Not Available | 799 | Open in IMG/M |
3300015264|Ga0137403_10317477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1450 | Open in IMG/M |
3300017934|Ga0187803_10058616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1517 | Open in IMG/M |
3300017943|Ga0187819_10666853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300017948|Ga0187847_10029993 | All Organisms → cellular organisms → Bacteria | 3245 | Open in IMG/M |
3300017955|Ga0187817_10945116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
3300018009|Ga0187884_10377211 | Not Available | 571 | Open in IMG/M |
3300018027|Ga0184605_10209401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 885 | Open in IMG/M |
3300018027|Ga0184605_10371862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300018034|Ga0187863_10865668 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300018037|Ga0187883_10186530 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300018038|Ga0187855_10866176 | Not Available | 527 | Open in IMG/M |
3300018061|Ga0184619_10074093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
3300018433|Ga0066667_11941319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300019879|Ga0193723_1146438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300019885|Ga0193747_1009108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2385 | Open in IMG/M |
3300019888|Ga0193751_1026288 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
3300019888|Ga0193751_1266228 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300020579|Ga0210407_10030688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3997 | Open in IMG/M |
3300020580|Ga0210403_10010633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7482 | Open in IMG/M |
3300020580|Ga0210403_10176617 | Not Available | 1750 | Open in IMG/M |
3300020583|Ga0210401_10512443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
3300021046|Ga0215015_10344284 | Not Available | 4590 | Open in IMG/M |
3300021170|Ga0210400_10819127 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300021181|Ga0210388_10247028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1566 | Open in IMG/M |
3300021401|Ga0210393_10087708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2470 | Open in IMG/M |
3300021401|Ga0210393_10306246 | Not Available | 1291 | Open in IMG/M |
3300021405|Ga0210387_10182504 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300021407|Ga0210383_10010097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8064 | Open in IMG/M |
3300021407|Ga0210383_10090911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2564 | Open in IMG/M |
3300021413|Ga0193750_1001450 | Not Available | 6434 | Open in IMG/M |
3300021420|Ga0210394_10537663 | Not Available | 1028 | Open in IMG/M |
3300021420|Ga0210394_10787736 | Not Available | 831 | Open in IMG/M |
3300021433|Ga0210391_10066346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2859 | Open in IMG/M |
3300021433|Ga0210391_10310650 | Not Available | 1237 | Open in IMG/M |
3300021433|Ga0210391_10726551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
3300021475|Ga0210392_11279069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300021477|Ga0210398_10646029 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300021477|Ga0210398_11022995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 658 | Open in IMG/M |
3300021478|Ga0210402_10000845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 32997 | Open in IMG/M |
3300021478|Ga0210402_10088879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2760 | Open in IMG/M |
3300021478|Ga0210402_10416136 | Not Available | 1248 | Open in IMG/M |
3300021479|Ga0210410_11227385 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300021559|Ga0210409_10073391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3179 | Open in IMG/M |
