Basic Information | |
---|---|
Family ID | F022450 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 214 |
Average Sequence Length | 45 residues |
Representative Sequence | IEGFWRVMKDTIGAGRCFPNLHQLYQRTRQVLMAHQERPIYAFHW |
Number of Associated Samples | 153 |
Number of Associated Scaffolds | 214 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 21.96 % |
% of genes near scaffold ends (potentially truncated) | 74.30 % |
% of genes from short scaffolds (< 2000 bps) | 86.92 % |
Associated GOLD sequencing projects | 142 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.991 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.224 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.972 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.262 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 214 Family Scaffolds |
---|---|---|
PF13358 | DDE_3 | 2.80 |
PF07508 | Recombinase | 2.80 |
PF13408 | Zn_ribbon_recom | 2.34 |
PF01609 | DDE_Tnp_1 | 2.34 |
PF00239 | Resolvase | 2.34 |
PF13546 | DDE_5 | 1.40 |
PF14224 | DUF4331 | 1.40 |
PF13267 | DUF4058 | 0.93 |
PF13561 | adh_short_C2 | 0.93 |
PF13610 | DDE_Tnp_IS240 | 0.93 |
PF00903 | Glyoxalase | 0.93 |
PF03050 | DDE_Tnp_IS66 | 0.93 |
PF06707 | DUF1194 | 0.93 |
PF01656 | CbiA | 0.93 |
PF02371 | Transposase_20 | 0.93 |
PF00211 | Guanylate_cyc | 0.93 |
PF00589 | Phage_integrase | 0.93 |
PF07592 | DDE_Tnp_ISAZ013 | 0.93 |
PF04909 | Amidohydro_2 | 0.93 |
PF03400 | DDE_Tnp_IS1 | 0.93 |
PF05981 | CreA | 0.47 |
PF00501 | AMP-binding | 0.47 |
PF01555 | N6_N4_Mtase | 0.47 |
PF00496 | SBP_bac_5 | 0.47 |
PF00078 | RVT_1 | 0.47 |
PF07991 | IlvN | 0.47 |
PF13801 | Metal_resist | 0.47 |
PF05598 | DUF772 | 0.47 |
PF05977 | MFS_3 | 0.47 |
PF14104 | DUF4277 | 0.47 |
PF06983 | 3-dmu-9_3-mt | 0.47 |
PF13586 | DDE_Tnp_1_2 | 0.47 |
PF00486 | Trans_reg_C | 0.47 |
PF14319 | Zn_Tnp_IS91 | 0.47 |
PF07045 | DUF1330 | 0.47 |
PF00561 | Abhydrolase_1 | 0.47 |
PF01717 | Meth_synt_2 | 0.47 |
PF00872 | Transposase_mut | 0.47 |
PF00067 | p450 | 0.47 |
PF02683 | DsbD | 0.47 |
PF13551 | HTH_29 | 0.47 |
PF13614 | AAA_31 | 0.47 |
PF00076 | RRM_1 | 0.47 |
PF13673 | Acetyltransf_10 | 0.47 |
PF00296 | Bac_luciferase | 0.47 |
PF01526 | DDE_Tnp_Tn3 | 0.47 |
PF13424 | TPR_12 | 0.47 |
PF01610 | DDE_Tnp_ISL3 | 0.47 |
PF10282 | Lactonase | 0.47 |
PF02518 | HATPase_c | 0.47 |
PF09339 | HTH_IclR | 0.47 |
PF10551 | MULE | 0.47 |
PF01548 | DEDD_Tnp_IS110 | 0.47 |
PF12697 | Abhydrolase_6 | 0.47 |
PF07690 | MFS_1 | 0.47 |
PF05973 | Gp49 | 0.47 |
PF01663 | Phosphodiest | 0.47 |
PF04545 | Sigma70_r4 | 0.47 |
PF10604 | Polyketide_cyc2 | 0.47 |
PF01051 | Rep_3 | 0.47 |
PF12973 | Cupin_7 | 0.47 |
PF03358 | FMN_red | 0.47 |
PF13473 | Cupredoxin_1 | 0.47 |
COG ID | Name | Functional Category | % Frequency in 214 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 5.14 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 2.34 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.34 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.34 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.34 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.34 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.34 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.34 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.40 |
COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 0.93 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.93 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.47 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.47 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.47 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.47 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.47 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.47 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.47 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.47 |
COG3045 | Periplasmic catabolite regulation protein CreA (function unknown) | Signal transduction mechanisms [T] | 0.47 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.47 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.47 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.47 |
COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.47 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.47 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.47 |
COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.99 % |
Unclassified | root | N/A | 7.01 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000443|F12B_10006790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 565 | Open in IMG/M |
3300000559|F14TC_101316604 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
3300000955|JGI1027J12803_107955262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 513 | Open in IMG/M |
3300000956|JGI10216J12902_101355850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1434 | Open in IMG/M |
3300003319|soilL2_10196570 | Not Available | 1135 | Open in IMG/M |
3300003996|Ga0055467_10112397 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300004463|Ga0063356_102858667 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300004479|Ga0062595_101596661 | Not Available | 608 | Open in IMG/M |
3300004633|Ga0066395_10025127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2419 | Open in IMG/M |
3300004633|Ga0066395_10085056 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300004633|Ga0066395_10346385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 824 | Open in IMG/M |
3300004633|Ga0066395_10723044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 592 | Open in IMG/M |
3300004798|Ga0058859_10881015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 558 | Open in IMG/M |