3300022557|Ga0212123_10004974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24210 | Open in IMG/M |
3300022557|Ga0212123_10098620 | All Organisms → cellular organisms → Bacteria | 2394 | Open in IMG/M |
3300022557|Ga0212123_10875653 | Not Available | 531 | Open in IMG/M |
3300023090|Ga0224558_1000514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 44492 | Open in IMG/M |
3300025922|Ga0207646_10853444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
3300026215|Ga0209849_1036785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
3300026294|Ga0209839_10187139 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300026320|Ga0209131_1086902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1674 | Open in IMG/M |
3300026326|Ga0209801_1028695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2651 | Open in IMG/M |
3300027073|Ga0208366_1001157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2073 | Open in IMG/M |
3300027117|Ga0209732_1015807 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300027370|Ga0209010_1000219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 20695 | Open in IMG/M |
3300027432|Ga0209421_1059279 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300027535|Ga0209734_1086179 | Not Available | 601 | Open in IMG/M |
3300027545|Ga0209008_1020458 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300027565|Ga0209219_1048642 | Not Available | 1058 | Open in IMG/M |
3300027575|Ga0209525_1001308 | All Organisms → cellular organisms → Bacteria | 5449 | Open in IMG/M |
3300027674|Ga0209118_1000019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 134138 | Open in IMG/M |
3300027824|Ga0209040_10118880 | Not Available | 1468 | Open in IMG/M |
3300027853|Ga0209274_10291570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300027854|Ga0209517_10005095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16896 | Open in IMG/M |
3300027857|Ga0209166_10618401 | Not Available | 549 | Open in IMG/M |
3300027867|Ga0209167_10003831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7743 | Open in IMG/M |
3300027879|Ga0209169_10638083 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300027894|Ga0209068_10091968 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
3300027903|Ga0209488_10004705 | All Organisms → cellular organisms → Bacteria | 10593 | Open in IMG/M |
3300027908|Ga0209006_10001289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22749 | Open in IMG/M |
3300027908|Ga0209006_11133456 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300027910|Ga0209583_10453479 | Not Available | 623 | Open in IMG/M |
3300027911|Ga0209698_10015326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7471 | Open in IMG/M |
3300027915|Ga0209069_10271581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
3300028047|Ga0209526_10006230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8157 | Open in IMG/M |
3300028047|Ga0209526_10728400 | Not Available | 622 | Open in IMG/M |
3300028646|Ga0302159_10001667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5029 | Open in IMG/M |
3300028678|Ga0302165_10084304 | Not Available | 843 | Open in IMG/M |
3300028906|Ga0308309_11864898 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300029943|Ga0311340_10164189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2300 | Open in IMG/M |
3300029987|Ga0311334_11694625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300030007|Ga0311338_10018411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10188 | Open in IMG/M |
3300030052|Ga0302217_10085502 | Not Available | 709 | Open in IMG/M |
3300030618|Ga0311354_11321596 | Not Available | 646 | Open in IMG/M |
3300030991|Ga0073994_10009344 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300031234|Ga0302325_13076304 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300031241|Ga0265325_10004875 | All Organisms → cellular organisms → Bacteria | 8386 | Open in IMG/M |