3300004801|Ga0058860_10108789 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300005172|Ga0066683_10247527 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300005178|Ga0066688_10942892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300005180|Ga0066685_11110288 | Not Available | 517 | Open in IMG/M |
3300005289|Ga0065704_10389350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 764 | Open in IMG/M |
3300005294|Ga0065705_10059168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 794 | Open in IMG/M |
3300005294|Ga0065705_10165768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1677 | Open in IMG/M |
3300005294|Ga0065705_10262130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1158 | Open in IMG/M |
3300005295|Ga0065707_11008265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 537 | Open in IMG/M |
3300005332|Ga0066388_100805605 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300005332|Ga0066388_102500702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
3300005332|Ga0066388_103202215 | Not Available | 836 | Open in IMG/M |
3300005332|Ga0066388_103780919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 772 | Open in IMG/M |
3300005332|Ga0066388_104493235 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300005332|Ga0066388_106385856 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005332|Ga0066388_106674284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 581 | Open in IMG/M |
3300005347|Ga0070668_101056734 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300005467|Ga0070706_100008793 | All Organisms → cellular organisms → Bacteria | 9411 | Open in IMG/M |
3300005467|Ga0070706_102149448 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 504 | Open in IMG/M |
3300005471|Ga0070698_100755517 | Not Available | 915 | Open in IMG/M |
3300005518|Ga0070699_101407440 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005557|Ga0066704_10284733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. BC1307 | 1119 | Open in IMG/M |
3300005561|Ga0066699_10911641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 613 | Open in IMG/M |
3300005569|Ga0066705_10603561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
3300005577|Ga0068857_100017973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 6202 | Open in IMG/M |
3300005617|Ga0068859_100081349 | All Organisms → cellular organisms → Bacteria | 3281 | Open in IMG/M |
3300005713|Ga0066905_100276610 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
3300005764|Ga0066903_100063090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4653 | Open in IMG/M |
3300005764|Ga0066903_102416627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1016 | Open in IMG/M |
3300005764|Ga0066903_105301045 | Not Available | 681 | Open in IMG/M |
3300005764|Ga0066903_107995685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 542 | Open in IMG/M |
3300005764|Ga0066903_108631869 | Not Available | 519 | Open in IMG/M |
3300006046|Ga0066652_100234643 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1598 | Open in IMG/M |
3300006196|Ga0075422_10229033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
3300006794|Ga0066658_10604921 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300006796|Ga0066665_11473765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 530 | Open in IMG/M |
3300006797|Ga0066659_11308573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
3300006844|Ga0075428_100310190 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
3300006844|Ga0075428_100678107 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1098 | Open in IMG/M |
3300006844|Ga0075428_101440130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 722 | Open in IMG/M |
3300006845|Ga0075421_100390670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1673 | Open in IMG/M |
3300006846|Ga0075430_100134499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2060 | Open in IMG/M |
3300006846|Ga0075430_100751799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 803 | Open in IMG/M |
3300006847|Ga0075431_100039770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4845 | Open in IMG/M |
3300006847|Ga0075431_101598675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 610 | Open in IMG/M |
3300006852|Ga0075433_11032580 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300006852|Ga0075433_11370706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 612 | Open in IMG/M |
3300006871|Ga0075434_101004427 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300006880|Ga0075429_100329316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1336 | Open in IMG/M |
3300006894|Ga0079215_11718235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 502 | Open in IMG/M |
3300006969|Ga0075419_11087400 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 585 | Open in IMG/M |
3300007004|Ga0079218_10873654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 878 | Open in IMG/M |
3300007076|Ga0075435_100991033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 734 | Open in IMG/M |
3300007255|Ga0099791_10062260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1681 | Open in IMG/M |
3300007265|Ga0099794_10384074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
3300009012|Ga0066710_100262720 | All Organisms → cellular organisms → Bacteria | 2505 | Open in IMG/M |
3300009012|Ga0066710_102578145 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300009038|Ga0099829_10285187 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300009090|Ga0099827_10313435 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300009090|Ga0099827_11215924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 655 | Open in IMG/M |
3300009094|Ga0111539_10319862 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
3300009094|Ga0111539_10690255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1188 | Open in IMG/M |
3300009100|Ga0075418_11474862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 738 | Open in IMG/M |