3300031344|Ga0265316_10813844 | Not Available | 655 | Open in IMG/M |
3300031708|Ga0310686_104189802 | Not Available | 535 | Open in IMG/M |
3300031708|Ga0310686_113050780 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
3300031715|Ga0307476_10064294 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
3300031720|Ga0307469_10816550 | Not Available | 857 | Open in IMG/M |
3300031720|Ga0307469_11558194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300031740|Ga0307468_100208663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1330 | Open in IMG/M |
3300032160|Ga0311301_10074939 | All Organisms → cellular organisms → Bacteria | 7058 | Open in IMG/M |
3300032160|Ga0311301_10339411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2362 | Open in IMG/M |
3300032180|Ga0307471_100378391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
3300032205|Ga0307472_101169356 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300032783|Ga0335079_12117370 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300032805|Ga0335078_10687286 | Not Available | 1271 | Open in IMG/M |
3300032805|Ga0335078_11196007 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300032829|Ga0335070_10830375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 858 | Open in IMG/M |
3300032896|Ga0335075_11263429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
3300033433|Ga0326726_10360014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
3300033888|Ga0334792_157584 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300034163|Ga0370515_0002097 | All Organisms → cellular organisms → Bacteria | 9999 | Open in IMG/M |
3300034199|Ga0370514_163915 | Not Available | 575 | Open in IMG/M |
3300034282|Ga0370492_0202596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.68% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.54% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.21% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.74% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.27% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.80% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.34% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.34% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.34% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.87% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.87% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.40% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.40% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.40% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.40% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.47% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.47% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.47% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.47% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.47% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.47% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A_all_C_01798140 | 2140918007 | Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVAFLGHYVWKIF |
JGI12270J11330_100605194 | 3300000567 | Peatlands Soil | MDKKEINSPRLTLDFLFWICGVGGFVLLILLAHFVWKVL* |
JGI12664J13189_100001619 | 3300001082 | Forest Soil | MDKKEINSPKLTANFLIWVGGVGGLLLLLLLAHFVWKIR* |
JGI12664J13189_10016642 | 3300001082 | Forest Soil | MDKKEINSPKATANFLIWICGVGGLLLLIFLAHFVWKIL* |
JGI12636J13339_10014791 | 3300001154 | Forest Soil | MDKKEINSPKLTVNFLIWICGVGGLLLFTCLAHFVWKIL* |
JGI12712J15308_100227602 | 3300001471 | Forest Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVAFLGHYVWKIF* |
JGI12635J15846_102360672 | 3300001593 | Forest Soil | MDKKEINSPKLTANFVIWICGVGGLLLAYLLAHFIWRVI* |
JGI12635J15846_108789102 | 3300001593 | Forest Soil | MDKKEINSPKLTAKFLFWIAGVGGVLLVALLAHYVWKIF* |
JGI12053J15887_100240662 | 3300001661 | Forest Soil | MDKREINSPRLTANYLFWVCGVGGLLVIALLGHYVWRAF* |