3300009137|Ga0066709_100201164 | All Organisms → cellular organisms → Bacteria | 2617 | Open in IMG/M |
3300009137|Ga0066709_100231227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2458 | Open in IMG/M |
3300009137|Ga0066709_102362165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 725 | Open in IMG/M |
3300009147|Ga0114129_10061957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5227 | Open in IMG/M |
3300009147|Ga0114129_11557248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 810 | Open in IMG/M |
3300009147|Ga0114129_12838362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 575 | Open in IMG/M |
3300009147|Ga0114129_13419858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 510 | Open in IMG/M |
3300009156|Ga0111538_10611020 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300009162|Ga0075423_11777807 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300009553|Ga0105249_10092179 | All Organisms → cellular organisms → Bacteria | 2836 | Open in IMG/M |
3300009553|Ga0105249_10912127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 946 | Open in IMG/M |
3300009553|Ga0105249_11145969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 848 | Open in IMG/M |
3300009553|Ga0105249_11736996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 55-13 | 696 | Open in IMG/M |
3300009792|Ga0126374_10273327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1117 | Open in IMG/M |
3300009792|Ga0126374_10984769 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300009804|Ga0105063_1086691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 509 | Open in IMG/M |
3300009817|Ga0105062_1001865 | Not Available | 2656 | Open in IMG/M |
3300009821|Ga0105064_1089686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 622 | Open in IMG/M |
3300010043|Ga0126380_10513854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 923 | Open in IMG/M |
3300010043|Ga0126380_10745010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea rhizosphaerae | 794 | Open in IMG/M |
3300010043|Ga0126380_11168904 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 661 | Open in IMG/M |
3300010046|Ga0126384_10888443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 804 | Open in IMG/M |
3300010046|Ga0126384_12068719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 546 | Open in IMG/M |
3300010047|Ga0126382_10134926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1664 | Open in IMG/M |
3300010047|Ga0126382_10702165 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 849 | Open in IMG/M |
3300010047|Ga0126382_11118540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 700 | Open in IMG/M |
3300010047|Ga0126382_11427328 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300010323|Ga0134086_10408898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
3300010358|Ga0126370_10355886 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300010358|Ga0126370_11034921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 752 | Open in IMG/M |
3300010359|Ga0126376_11367893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 731 | Open in IMG/M |
3300010360|Ga0126372_10129478 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300010361|Ga0126378_10619158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1196 | Open in IMG/M |
3300010362|Ga0126377_11237675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
3300010362|Ga0126377_11523713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 743 | Open in IMG/M |
3300010362|Ga0126377_11820335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 684 | Open in IMG/M |
3300010366|Ga0126379_10822265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1029 | Open in IMG/M |
3300010366|Ga0126379_11337930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 822 | Open in IMG/M |
3300010366|Ga0126379_11996764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 683 | Open in IMG/M |
3300010376|Ga0126381_102581764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 727 | Open in IMG/M |
3300011432|Ga0137428_1224588 | Not Available | 556 | Open in IMG/M |
3300011440|Ga0137433_1291914 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 530 | Open in IMG/M |
3300012189|Ga0137388_10862897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3 → candidate division KSB3 bacterium | 838 | Open in IMG/M |
3300012189|Ga0137388_11678779 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012198|Ga0137364_10089777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2143 | Open in IMG/M |
3300012199|Ga0137383_10365457 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300012199|Ga0137383_10456391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 936 | Open in IMG/M |
3300012201|Ga0137365_10145630 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300012202|Ga0137363_11761790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 512 | Open in IMG/M |
3300012205|Ga0137362_10425827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1149 | Open in IMG/M |
3300012206|Ga0137380_10218289 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
3300012207|Ga0137381_11607127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 541 | Open in IMG/M |
3300012209|Ga0137379_10297638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1524 | Open in IMG/M |
3300012209|Ga0137379_10347908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Fraserbacteria → Candidatus Fraserbacteria bacterium RBG_16_55_9 | 1392 | Open in IMG/M |
3300012209|Ga0137379_10570098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1039 | Open in IMG/M |
3300012210|Ga0137378_10049902 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae | 3765 | Open in IMG/M |
3300012210|Ga0137378_10971296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 763 | Open in IMG/M |
3300012210|Ga0137378_11368058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 622 | Open in IMG/M |
3300012211|Ga0137377_10231352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1775 | Open in IMG/M |
3300012211|Ga0137377_11289402 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 660 | Open in IMG/M |
3300012212|Ga0150985_101509247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 536 | Open in IMG/M |
3300012285|Ga0137370_10763261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 600 | Open in IMG/M |
3300012349|Ga0137387_10171826 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300012349|Ga0137387_10656630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 759 | Open in IMG/M |
3300012351|Ga0137386_10837253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 661 | Open in IMG/M |
3300012351|Ga0137386_11048544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
3300012353|Ga0137367_10154452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1674 | Open in IMG/M |
3300012355|Ga0137369_10297459 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300012357|Ga0137384_11459501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 533 | Open in IMG/M |
3300012358|Ga0137368_10753292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 607 | Open in IMG/M |
3300012362|Ga0137361_11171413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 691 | Open in IMG/M |
3300012469|Ga0150984_108662773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 721 | Open in IMG/M |
3300012582|Ga0137358_10894576 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 583 | Open in IMG/M |
3300012907|Ga0157283_10214481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 616 | Open in IMG/M |
3300012918|Ga0137396_10251611 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1303 | Open in IMG/M |
3300012930|Ga0137407_11310539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 688 | Open in IMG/M |
3300012951|Ga0164300_11152013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 510 | Open in IMG/M |
3300012971|Ga0126369_10118228 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 2436 | Open in IMG/M |
3300012971|Ga0126369_10591399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1179 | Open in IMG/M |
3300012971|Ga0126369_13212248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 535 | Open in IMG/M |
3300013306|Ga0163162_10196128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2148 | Open in IMG/M |
3300013306|Ga0163162_10221295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2023 | Open in IMG/M |
3300013306|Ga0163162_12404232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 606 | Open in IMG/M |
3300013307|Ga0157372_12222296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 630 | Open in IMG/M |
3300015245|Ga0137409_10092111 | All Organisms → cellular organisms → Bacteria | 2819 | Open in IMG/M |
3300015358|Ga0134089_10290898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 676 | Open in IMG/M |
3300015371|Ga0132258_10236363 | All Organisms → cellular organisms → Bacteria | 4457 | Open in IMG/M |
3300016270|Ga0182036_10015785 | All Organisms → cellular organisms → Bacteria | 4171 | Open in IMG/M |
3300016294|Ga0182041_10513828 | Not Available | 1041 | Open in IMG/M |
3300016319|Ga0182033_11696943 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300016341|Ga0182035_10299309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1319 | Open in IMG/M |
3300016341|Ga0182035_10578331 | Not Available | 968 | Open in IMG/M |
3300017792|Ga0163161_10246952 | Not Available | 1390 | Open in IMG/M |
3300018071|Ga0184618_10486020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 518 | Open in IMG/M |
3300018433|Ga0066667_10452629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1049 | Open in IMG/M |
3300018433|Ga0066667_11870520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 546 | Open in IMG/M |
3300018466|Ga0190268_11613169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 572 | Open in IMG/M |
3300019377|Ga0190264_11265606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 619 | Open in IMG/M |
3300019789|Ga0137408_1488187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1874 | Open in IMG/M |
3300021560|Ga0126371_13899839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 502 | Open in IMG/M |
3300025961|Ga0207712_11774812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 553 | Open in IMG/M |
3300025961|Ga0207712_12086544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 507 | Open in IMG/M |
3300025972|Ga0207668_10077942 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
3300026116|Ga0207674_10021157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7012 | Open in IMG/M |
3300027874|Ga0209465_10025450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2755 | Open in IMG/M |
3300027903|Ga0209488_10243444 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300027907|Ga0207428_10465199 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300027909|Ga0209382_10649797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1141 | Open in IMG/M |
3300028381|Ga0268264_11567726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 669 | Open in IMG/M |
3300028587|Ga0247828_10228959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 986 | Open in IMG/M |
3300030621|Ga0247655_10235462 | Not Available | 566 | Open in IMG/M |
3300030634|Ga0247636_10086866 | Not Available | 841 | Open in IMG/M |
3300030830|Ga0308205_1027975 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 679 | Open in IMG/M |
3300030903|Ga0308206_1154867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 554 | Open in IMG/M |
3300031058|Ga0308189_10380114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 577 | Open in IMG/M |
3300031093|Ga0308197_10018860 | Not Available | 1474 | Open in IMG/M |