JGIcombinedJ26739_1000635014 | 3300002245 | Forest Soil | MDKKEINSPKLTANFIFWICGVGVLLLFALLAHYVWRVF* |
JGIcombinedJ26739_1015234382 | 3300002245 | Forest Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVAFLGHYVWRIF* |
JGI25390J43892_100352241 | 3300002911 | Grasslands Soil | MDKKEINSPKLTANFLIWICGVGALLLVAFLAHFVWKIL* |
Ga0062387_1000723851 | 3300004091 | Bog Forest Soil | TMDRKEINSPKLTVNFLIWVCGVGGLLLVIFLAHFVWKII* |
Ga0062389_1014983551 | 3300004092 | Bog Forest Soil | MDKKEINSPKLTANFLIWVGGVGGLLLLLFLAHFVWKIR* |
Ga0058888_13342282 | 3300004102 | Forest Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYVWKIF* |
Ga0058903_10002783 | 3300004103 | Forest Soil | MDKKEINSPNLTANFLFWVCGVGGLLLFALLGPFVWKAF* |
Ga0058897_110532713 | 3300004139 | Forest Soil | AAMDKKEINSPNLTANFLFWVCGVGGLLLFALLGPFVWKAF* |
Ga0062388_1014259652 | 3300004635 | Bog Forest Soil | MDKKKINSPKLTANFLIWVGGVGGLLLLLFLAHFVWKIR* |
Ga0066677_103383462 | 3300005171 | Soil | MDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVWKIL* |
Ga0066680_100622132 | 3300005174 | Soil | MDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVRKIL* |
Ga0070709_110930621 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AAMDKKEINSPNLTANFLFWVCGVGGLLLLALLGAFVWKTF* |
Ga0070713_1000265405 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKEINSPNLTANFLFWVCGVGGLLLLALLGAFVWKTF* |
Ga0066686_109583422 | 3300005446 | Soil | MDKKEINSPKLTANFLFWICGVGALLLVVFLAHFVWKIL* |
Ga0070706_10000155728 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKEINSPKLTANFLFWICGAGALLLAAFLAHFVWKIL* |
Ga0070707_1000764432 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKEINSPKLTANFLFWVCGVGGVLLIALLGHYVWRVF* |
Ga0070699_1001846753 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKEINSPKLTANFLFWVCGVGGVLLVGFLGHYVWKVF* |
Ga0070741_1000053034 | 3300005529 | Surface Soil | MDKKEINSPKLTENFLFWICGVGGVILIGLLGHFVWKIF* |
Ga0070697_1001577803 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVWKIL* |
Ga0070697_1014901521 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKKEINSPKLTANFLFWICGVGTLLLVAFLAPFVWTIL* |
Ga0070697_1016769282 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVWKIF* |
Ga0070730_106060873 | 3300005537 | Surface Soil | MDKKEINSPTLTLNFVFWICGVGGLVLLILSAHFVWKVL* |
Ga0070731_106908592 | 3300005538 | Surface Soil | MNKKEISSPKVTVNFLIWVCGVGGLLLLIVFAHFVWKIM* |
Ga0070733_100049099 | 3300005541 | Surface Soil | MDKKEINSPKATANFIVWVCGVGGLLLLIFLANFVWKIL* |
Ga0070761_100623832 | 3300005591 | Soil | MDKKEINSPKLTANFIVWVCGVGGLLLLVFLAHFVWKIL* |
Ga0070763_105354722 | 3300005610 | Soil | MDKKEINSRKLTANFLIWVGGVGGLLLLLFLAHFVWKIR* |
Ga0075283_10108581 | 3300005891 | Rice Paddy Soil | MDKKEINSPKLTANFLFWICGVGGLLLLGFLGHYVWKIF* |
Ga0070766_104676453 | 3300005921 | Soil | MDKKEINSPRLTLNFVFWICGVGGLVLLLLLAHFVWKVL* |
Ga0080027_100900703 | 3300005993 | Prmafrost Soil | MDKKEINSPKLTGNFLFWICGVGGLILVGLLGHFVWRIF* |
Ga0066789_100012502 | 3300005994 | Soil | MNKKQINSPKLTANFLLWVGGAGGIVILLAHYVWKVF* |
Ga0066789_100384983 | 3300005994 | Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVALLHYVWKIF* |
Ga0066790_101000492 | 3300005995 | Soil | MDKKEINSPKLTINFLIWVCGVGGLLLAYLLVHFVFHLV* |
Ga0066790_102263002 | 3300005995 | Soil | MDKKEINSPKLTAHFLIWVCGVGGLLLAYLFAHVIFHVL* |
Ga0070717_102443232 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVREASTMDKKQINSPKLTAHFLFWVCGVGGVFVLLLGHYVWKVF* |
Ga0070717_105252932 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKQINSPKLTANFLFWVCGVGGVFVVLLGHYVWKVF* |
Ga0070717_107370561 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKEINSPKLTANFLFWVGGVGGVLLVAFWGHYVWKIF* |
Ga0075023_1005698042 | 3300006041 | Watersheds | TMDKKEINSSKLTANFLFWICGVGGVLMIGLLGHYIWRVF* |
Ga0075029_1002569772 | 3300006052 | Watersheds | MDKKEIYSPNLTANFLFWVCGVGGLLLFALFGHYVWRLFEQS* |
Ga0075029_1003881252 | 3300006052 | Watersheds | VDKKEINSPWLTARFLFWVCGVGGVAVLALLGHYVWKTF* |
Ga0075017_1006451093 | 3300006059 | Watersheds | MGKKEINSPKLAADFLFWVSSVGGELLIALLRQYLWKIS* |
Ga0075019_104168203 | 3300006086 | Watersheds | VDKKEINSPWLTARFLFWVCGVGGVAVLALLGHYVWK |
Ga0075030_1008559151 | 3300006162 | Watersheds | MDKKEINSPQLTARFLFWICGVGGVALLALLGHYVWKIL* |
Ga0070715_103756692 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKQINSPKLTANFLFWVCGVGGVFVLLLGHYVWKVF* |
Ga0070716_1012568442 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RQPAGRRRYMDKKEINSPKLTANFLFWICGVGALLMVALLAHFVWKIF* |
Ga0070765_1001482142 | 3300006176 | Soil | MHPSSAMDKKEINSPKLTANFLFWICGVGGLLLAIFLAHYVWRVF* |
Ga0070765_1017683092 | 3300006176 | Soil | MNKKEINSPKLTANFLFWVGGVGGALLIAFLGHFIWKVF* |
Ga0070765_1021755162 | 3300006176 | Soil | MDKKEINSPKLTINFLIWICGVGGLLMFALLGHYVWRIF* |
Ga0066659_104066072 | 3300006797 | Soil | MDKKEINSPKLTANFLFWICGAGSLLLVAFLAHFVWKIL* |
Ga0073928_100130934 | 3300006893 | Iron-Sulfur Acid Spring | MDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYIWKIF* |
Ga0073928_101048432 | 3300006893 | Iron-Sulfur Acid Spring | MDKKEINSPKLTANFLFWIAGVGGAVLVALLGHYVWKIF* |
Ga0073928_103752073 | 3300006893 | Iron-Sulfur Acid Spring | MDKKEINSPKLTANFLFWVCGVGGVFVFGLLGHYVWKVF* |
Ga0073928_109393241 | 3300006893 | Iron-Sulfur Acid Spring | MDKKQINSPKLTANFLFWVCGAGGMAILLAHYLWKVF* |
Ga0102924_12883611 | 3300007982 | Iron-Sulfur Acid Spring | MNKKEINSPKLTANFLFWVVGVGGVLLVVFLGHFVWKIF* |
Ga0099792_100189575 | 3300009143 | Vadose Zone Soil | MEKKEINSSRLSADFLFWICGVGGLLIIALLGHYVWRVF* |
Ga0099792_105587261 | 3300009143 | Vadose Zone Soil | RETSTMDKREINSPRLTANFLFWVCGVGGLLVIAFLGHYVWRAF* |
Ga0116121_100001426 | 3300009644 | Peatland | MDKKEINSPKLTANFLFWICGVGGLLMAALLGHYLWKIF* |
Ga0116224_100379065 | 3300009683 | Peatlands Soil | MDKKEINSPRLTLNFVFWICGVGGSVLLILLAHFVWKVL* |
Ga0074045_104245301 | 3300010341 | Bog Forest Soil | MDKKEINSPKLTENFLFWICGVGVLLLVALFSHFVWHLY* |
Ga0074044_100261524 | 3300010343 | Bog Forest Soil | MDKKEINSSRLTLNFVFWICGVGGSVLLILLAHFVWKVL* |
Ga0134125_101799182 | 3300010371 | Terrestrial Soil | MDKKEINSPKLTGNFLFWICGVGGVILIVFFGHFVWKIF* |
Ga0134128_130709101 | 3300010373 | Terrestrial Soil | HTMDKKEINSPKLTGNFLFWICGVGGVILIVFFGHFVWKIF* |
Ga0126381_1017489902 | 3300010376 | Tropical Forest Soil | MEKKEINSPKLTASFVFRILGVGGLLLAFFLAYFVWKIV* |
Ga0136449_1001427835 | 3300010379 | Peatlands Soil | MDKKEINSPKLTANFLIWVCGVGGLLLLIFLAHFVWKIL* |
Ga0136449_1003549443 | 3300010379 | Peatlands Soil | MDKKEINSPKLTENFLFWICGVGGLLLLVMLAHFVWHLY* |
Ga0126361_103025873 | 3300010876 | Boreal Forest Soil | MDKKEINSPKLTANFLFWVVGVGGILLVAFLAHYVWKIF* |
Ga0150983_152665321 | 3300011120 | Forest Soil | MDKKEINSPNLTAAFLFWVCGVGGLLLFALLGHYLWKAF* |
Ga0137376_101826645 | 3300012208 | Vadose Zone Soil | MDKKEINSPKLTANFLFWICGAGALLLVAFLVHFVWKIL* |
Ga0137376_114163242 | 3300012208 | Vadose Zone Soil | MDKKEINSPKLTANFLFWICGVGALLLVAFLAHFVWKIL* |
Ga0137360_112585542 | 3300012361 | Vadose Zone Soil | DKKEINSPKLTANFLIWICGVGALLLVAFLAHVVWKIL* |
Ga0137358_100348362 | 3300012582 | Vadose Zone Soil | MEKKEINSPRLSADFVFWICGVGGLLIIALLGHYVWRVF* |
Ga0137397_101564794 | 3300012685 | Vadose Zone Soil | MEKREINSPRLTANYLFWVCGVGGLLVIALLGHYVWRAF* |
Ga0137397_111426681 | 3300012685 | Vadose Zone Soil | MDKKEINSPKLTANFLFWICGIGALLLIAFLAHFVWRIL* |
Ga0137394_103371822 | 3300012922 | Vadose Zone Soil | MDKKEINSPKLTANFLFWVCGVGGVLLIALLGHYVWRIF* |
Ga0137394_107003271 | 3300012922 | Vadose Zone Soil | MDKKEINSPKLTGNFLFWICGVGALLLVGFLAHFVWRIL* |
Ga0137416_108326331 | 3300012927 | Vadose Zone Soil | MDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVWKIH* |
Ga0137404_103045731 | 3300012929 | Vadose Zone Soil | MDKKEINSPRLTANFLFWVCGVGGVLLIALLEHYVWRIF* |
Ga0153915_100421722 | 3300012931 | Freshwater Wetlands | MDKKEINSPKLTANFLFWVCGVGGLLVLIFLAHFVWRIL* |
Ga0137410_100109726 | 3300012944 | Vadose Zone Soil | MDKKEINSPKLTANFLFWVCGVGGALLIALLGHYVWRIF* |