3300031228|Ga0299914_10554724 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300031547|Ga0310887_10589560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 680 | Open in IMG/M |
3300031548|Ga0307408_100037862 | All Organisms → cellular organisms → Bacteria | 3399 | Open in IMG/M |
3300031561|Ga0318528_10359466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
3300031719|Ga0306917_11255133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 574 | Open in IMG/M |
3300031740|Ga0307468_100509150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 957 | Open in IMG/M |
3300031744|Ga0306918_10790002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 741 | Open in IMG/M |
3300031892|Ga0310893_10013690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2266 | Open in IMG/M |
3300031908|Ga0310900_10015932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3831 | Open in IMG/M |
3300031912|Ga0306921_10207308 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
3300031943|Ga0310885_10054548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1672 | Open in IMG/M |
3300031944|Ga0310884_10271036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 935 | Open in IMG/M |
3300031947|Ga0310909_10972561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300032012|Ga0310902_11044933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 569 | Open in IMG/M |
3300032012|Ga0310902_11377917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 501 | Open in IMG/M |
3300032063|Ga0318504_10504173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 580 | Open in IMG/M |
3300032090|Ga0318518_10452012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 658 | Open in IMG/M |
3300032122|Ga0310895_10082839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1266 | Open in IMG/M |
3300032179|Ga0310889_10032361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1931 | Open in IMG/M |
3300032261|Ga0306920_100712841 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Seonamhaeicola → Seonamhaeicola marinus | 1478 | Open in IMG/M |
3300033289|Ga0310914_10913938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300034172|Ga0334913_039199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1015 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.22% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.15% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.80% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.40% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.47% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.47% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.47% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.47% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300030621 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F12B_100067901 | 3300000443 | Soil | PIEGFWRVMKDAIGAGRCLADLQQLYQRTRRVLMAHHERPIYAFHW* |
F14TC_1013166041 | 3300000559 | Soil | LQMQPTADVHHLNPMEGFWRVLKDRIGAGRCFPDLHQLYQRTRRVLMAHQERPIYAFHW* |
JGI1027J12803_1079552622 | 3300000955 | Soil | IEGFWRVMKDAIGAGRGFADLHQLYQRTRHVLMAHQERPIYEFHW* |
JGI10216J12902_1013558502 | 3300000956 | Soil | MEGFWRVMKDTIGAGRCFPDLRQLYPRTRQGLMAQQERPIYTLHW* |
soilL2_101965701 | 3300003319 | Sugarcane Root And Bulk Soil | NPIEGFWRVLKDKIGAGRCFPDLQQLYWRARRVLMAHHEQPIYAFRW* |
Ga0055467_101123972 | 3300003996 | Natural And Restored Wetlands | PIEGFWRRMKEVIGAGRCFRDLHQLYQRTRQVLMAHQERPIYEFSW* |
Ga0063356_1028586671 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EGFWRVMKDTIGAGRCFAELHLLYQRTRQVLMAHHERPIYEFHW* |
Ga0062595_1015966611 | 3300004479 | Soil | MGCDYNIEGFWRVMKDAIGAGRGFADLHRLYQRTRQVLMAHHERPIYEFHW* |
Ga0066395_100251271 | 3300004633 | Tropical Forest Soil | MGCDYNIEGFWRVMKDAIGAGRGFADLPQLYQRTRQVLMAHQERPSYEFHW* |
Ga0066395_100850562 | 3300004633 | Tropical Forest Soil | MEGFWRVLKDTIRAGRCFPDLQQLYGRVRRVLMAHQEQPIYAFRW* |
Ga0066395_103463851 | 3300004633 | Tropical Forest Soil | MGCDYNIEGFWRVMKDTIGAGRCFPDLLQLYQRTRRVLMAHQERPIYE |
Ga0066395_107230441 | 3300004633 | Tropical Forest Soil | MLKHGHHLNPIEGFWRVLKDAIGAGRGFADLHQLYQRTRQVLMAHQERP |
Ga0058859_108810151 | 3300004798 | Host-Associated | PIEGFWRVRKDAIGAGRCCPNLAQLYQRTHQVLMAHQERPIYAFHW* |
Ga0058860_101087891 | 3300004801 | Host-Associated | RVRKDAIGAGRCCPNLAQLYQRTHQVLMAHQERPIYAFHW* |
Ga0066683_102475271 | 3300005172 | Soil | IEGFWRVMKDTIGAGRCFADLQQLYQRTRWVLIGHQLTSDSL* |
Ga0066688_109428921 | 3300005178 | Soil | EGFWRVMKDTIGAGRCFANLHRLYQRTRQVLMTHQERPIYAFHW* |
Ga0066685_111102881 | 3300005180 | Soil | WRVMKDTIGAGRCFPNLHQLYQRTRQVLMAHQERPIYEFHW* |
Ga0065704_103893501 | 3300005289 | Switchgrass Rhizosphere | MGCDYNIEGFWRVMKDAIGAGRGLRDLPTLYQRTRHVLMAHQERPIYAFHW* |
Ga0065705_100591682 | 3300005294 | Switchgrass Rhizosphere | LTTPIEGFWRVMKDTIGAGRCFPHLLQLYQHTRRVLMAHQERPIYEFHW* |
Ga0065705_101657682 | 3300005294 | Switchgrass Rhizosphere | FWRVMKDTIGAGRCFGALQELYQRTRRVLTAHQERPIYAFHW* |
Ga0065705_102621301 | 3300005294 | Switchgrass Rhizosphere | MGCDYNIEGFWRVMKDMIGAGRCFTNLPLLYQRTRQVLMAHYERPIYEFHW* |
Ga0065707_110082651 | 3300005295 | Switchgrass Rhizosphere | LGRVANKLTTPIEGFWRVMKDTIGAGRCFPHLLQLYQHTRRVLMAHQERPIYEFHW* |
Ga0066388_1008056054 | 3300005332 | Tropical Forest Soil | GFWRVMKDTIGAGRCFPDLLQLYQRTHHVLRAHQERPIYAFHW* |
Ga0066388_1025007023 | 3300005332 | Tropical Forest Soil | FWRVMKDTIGAGRCFPDLRQLYQRTRQVLMAHQERPIYAFHW* |
Ga0066388_1032022151 | 3300005332 | Tropical Forest Soil | IEGFWRVMKDTIGAGRCFPDLLQLYQRTHHVLRAHQERPIYEFHW* |
Ga0066388_1037809192 | 3300005332 | Tropical Forest Soil | MGCDYNIESFWRVMQDRSGAGRCFPDLPQLYQRTRHVLMAHQERPIYAFHW* |
Ga0066388_1044932352 | 3300005332 | Tropical Forest Soil | EGFWRVMKDAIGAGRCLPTLHALYQRTRQVLMAHQERPIYEFHW* |
Ga0066388_1063858561 | 3300005332 | Tropical Forest Soil | MGCDYNIEGFWRVMKDCIGAGRGFADVHLLYYRTRQVLMAHHERPI* |
Ga0066388_1066742841 | 3300005332 | Tropical Forest Soil | GFWRVMKDTIGAGRCFPDLLQLYQRTHHVLRAHQERPIYEFHW* |