Ga0137410_100606345 | 3300012944 | Vadose Zone Soil | MDKKEINSAKLTANFLFWVCGVGGLLLIVLLGHFVWKVF* |
Ga0164303_111544201 | 3300012957 | Soil | MDKKEINSPKLTANFLFWICGIGALLLIAFLAHFVW |
Ga0164305_101108033 | 3300012989 | Soil | MDKKQINSPKLTAHFLFWVCGVGGVFVLLLGHYVWKVF* |
Ga0120123_10734612 | 3300013770 | Permafrost | PRDQIPSDQGTSTMDKKQINSPKLTANFLFWVCGVGGVVVLLGHYVWKVF* |
Ga0120132_10728781 | 3300013832 | Permafrost | GYTSNMDKKEINSPKLTGNFLFWICGIGGVVLIGLLGHFVWRIF* |
Ga0181531_100111822 | 3300014169 | Bog | MDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVWRVI* |
Ga0181531_102112202 | 3300014169 | Bog | MMAKTKRIKTMDKKEINSPKLTANFLIWICGVGGLLMFALLGHYVWRIF* |
Ga0181537_100386331 | 3300014201 | Bog | MDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVW |
Ga0181537_101515063 | 3300014201 | Bog | YSSFMDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVWRVI* |
Ga0182018_1000100420 | 3300014489 | Palsa | MDKKEINSPKLTANFLFWIAGVGGALLVALLGHYVWKIF* |
Ga0182014_1000106337 | 3300014491 | Bog | MDKKEINSPKLTANFLFWICGIGGLLLFAMLAHFIWRAF* |
Ga0182014_1000116633 | 3300014491 | Bog | MDKKEINSPKLTENFLFWICGVGGLLLVALFSHFVWHLY* |
Ga0182017_105354071 | 3300014494 | Fen | MDKKEINSPKLTANFLFWICGVGGVLVFGLLGHYIWKIF* |
Ga0182024_1000056330 | 3300014501 | Permafrost | MDKKEINSPKLTANFLFWVAGVGGVLLVTLLAHFVWKIF* |
Ga0182024_1006881312 | 3300014501 | Permafrost | VDKKEINSPKLTANFLFWVCGVGGALLLAILAHYVWRIF* |
Ga0182024_110242581 | 3300014501 | Permafrost | MDKKEINSPKLTANFLFWVCGVGGAVLIAVLGHYVWKVF* |
Ga0182024_110826722 | 3300014501 | Permafrost | MDKKEINSPKLTANFLFWVAGVGGVLLVALLGHYVWKMF* |
Ga0181522_102364001 | 3300014657 | Bog | MDKKEINSSKLTANFLFWVCGVGVLLLVALLGHFVWKIF* |
Ga0167662_10229212 | 3300015082 | Glacier Forefield Soil | MEKKEINSPKLTGNFLFWVCGVGGLMLVALLGHFVWHIF* |
Ga0137403_103174772 | 3300015264 | Vadose Zone Soil | MDKKEINSPRLTANFLFWVSGVGGVLLIALLEHYV |
Ga0187803_100586162 | 3300017934 | Freshwater Sediment | MDKKEINSPKLTANFLFWICGVGGVLLIGLGLLGHYIWKVF |
Ga0187819_106668532 | 3300017943 | Freshwater Sediment | MNVTLSATMDKKEINSPQLTANFLFWICGVGGVLLIVLLGHYVWRVL |
Ga0187847_100299933 | 3300017948 | Peatland | MDKKEINSPKLTANFLFWICGVGGLLMAALLGHYLWKIF |
Ga0187817_109451162 | 3300017955 | Freshwater Sediment | MDKKEINSPKLTANFLFWVCGVGGVLLVVLLGHYVW |
Ga0187884_103772112 | 3300018009 | Peatland | MDKKEINSPKATANFLIWICGVGGLLLLIFLAHFVWKIL |
Ga0184605_102094012 | 3300018027 | Groundwater Sediment | MDKKEINSPKLTANFLIWICGVGALLLVAFLAHFVWKIL |
Ga0184605_103718621 | 3300018027 | Groundwater Sediment | MDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVW |
Ga0187863_108656682 | 3300018034 | Peatland | MDKKEINSPKLTENFLFWICGVGGLLLLALFSPFVWHLF |
Ga0187883_101865302 | 3300018037 | Peatland | MDKKEINSPKLTANFLFWICGVGGLLMAALLGHYVWKIF |
Ga0187855_108661762 | 3300018038 | Peatland | MDKKEINSSKLTANFLFWVCGVGVLLLVALLGHFVWK |
Ga0184619_100740932 | 3300018061 | Groundwater Sediment | MDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVWKIF |
Ga0066667_119413191 | 3300018433 | Grasslands Soil | MDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVWKIL |
Ga0193723_11464382 | 3300019879 | Soil | MDKKEINSPKLTANFLFWICGVGALLMVAFLAHFVWKIL |
Ga0193747_10091084 | 3300019885 | Soil | MDKKEINSPKLTANFLFWICGLGALLLVAFLAHFVWKIL |
Ga0193751_10262881 | 3300019888 | Soil | MDKKEINSPQLTASFLFWICGVGGVAPLALLGHYVWKIF |
Ga0193751_12662282 | 3300019888 | Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVALLGHYIWKIF |
Ga0210407_100306887 | 3300020579 | Soil | MDKKEINSLNLTANFLFWICGVGGLLLFALLGHYVWKAF |
Ga0210403_1001063313 | 3300020580 | Soil | MDKKEINSPKLTANFLFWIAGVGGALLVALLGHYVWKIF |
Ga0210403_101766174 | 3300020580 | Soil | MDKKEINSRALTFNFVFWICGVGGLVLLILLAHFVWKVL |
Ga0210401_105124432 | 3300020583 | Soil | LSCALFEPAAMDKKEINSPNLTANFIFWVCGVGGLLLLALLGAFV |
Ga0215015_103442842 | 3300021046 | Soil | MDKKEINSPKLTANFLFWVGGVGGVLLVAFWGHYVWKIF |
Ga0210400_108191271 | 3300021170 | Soil | MDKKEINSPKLTANFLFWVAGVGGALLVALLGHYVWKIF |