Ga0070668_1010567341 | 3300005347 | Switchgrass Rhizosphere | NPSEGCGRVLKDAVGAGRCFSPLPQLSWRTRQGLMGHQERPIYEFHW* |
Ga0070706_10000879312 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EGFWRVMKDAIGAGRCFANLHLFYQRTRQVLLAHQERPIYAFHW* |
Ga0070706_1021494482 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TMKDAIGAGRYVRDLHQLYQRTRQVLTAHQERPIYAFSW* |
Ga0070698_1007555172 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FWRVMKDCIGAGRCFANLPLFYQRTRQVLMAHQERPLYAFHW* |
Ga0070699_1014074401 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EGFWRTMKDAIGAGRWLNDLHQLYKRTRQVLMAHQERPIYAFSW* |
Ga0066704_102847332 | 3300005557 | Soil | MKDAIGAGRCFPDLQQLYHRTRQVLMAHQERPMYAFHW* |
Ga0066699_109116413 | 3300005561 | Soil | WRVMKDAIGAGRCFPDLHQLYHRTRQVLMAHQERPIYAFHW* |
Ga0066705_106035612 | 3300005569 | Soil | LNPIEGFWRVMKDAIGAGRCFPDLHQLYQRTRHVLMAHQERPIYAFHW* |
Ga0068857_1000179737 | 3300005577 | Corn Rhizosphere | MGCDYNIEGFWRVMKDTIGAGRCFPALHLLYRRTRQVLMAHQERPIYAFHW* |
Ga0068859_1000813495 | 3300005617 | Switchgrass Rhizosphere | HCGHHLHPIEGFWRVRKDAIGAGRCCPNLAQLYQRTHQVLMAHQERPIYAFHW* |
Ga0066905_1002766102 | 3300005713 | Tropical Forest Soil | MKDTIGAGRCFPDLLQLSQRTRRVLMAHHERPIYEFHW* |
Ga0066903_1000630907 | 3300005764 | Tropical Forest Soil | GCDYNIEGFWRVMKDRIGAGRCFPDLHQLSQRTRRVLMDHQARPIYAFHW* |
Ga0066903_1024166271 | 3300005764 | Tropical Forest Soil | WRVMKDAIGAGRCFIDLPLLYQRTRQGLIAHQERPIYEFHW* |
Ga0066903_1053010452 | 3300005764 | Tropical Forest Soil | GFWRVLKDRIGAGRCFPDLHQLYQRTRRVLMAHQERPIYAFHW* |
Ga0066903_1079956851 | 3300005764 | Tropical Forest Soil | EGFWRVMKDAIGAGRCFANLHLLYQRTRQVLRAHQERPIYAFHW* |
Ga0066903_1086318691 | 3300005764 | Tropical Forest Soil | IEGFWRVMKDAIGAGRCVSDLQLLYKRTRHVLMAHQERPIYAFSW* |
Ga0066652_1002346431 | 3300006046 | Soil | IGAGRCFGNLQQLYQRTRRVLMVHQERPIYEFHW* |
Ga0075422_102290332 | 3300006196 | Populus Rhizosphere | MGCDYNIEGFWRVMKDRIGAGRCFPDLHQLYERMRQVLMAHQERPIYQFHW* |
Ga0066658_106049211 | 3300006794 | Soil | IEGFWRVMKDTIGAGRCFPDLPQLYQRTRRVLMAHQERPIYEFHW* |
Ga0066665_114737652 | 3300006796 | Soil | EGFWRVMTDTIGAGRCFRDLQQLYRRTRHVLMAHQERPMYAFHW* |
Ga0066659_113085731 | 3300006797 | Soil | HCGHHLNPIEGFWRVMKDTIGAGRWFANLHLLYQRTRQVLMAHHERPIYEFHW* |
Ga0075428_1003101903 | 3300006844 | Populus Rhizosphere | MQDTIGAGRYFADFPLLYQRTRPVLMAHHERPLYALHW* |
Ga0075428_1006781071 | 3300006844 | Populus Rhizosphere | KDTIGAGRCFPNLPQLYQRTRQVLMAHQERPIYAFHW* |
Ga0075428_1014401301 | 3300006844 | Populus Rhizosphere | EVIGAGRCFDDLHQLYRRTRQVLMAHQERPIYEFSW* |
Ga0075421_1003906702 | 3300006845 | Populus Rhizosphere | NPIEGFWRVMKDKIGAGRCFPDLHLLYQRTREVLMAQQARPIYEFHW* |
Ga0075430_1001344991 | 3300006846 | Populus Rhizosphere | MGCDYNIEGFWRVMKDAIGAGRCLPNLPQLYQRTRQVLMAHQERPIYAFHW* |
Ga0075430_1007517993 | 3300006846 | Populus Rhizosphere | WRVMKDTIGAGRCFANLSLLYQRTRQVLMAHQERPIYAFHW* |
Ga0075431_1000397704 | 3300006847 | Populus Rhizosphere | MGCDYNIEGFWRVMKDAIGAGRGFAALHQFYQRTRHVLMAHQERPIYECHW* |
Ga0075431_1015986751 | 3300006847 | Populus Rhizosphere | MKDAIGAGRCFPDLPQLYKRMRQVLMAHQERPNYEFHW* |
Ga0075433_110325802 | 3300006852 | Populus Rhizosphere | MQDTIGAGRHFADLPLLYQRTRQVLMAHHERPLSEFHW* |
Ga0075433_113707062 | 3300006852 | Populus Rhizosphere | EGFWRTMKDAIGAGRYVRDLHQLYKRTRQVLTAHQERPIYAFSW* |
Ga0075434_1010044271 | 3300006871 | Populus Rhizosphere | MQDTIGAGRHFADLPLLYQRTRQVLMAHHERPLYALHW* |
Ga0075429_1003293163 | 3300006880 | Populus Rhizosphere | HLNPIEGFWRVMKAAIGAGRWFPELSQLYTRTRQVLMAHQERPIYEFHW* |
Ga0079215_117182351 | 3300006894 | Agricultural Soil | PIEGFWRVMKDCIGAGRCFANLPLLYQRTRQVLMAHHERPIYAFHW* |
Ga0075419_110874001 | 3300006969 | Populus Rhizosphere | EGFWRVMKDAVGAGRCFSALQQLYWRTRQVLMGHQERPIYEFHW* |
Ga0079218_108736543 | 3300007004 | Agricultural Soil | MEGFWRRMKEVIGAGRCFEDLHQLYRRTRQVLMVHQERPIYEFSW* |
Ga0075435_1009910332 | 3300007076 | Populus Rhizosphere | LNPIEGFWRVMKDTIGAGRCFGDLHQLYQRTRRVLMAHQERPIYAFRW* |
Ga0099791_100622601 | 3300007255 | Vadose Zone Soil | MKDTIGAGRCFGDLPQLYKRTRQVLMAHQERPIYEFHW* |
Ga0099794_103840741 | 3300007265 | Vadose Zone Soil | VMKDVIGAGRCFPDLHQLYHRTRQVLMAHQERPIYAFHW* |
Ga0066710_1002627202 | 3300009012 | Grasslands Soil | MQDAIGAGRCFPDLHQLYHRTRQVLMAHQERPIYAFHW |
Ga0066710_1025781451 | 3300009012 | Grasslands Soil | GFWRVMKDAIGAGRCFPDLHQLYHRTRQVFMAHQERPMYAFHW |
Ga0099829_102851871 | 3300009038 | Vadose Zone Soil | GFWRVMKDAIGAGRCFAHLHLLYQRTRQVLMAHQERPIYAFHW* |
Ga0099827_103134351 | 3300009090 | Vadose Zone Soil | MKDTIGAGRCFGDLQQLYQRTRRVLMAHQERPMYAF |
Ga0099827_112159241 | 3300009090 | Vadose Zone Soil | DLTPIAGFWRVRKDRMGAGRCFADLPQRYPRPRQGLMAHQERPMYAFHW* |
Ga0111539_103198623 | 3300009094 | Populus Rhizosphere | WRVMKDTIGAGRCFPNLLQLYQRTRRVLMAHQERPIYEFHW* |
Ga0111539_106902553 | 3300009094 | Populus Rhizosphere | NPIEGFWRVMKDTIGAGRCFPDLLQLYQRTHHVLRAHQERPIYAFHW* |
Ga0075418_114748622 | 3300009100 | Populus Rhizosphere | EGFWRAMKDAIGAGRCFRDLPLLYQRTRQVLMAHQERPIYAFHW* |
Ga0066709_1002011641 | 3300009137 | Grasslands Soil | LNPIEGFWRVMKDAIGAGRCFANLHLFYQRTHQVLMAHQERPIYAFHW* |
Ga0066709_1002312273 | 3300009137 | Grasslands Soil | MKDTIGAGRCFSTLQQLYWRTRQVLMAHHERPIYEFHW* |
Ga0066709_1023621651 | 3300009137 | Grasslands Soil | HHLNPIEGFWRVMKDAIGAGRCFPDLHQLYHRTRQVLMAHQERPIYAFHW* |
Ga0114129_100619571 | 3300009147 | Populus Rhizosphere | IEGFWRVMKDKIGAGRCFPDLHLLYQRTREVLMAQQARPIYEFHW* |
Ga0114129_115572482 | 3300009147 | Populus Rhizosphere | NPIEGFWRVMKDAIGAGRCWRDLPTLYQRTRHVLMAHQERPIYEFHW* |
Ga0114129_128383621 | 3300009147 | Populus Rhizosphere | MHLLRFQDTIGAGRCFGALQQLSQRTRRVLMAHQERPIYAFSW* |
Ga0114129_134198581 | 3300009147 | Populus Rhizosphere | EGFWRRMKEVIGAGRCFEDLHLLYRRTRQVLMAHQERPIYEFSW* |
Ga0111538_106110201 | 3300009156 | Populus Rhizosphere | HLNPIAGFWRVMKDTIGAGRCFPNLLQLYQRTRRVLMAHQERPIYEFHW* |
Ga0075423_117778071 | 3300009162 | Populus Rhizosphere | IGAGRWFGDLKQLYQRTRRVLMGHQERPIYAFHW* |
Ga0105249_100921791 | 3300009553 | Switchgrass Rhizosphere | GFWRVMKEAGGAGRCLPDLPPLYQRTRHVLRAHQERPIYEFPW* |
Ga0105249_109121272 | 3300009553 | Switchgrass Rhizosphere | MGCDYNIEGFWRVMKDTIGAGRGFPDLRQLYQRTRQVLMAHQERPSYELHW* |
Ga0105249_111459692 | 3300009553 | Switchgrass Rhizosphere | FWRVMKDTIGAGRCFSALQQLYGRTRQVLMAHQERPIYEFHW* |
Ga0105249_117369961 | 3300009553 | Switchgrass Rhizosphere | HLNPIEGFWRVMKDCIGAGRCFANLHLFYQRTRQVLMAHQERPIYEFHW* |
Ga0126374_102733271 | 3300009792 | Tropical Forest Soil | LNPIEGFWRVMKDTIGAGRCFPDLLQLSQRTRHVLRAHQERPIYEFHW* |
Ga0126374_109847692 | 3300009792 | Tropical Forest Soil | PIEGFWRVMKDTIGAGRYFANLHLLYQRTRQVLMAHHERPIYEFHW* |
Ga0105063_10866912 | 3300009804 | Groundwater Sand | HHLNPIEGFWRVMKDTIGAGRCFSQLAQLYQRTRQVLRAHQERPIYAFHW* |
Ga0105062_10018653 | 3300009817 | Groundwater Sand | LAGFWRVMKDMIGPGRCFPDLYQLYQRTRRVLMAHHERPIGEFHW* |
Ga0105064_10896861 | 3300009821 | Groundwater Sand | FWRVMKDAIGAGRSFADLHLLYQRTRQVLMAHQERPIYEFHW* |
Ga0126380_105138541 | 3300010043 | Tropical Forest Soil | MKDTIGAGRCFPDLLQLYQRTRHVLRAHQERPIYAFHW* |
Ga0126380_107450101 | 3300010043 | Tropical Forest Soil | PIEGFWRVMKDSIGTGRCFPDLQQLYQRTRRVLMAQHERPIFKFHW* |
Ga0126380_111689041 | 3300010043 | Tropical Forest Soil | PHLHPIEGFWRVMKDTIGAGRCFADLHLFYQRTRQVLMAHQERPIYTFRW* |
Ga0126384_108884431 | 3300010046 | Tropical Forest Soil | PIEGFGRVMKDAIGAGRCFAHLHLLYQRTRQVLMAHQERPIYAFHW* |
Ga0126384_120687191 | 3300010046 | Tropical Forest Soil | GFWRVMKEAIGAGRGFADLHQLYQRTRQVLMTHHERPIYEFHW* |
Ga0126382_101349262 | 3300010047 | Tropical Forest Soil | YNIEGFWRVMKDAIGAGRCFRDLPALYQRTRQVLMAQQERPIYEFHW* |
Ga0126382_107021651 | 3300010047 | Tropical Forest Soil | HLNPIAGFWRVMKDKIGAGRYFPDLSQLYQRTRHVLMAHQERPIYAFHW* |
Ga0126382_111185401 | 3300010047 | Tropical Forest Soil | WRVMKDTISAGRCFSDLQQLYQRTRQVLMAQQERPIYKFDW* |
Ga0126382_114273281 | 3300010047 | Tropical Forest Soil | MKDTIGAGRCFPDLLQLYQRTRHVLRAHQERPIYEFHW* |
Ga0134086_104088981 | 3300010323 | Grasslands Soil | IGAGRCFADLHLLYQRTRQVLMAHQERPIYAFHW* |
Ga0126370_103558861 | 3300010358 | Tropical Forest Soil | PIEGFWRVMKDVIGAGRCFPDLHQLYHRTRQVLMAHQERPIYAFHW* |
Ga0126370_110349211 | 3300010358 | Tropical Forest Soil | VPAADPIKGFWRVMKDAIGVGRCFGDLQQLYQRTRHMLMAHQERPIYAFHW* |
Ga0126376_113678931 | 3300010359 | Tropical Forest Soil | MKEAIGAGRGFADLHLLYQRTRQVLMAHQERPIYAFHW* |
Ga0126372_101294784 | 3300010360 | Tropical Forest Soil | ARYGHHLHSMEGFWRVLKDTIRAGRCFPDLQQLYGRVRRVLMAHQEQPIYAFRW* |
Ga0126378_106191581 | 3300010361 | Tropical Forest Soil | MLKHGHHLNPIEGFWRVLKDAIGAGRGFADLHQLYQRTRQVLMAHQERPIYEFHW* |
Ga0126377_112376751 | 3300010362 | Tropical Forest Soil | MGCDYNIEGFWRVMKDKIGAGRCFPTLHALYQRTRQVLMVHQERPIYA |
Ga0126377_115237131 | 3300010362 | Tropical Forest Soil | LNPIEGFWRRMKEVIGAGRCFENLHQLYQRTRQVLIAHQERPIYEFSW* |
Ga0126377_118203352 | 3300010362 | Tropical Forest Soil | SFSSLNPIEGFWRVLKDKIGAGRCFPDLQQLYWRVRRVFMAHQEQPIYAFRW* |
Ga0126379_108222651 | 3300010366 | Tropical Forest Soil | IEGFWRVMKDTIGAGRCFSNLQQLYQRTRQVLMAHQERPISKFHW* |
Ga0126379_113379301 | 3300010366 | Tropical Forest Soil | MGCDYNIEGFWRVMKDAIGAGRGFADLPQLYQRTRQVLMAHQERPSYAFHW* |
Ga0126379_119967641 | 3300010366 | Tropical Forest Soil | PIEGFWRVMKDTIGAGRCFPDLRQLYPRTRQGLMAQQERPIYALHW* |
Ga0126381_1025817642 | 3300010376 | Tropical Forest Soil | EGFWRVMKDRIGAGRGFAHLHLLYQRTRQVLLAHQERPISAWYW* |
Ga0137428_12245882 | 3300011432 | Soil | VSVGTLRGHHLNPIEGFWRVMQDTISAGRCFPDLHLFYQRTRQVLMAHQERPIYEFPW* |
Ga0137433_12919142 | 3300011440 | Soil | EGFWRVMKETTGAGRCFPDLHLFYQRTRQVLMAHQERPIYEFPW* |
Ga0137388_108628972 | 3300012189 | Vadose Zone Soil | GFWRAMKDTIGAGRCFADLHLLYQRTRQVLMAHQERPIYAFHW* |
Ga0137388_116787792 | 3300012189 | Vadose Zone Soil | GHHLNPIEGFWRVMKDRIGAGRCFAALHQLYQRTRQVLMAHQERPIYAFHW* |
Ga0137364_100897772 | 3300012198 | Vadose Zone Soil | RVMKDALGAGRCFSDLHQLYWRTRQVLMAHQERPIYEFHW* |
Ga0137383_103654571 | 3300012199 | Vadose Zone Soil | RVMKDRIGAGRYFADLHQLYQRTRQVLMAHQERPIYAFHW* |
Ga0137383_104563911 | 3300012199 | Vadose Zone Soil | IEGFWRVMKDAIGAGRCWRDLPTLYQRTRHVLIAHQERPIYEFHW* |
Ga0137365_101456302 | 3300012201 | Vadose Zone Soil | MHLLRFQDTIGAGRCFGDLQQLYQRTRQVLMAHQERPIYAFCW* |
Ga0137363_117617901 | 3300012202 | Vadose Zone Soil | GATLNPIEGFWRVLKDWIGAGRCFPDLHQLYQRTRRVLMAHQERPIYAFHW* |
Ga0137362_104258272 | 3300012205 | Vadose Zone Soil | VLGLGLEGFWRVMKDAIGAGRCFYDLAQLYKRTRQVLMAHQERPIYAFHW* |
Ga0137380_102182891 | 3300012206 | Vadose Zone Soil | IGAGRCFPDLHQLYQRTRHVLVAHQERPIYAFHW* |
Ga0137381_116071271 | 3300012207 | Vadose Zone Soil | HHLNPIEGFWRVMKDTIGAGRCFGNLQQLYQRTRRVLMVHQERPIYEFHW* |
Ga0137379_102976381 | 3300012209 | Vadose Zone Soil | LNPIEGFWRVMKDRIGAGRCFADLHQLYQRTRQVLMAHQERPIYAFHW* |
Ga0137379_103479082 | 3300012209 | Vadose Zone Soil | WRVMKDTIGAGRCFGTLHQLYQRTRRVLMAHQEHPIYAFRW* |
Ga0137379_105700982 | 3300012209 | Vadose Zone Soil | IEGFWRVMKDAIGAGRCFADLHLLYQRTRQVLMAHQERPIYTFRW* |
Ga0137378_100499027 | 3300012210 | Vadose Zone Soil | PIEGFWRVMKDTISAGRCFGNLQQLYQRTRRVLMAHQERPMYAFRW* |
Ga0137378_109712962 | 3300012210 | Vadose Zone Soil | PIEGFWRVMKDTISAGRCFGNLQQLYQRTRRVLMAHQERPIYAFRW* |
Ga0137378_113680581 | 3300012210 | Vadose Zone Soil | HLNPIEGFWRVMKDRIGAGRYFADLHQLYQRTRQVLMAHQERPIYAFHW* |
Ga0137377_102313521 | 3300012211 | Vadose Zone Soil | EGFWRVMKDAIGAGRCWRDLPTLYQRTRHVLIAHQERPIYEFHW* |
Ga0137377_112894021 | 3300012211 | Vadose Zone Soil | KDTIGAGRCFGDLSQLYKRTRQVLMAHQERPIYEFSW* |
Ga0150985_1015092472 | 3300012212 | Avena Fatua Rhizosphere | VMKNTIGAGRCFPDLPQLYQRTRRVLMAHQERPIYEFHW* |
Ga0137370_107632612 | 3300012285 | Vadose Zone Soil | IEGFWRVMKGAIGAGRCFGDLGQLYKRTRQVLMAHQERPIYAFHW* |
Ga0137387_101718263 | 3300012349 | Vadose Zone Soil | MKDRIGAGRYFADLHQLYQRTRQVLMAHQERPIYAFHW* |
Ga0137387_106566302 | 3300012349 | Vadose Zone Soil | KDTIGAGRCFGDLQQLYQRTRRVLMAHHERPIYEFHW* |