Ga0210388_102470283 | 3300021181 | Soil | LAKAEGRKLKTMDKKEINSPRLTANFLFWICGVGGLLVFALLGHYVWKVF |
Ga0210393_100877084 | 3300021401 | Soil | MDKKEINSPKLTANFLFWICGVGGLLLAIFLAHYVWRVF |
Ga0210393_103062461 | 3300021401 | Soil | MDKKEINSPTLTLNFVFWICGVGGLVLLLLLAHFVWKVL |
Ga0210387_101825043 | 3300021405 | Soil | MNKKEINSPKLTANFLFWVGGVGGALLIAFLGHFIWKVF |
Ga0210383_100100973 | 3300021407 | Soil | MNKKEISSPKVTVNFLIWVCGVGGLLLLIVLAHFVWKIM |
Ga0210383_100909111 | 3300021407 | Soil | MHPSSAMDKKEINSPKLTANFLFWICGVGGLLLAIFLAHYVWR |
Ga0193750_10014507 | 3300021413 | Soil | MDKKEINSPKLTANFLFWICGVGALLLVAFLAHFVWKIL |
Ga0210394_105376633 | 3300021420 | Soil | MDKKEINSPRLTLNFVFWICGVGGLVLLLLLAHFVWKVL |
Ga0210394_107877361 | 3300021420 | Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYVWKIF |
Ga0210391_100663463 | 3300021433 | Soil | MEKKEINSPTLTLNFVFWICGVGGLVLLILLAHFIWKVL |
Ga0210391_103106502 | 3300021433 | Soil | MDKKEINSPKLTANFIVWVCGVGGLLLLVFLAHFVWKIL |
Ga0210391_107265511 | 3300021433 | Soil | MDKKEIDSPKLTANFIIWICGVGGLLLLNFLGSFRLE |
Ga0210392_112790692 | 3300021475 | Soil | KRHLMRCVIRPMNKKEINSPKLTANFLFWVGGVGGALLIAFLGHFIWKVF |
Ga0210398_106460292 | 3300021477 | Soil | MDKKEINSPTLALNFVFWICGVGGLVLLLLLAHFVWKVL |
Ga0210398_110229952 | 3300021477 | Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYTWKIF |
Ga0210402_100008454 | 3300021478 | Soil | MDKKDINSPALTANFLFWVCGVGGLLLIALLGRYVWKVF |
Ga0210402_100888794 | 3300021478 | Soil | MDKKEINSPALTANFLFWVCGVGGLLLIALLGRYVWKVF |
Ga0210402_104161365 | 3300021478 | Soil | MDKKEINSPKLTANFLFWICGVGGLVLFVLLGHYVWRVF |
Ga0210410_112273851 | 3300021479 | Soil | MDKKEINSPKLTANFLFWIAGVGGALLVALLGHYVWK |
Ga0210409_100733916 | 3300021559 | Soil | MDKKEINSPNLTANFLFWVCGVGGLLLFALLGPFVWKAF |
Ga0212123_1000497420 | 3300022557 | Iron-Sulfur Acid Spring | MDKKEINSPKLTANFLFWVAGVGGVLLVAFLAHYIWKIF |
Ga0212123_100986203 | 3300022557 | Iron-Sulfur Acid Spring | MDKKEINSPKLTANFLFWIAGVGGAVLVALLGHYVWKIF |
Ga0212123_108756531 | 3300022557 | Iron-Sulfur Acid Spring | MDKKQINSPKLTANFLFWVCGAGGMAILLAHYLWKVF |
Ga0224558_100051412 | 3300023090 | Soil | MDKKEINSPKLTANFLFWICGIGGLLLFAMLAHFIWRAF |
Ga0207646_108534442 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKEINSPKLTANFLFWVCGVGGVLLIALLGHYVWRVF |
Ga0209849_10367851 | 3300026215 | Soil | MDKKEINSPRLTANFLFWVAGIGGVLLVALLHYVWKVF |
Ga0209839_101871392 | 3300026294 | Soil | MDKKEINSPKLTAHFLIWVCGVGGLLLAYLFAHVIFHVL |
Ga0209131_10869022 | 3300026320 | Grasslands Soil | MEKREINSPRLTANFLFWVCGVGGLLVIALLGHYVWRAF |
Ga0209801_10286951 | 3300026326 | Soil | MDKKEINSPKLTANFLFWICGAGALLLVAFLAHFVRKIL |
Ga0208366_10011571 | 3300027073 | Forest Soil | LFEAAAMDKKEINSPNLTANFLFWVCGVGGLLLFALWGPFVWKAF |
Ga0209732_10158073 | 3300027117 | Forest Soil | MNKKEINSPNLTANFLFWIAGVGGVLLVAVLHYVWKVF |
Ga0209010_100021918 | 3300027370 | Forest Soil | MDKKEINSPKLTANFLIWVGGVGGLLLLLLLAHFVWKIR |
Ga0209421_10592792 | 3300027432 | Forest Soil | MDKKEINSPKLTANFLFWICGVGGVLLIGLLGHYVWRIF |
Ga0209734_10861792 | 3300027535 | Forest Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVALLGHYVWKVF |
Ga0209008_10204584 | 3300027545 | Forest Soil | MDKKEINSPKLTANFIFWICGVGVLLLFALLAHYVWRVF |
Ga0209219_10486421 | 3300027565 | Forest Soil | MMDKKEINSPKLTANLLFWVCGVGSVVVVALLGHYVWKIF |
Ga0209525_10013082 | 3300027575 | Forest Soil | MDKKEINSPKLTINFLIWICGVGGLLLAYLLAHFVLHVV |
Ga0209118_100001932 | 3300027674 | Forest Soil | MDKKEINSPKLTVNFLIWICGVGGLLLFTCLAHFVWKIL |
Ga0209040_101188803 | 3300027824 | Bog Forest Soil | MDKKEINSPKLTANFLFWIAGVGGVLLVALLHYVWKVF |
Ga0209274_102915702 | 3300027853 | Soil | MDKKEINSPKLTANFLIWVGGVGGLLLLLFLAHFVWKIR |
Ga0209517_1000509515 | 3300027854 | Peatlands Soil | MDKKEINSPRLTLDFLFWICGVGGFVLLILLAHFVWKVL |
Ga0209166_106184012 | 3300027857 | Surface Soil | MDKKEINSPTLTLNFVFWICGVGGLVLLILSAHFVWKVL |
Ga0209167_100038315 | 3300027867 | Surface Soil | MDKKEINSPKATANFIVWVCGVGGLLLLIFLANFVWKIL |
Ga0209169_106380832 | 3300027879 | Soil | TMDKKEINSPKLTINFLIWICGVGGLLMFALLGHYVWRIF |
Ga0209068_100919683 | 3300027894 | Watersheds | MDKKEINSPNLTANFLFWVCGVGGLLLFALLGHYVWKAF |
Ga0209488_100047057 | 3300027903 | Vadose Zone Soil | MEKKEINSSRLSADFLFWICGVGGLLIIALLGHYVWRVF |
Ga0209006_100012899 | 3300027908 | Forest Soil | MDKKEINSPNLTANFLIWVGGVGGLLLLLFLAHFMWKIR |
Ga0209006_111334562 | 3300027908 | Forest Soil | MDKKEINSPKLTANFLFWVAGVGGVLLVALLAHYVWKIF |
Ga0209583_104534792 | 3300027910 | Watersheds | MDKKEINSPNLTANFLFQVCGVGGLLLFALLGHYVWKAF |
Ga0209698_100153264 | 3300027911 | Watersheds | MDKKEIYSPNLTANFLFWVCGVGGLLLFALFGHYVWRLFEQS |
Ga0209069_102715811 | 3300027915 | Watersheds | DKKEVNSSNLTANFLFWVCGVGGLLLFALVGHYVWKAF |
Ga0209526_100062306 | 3300028047 | Forest Soil | MDKKEINSPKLTANFLFWVCGVGGVVLVALLGHFVWKIF |
Ga0209526_107284002 | 3300028047 | Forest Soil | SAMDKKEINSPKLTANFLFWVCGVGGVLLVGFLGHYVWKVF |
Ga0302159_100016679 | 3300028646 | Fen | MNKKEINSPKLTANFLFWVCGVGGVLVIGLLGHYIWRVF |
Ga0302165_100843042 | 3300028678 | Fen | MDKKEINSPKLTANFLFWVCGVGGVLLFGVLGHYIWKVF |
Ga0308309_118648982 | 3300028906 | Soil | MDKKEINSPKLTINFLIWICGVGGLLMFALLGHYVWRIF |
Ga0311340_101641893 | 3300029943 | Palsa | MDKKEINSPKLTANFLIWVGGVGGLLLLLFLAHFVWKIL |
Ga0311334_116946252 | 3300029987 | Fen | MDKKEINSPKLTANFLFWVCGVGGVLMMALLGRYVWKVF |
Ga0311338_100184119 | 3300030007 | Palsa | MDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVWRVV |
Ga0302217_100855022 | 3300030052 | Fen | MNKKEINSPKLTANFLFWVCGVGGVLVIGLLGHYIW |
Ga0311354_113215962 | 3300030618 | Palsa | MDKKEINSPKLTANFLIWVGGVGGLLLLLFLAHFVW |
Ga0073994_100093442 | 3300030991 | Soil | MDKKEINSPKLTANFLFWVCGVGGVLLVGFLGHYVWKVF |
Ga0302325_130763042 | 3300031234 | Palsa | GTTEYSSFMDKKEINSPKLTANFLIWICGVGGLLLAYLLAHFVWRVI |
Ga0265325_100048759 | 3300031241 | Rhizosphere | MDKKEINSPKLTANFLFWIAGVGGVLLVALLHYVWRVF |
Ga0265316_108138442 | 3300031344 | Rhizosphere | MDKKEINSPKLTAQFLFWVGGGVLLIAFLIARYVFHVL |
Ga0310686_1041898022 | 3300031708 | Soil | MDKKEINSPKLTANFLIWVGGVGGLLLLLFLVHFVWKIR |
Ga0310686_1130507801 | 3300031708 | Soil | MDKKEINSPKLTANFLIWICGVGGLLLFALLGHYVWRIF |
Ga0307476_100642943 | 3300031715 | Hardwood Forest Soil | MDKKKINSPKLAANFLFWVAGVGGAVLVAFLAHYVWKIF |
Ga0307469_108165502 | 3300031720 | Hardwood Forest Soil | MDKKEINSPKLTASFLFWVCGVGGLLLVALLGHYVWKIF |
Ga0307469_115581942 | 3300031720 | Hardwood Forest Soil | MDKKELNSPKLTANFLFWICGVGALLLVAFLAHFVWKIL |
Ga0307468_1002086631 | 3300031740 | Hardwood Forest Soil | LSCALFEPAAMDKKEINSPNLTANFLFWVCGVGGLLLLALLGAFAWKTF |
Ga0311301_100749399 | 3300032160 | Peatlands Soil | MDKKEINSPKLTANFLIWVCGVGGLLLLIFLAHFVWKIL |
Ga0311301_103394112 | 3300032160 | Peatlands Soil | MDKKEINSPKLTENFLFWICGVGGLLLLVMLAHFVWHLY |
Ga0307471_1003783913 | 3300032180 | Hardwood Forest Soil | MDKKEINSPKLTANFLFWVCGVGGVALVVILGHYVWEIF |
Ga0307472_1011693561 | 3300032205 | Hardwood Forest Soil | PAGRRRYMDKKEINSPKLTANFLFWICGVGALLLVAFLAHFVWKIL |
Ga0335079_121173701 | 3300032783 | Soil | MDKKEINSPGLTANFLFWICGVGVTLLVLFLGHYIWKIF |
Ga0335078_106872863 | 3300032805 | Soil | MDKKEINSPQLTANFIVWICGVGGLLLFVLLSHFVWRVW |
Ga0335078_111960072 | 3300032805 | Soil | MVKKEINSRQLTANFVIWICGVGGLLLFVLLGHFVWRVW |
Ga0335070_108303752 | 3300032829 | Soil | GPDHGEKEIKSPKLTANFVFWILGVGGLTLAFLLAHFVWNIV |
Ga0335075_112634293 | 3300032896 | Soil | KKEINSPKLTANFLIWVGGVGGLLLIIFLAHFVWKIF |
Ga0326726_103600141 | 3300033433 | Peat Soil | MDKKEINSSKLTANFLFWVCGVGGVLLIILLGHYVWKGF |
Ga0334792_157584_2_109 | 3300033888 | Soil | EINSPKLTANFLFWVAGVGGVLLVTLLARFVWKIF |
Ga0370515_0002097_4030_4149 | 3300034163 | Untreated Peat Soil | MMDKKEINSPKLTANFLFWVAGVGAVLLVALLHYVWRVF |
Ga0370514_163915_2_109 | 3300034199 | Untreated Peat Soil | MMDKKEINSPKLTANFLFWVAGVGAVLLVALLHYVW |
Ga0370492_0202596_43_162 | 3300034282 | Untreated Peat Soil | MDKKEINSPKLTINFLIWVCGVGGLLLAYLLAHFVFHLV |
⦗Top⦘ |