Ga0137386_108372531 | 3300012351 | Vadose Zone Soil | FWRVMKDRIGAGRCFADLHQLYQRTRQVLMAHQERPIYEFHW* |
Ga0137386_110485441 | 3300012351 | Vadose Zone Soil | GFWRVMKDRIGAGRCFADLHQLYQRTRQVLMAHQERPIYAFHW* |
Ga0137367_101544523 | 3300012353 | Vadose Zone Soil | MKDAVGTGRCCADLHQLYQRTRQVLMAHQERPIYEFHW* |
Ga0137369_102974591 | 3300012355 | Vadose Zone Soil | LNPIEGFWRVMKDTIGAGRCFGDLQQLYQRTRRVLMAHQERPIYEFHW* |
Ga0137384_114595011 | 3300012357 | Vadose Zone Soil | HLNPIEGFWRVMKDTIGAGRCFPHLHQLYQRTRHVLMAHQERPIYAFHW* |
Ga0137368_107532921 | 3300012358 | Vadose Zone Soil | TIGAGRCFADLHLFYQRTSQVLMAHHERPISAFSW* |
Ga0137361_111714131 | 3300012362 | Vadose Zone Soil | MKDTIGAGRCFGDLQQLYQRTRRVLMAHQERPIYQFHW* |
Ga0150984_1086627732 | 3300012469 | Avena Fatua Rhizosphere | GRVMKDVIGAGRCFPDLHQLYRRTRQVLMAHQEQPIYEFHW* |
Ga0137358_108945761 | 3300012582 | Vadose Zone Soil | MKDAIGAGRCLANLHLLYQRTRQVLMAHQERPIYAFHW |
Ga0157283_102144811 | 3300012907 | Soil | IGAGRCFADLHLLYQRTRQVLMAHQWRLIYEFPW* |
Ga0137396_102516112 | 3300012918 | Vadose Zone Soil | MKEAMVAGLCLANLDLLYQRTRQVLMAHQERPIYAFHW* |
Ga0137407_113105391 | 3300012930 | Vadose Zone Soil | LNPIEGFWRVMKDTIGAGRCFGDLQKLYQRTRRVLMAHQERPIYAFHW* |
Ga0164300_111520131 | 3300012951 | Soil | MEGFWRVMKEAIGAGRCLPTLYELYQRTRQVLMALEEQPIYAFHW* |
Ga0126369_101182284 | 3300012971 | Tropical Forest Soil | MGCDDNIEGFWRVMKDAIGAGRGFADLPQLYQRTRQVLMAHQERPSYEFHW* |
Ga0126369_105913992 | 3300012971 | Tropical Forest Soil | PGIQYEREGFWRVLKDCIGAGRCFAHLHLLYQRTRQVLMAHHERPIYAFHW* |
Ga0126369_132122482 | 3300012971 | Tropical Forest Soil | NPIEGFWRRMKEVIGAGRCFEDLPQLYRRTRQVLMAHQERLIYEFSW* |
Ga0163162_101961281 | 3300013306 | Switchgrass Rhizosphere | IEGFWRVRKDAIGAGRCLRDLPTLYQRTRQVLMAHQERPIYAFHW* |
Ga0163162_102212953 | 3300013306 | Switchgrass Rhizosphere | MEGFWRVLKDKIGAGRCFPDLQQLSWRVRHVLMAHQEQPISAFR* |
Ga0163162_124042321 | 3300013306 | Switchgrass Rhizosphere | HLNPIEGFWRVMKDTIGAGRCFSALQQLYGRTRQVLMAHQERPIYEFHW* |
Ga0157372_122222961 | 3300013307 | Corn Rhizosphere | GFWRVMKDTIGAGRCFSALQQLYGRTRQVLMAHQERPIYEFHW* |
Ga0137409_100921111 | 3300015245 | Vadose Zone Soil | MKDAIGAGRCLANLHLLYQRTRQMLMAHQERPIYA |
Ga0134089_102908982 | 3300015358 | Grasslands Soil | LNPIEGFWRVMKDRIGAGRCFPDLQQLYQRTRRVLMAHHERPIYAFHW* |
Ga0132258_102363635 | 3300015371 | Arabidopsis Rhizosphere | PIEGFWRVMKDAIGVGRCFRALPALSQRTRQVLLAHQARPIYEFHW* |
Ga0182036_100157852 | 3300016270 | Soil | MTRPNVTLSSYNIEGFWRVMKDAIGAGRCFPALHQLYQRTRHVLMAHQERPIYAFHW |
Ga0182041_105138281 | 3300016294 | Soil | IEGFWRVMKDAIGAGRCLRDLPTLYQRTRQVLMAHQERPIYEFHW |
Ga0182033_116969432 | 3300016319 | Soil | IEGFWRVMKDAIGAGRCFANLHLLSQRTRQVLMAHQERPMYAFHW |
Ga0182035_102993092 | 3300016341 | Soil | MGYDYNIEGFWRVMKDTIGAGRCLPDLHQLYQRTRHVLMAHQERPIYAFH |
Ga0182035_105783313 | 3300016341 | Soil | PIEGFWRVMKDCIGAGRCFADLQLLYHRTRQVLMAHQERPIYAFH |
Ga0163161_102469524 | 3300017792 | Switchgrass Rhizosphere | IEGFWRVMKDRVSAGRCFPDLHQLYQRTRRVLMAHQECPIYAFHW |
Ga0184618_104860201 | 3300018071 | Groundwater Sediment | KDAIGAGRCFANLHLLYQRTRQVLMAHQERPIYAFHW |
Ga0066667_104526291 | 3300018433 | Grasslands Soil | IEGFWRVMKDTIGAGRCFGNLQQLYQRTRRVLMVHQERPIYEFHW |
Ga0066667_118705201 | 3300018433 | Grasslands Soil | MKDTIGAERCFPNLHQLSQRTPRVLMAHQERPIYAFH |
Ga0190268_116131691 | 3300018466 | Soil | NPIEGFWRVMKDAIGARRCFADLHLLYQRTRHVLMAHQERPIYEFHW |
Ga0190264_112656062 | 3300019377 | Soil | MKEAIGAGRCLSHLHQLYQRTRQVLMAQQEQPIYAFHW |
Ga0137408_14881872 | 3300019789 | Vadose Zone Soil | MKDTIGAGRCFGDLPQLYKRTRQVLMAHQERPIYAFHW |
Ga0126371_138998391 | 3300021560 | Tropical Forest Soil | MGCDYNIEGFWRVMKDAIGAGRGFADLPQLYQRTRQVLMAHQERPIYAFHW |
Ga0207712_117748121 | 3300025961 | Switchgrass Rhizosphere | MGCDYNIEGFWRVMKDAIGVGRCLRDLPTLYQRTRHVLMAHQERSIYEFHW |
Ga0207712_120865441 | 3300025961 | Switchgrass Rhizosphere | LTTPIEGFWRVMKDTIGAGRCFPHLLQLYQHTRRVLMAHQERPIYEFHW |
Ga0207668_100779425 | 3300025972 | Switchgrass Rhizosphere | CGHHLNPIEGFWRVLKDRIGAGRCFPDLPQLYHRTRRVLMAHHERPIYAFHW |
Ga0207674_100211575 | 3300026116 | Corn Rhizosphere | MGCDYNIEGFWRVMKDTIGAGRCFPALHLLYRRTRQVLMAHQERPIYAFHW |
Ga0209465_100254502 | 3300027874 | Tropical Forest Soil | MGCDYNIEGFWRVMKDAIGAGRGFADLPQLYQRTRQVLMAHQERPSYAFHW |
Ga0209488_102434443 | 3300027903 | Vadose Zone Soil | PIEGFWRVMKDSIGAGRCFPDLHQLYHRTCRVLMAHHERPIYEFHW |
Ga0207428_104651993 | 3300027907 | Populus Rhizosphere | KDAIGAGRGFPDLHQLYKRTREVLMAHQERPIYEFHW |
Ga0209382_106497972 | 3300027909 | Populus Rhizosphere | MKDVIGAGRCFPDLPQLYRRTRQVLMAHQERPIYAFHW |
Ga0268264_115677261 | 3300028381 | Switchgrass Rhizosphere | LTTPIEGFWRVMKDTIGAGRCFPDLLQLYQRTRHVLKAHQERPIYEFHW |
Ga0247828_102289592 | 3300028587 | Soil | MEGFWRVMKEAIGAGRCLPTLYELYQRTRQVLMALQEQPIY |
Ga0247655_102354623 | 3300030621 | Soil | GHHLNLIEGFWRVMKDAIGAGRCFPDLHQRYHRVRQVLMAHQERPIYAFHW |
Ga0247636_100868661 | 3300030634 | Soil | CGHHLNLIEGFWRVMKDAIGAGRCFPDLHQRYHRVRQVLMAHQERPIYAFHW |
Ga0308205_10279751 | 3300030830 | Soil | HLNPIEGFWRVMKDTIGAGRCFGNLQQLYQRTRRVLMVHQERPIYEFHW |
Ga0308206_11548671 | 3300030903 | Soil | CGHHLNPIDGFWRVMKDAIGAGRCFGDLVQLYGRTRQVLMAHQERPI |
Ga0308189_103801141 | 3300031058 | Soil | LKDTIGAGRCFPGLYQLYQRTRQVLMAHQERPIYAFHW |
Ga0308197_100188601 | 3300031093 | Soil | HHLNPIEGFWRVMKDTIGAGRCFADLHLLYQRTRQVLMAHQERPIYAFHW |
Ga0299914_105547243 | 3300031228 | Soil | EGFWRRMKEVMGAGRCFEDLHQLYQRTRQVLMAHQERPIYEFSW |
Ga0310887_105895601 | 3300031547 | Soil | EGFWRVMKDTIGAGRCFADLHLLYQRTRQVLMAHQERPIYEFHW |
Ga0307408_1000378621 | 3300031548 | Rhizosphere | IEGFWRVMKDTIGAGRCFPNLHQLYQRTRQVLMAHQERPIYAFHW |
Ga0318528_103594662 | 3300031561 | Soil | KDAIGAGRGFTDLHRLYQRTRQVLMAHQERPIYEFHW |
Ga0306917_112551332 | 3300031719 | Soil | HHLNPLEGFWRVMKDTIGARRCLSDLQQLYQRTRQVLMAHHERPIYKCHW |
Ga0307468_1005091502 | 3300031740 | Hardwood Forest Soil | MGCDYNIEGFWRVLKERIGAGRCFPDLHQLYQRTRRVLMAHHERPIYAFRW |
Ga0306918_107900022 | 3300031744 | Soil | KDTIGAGRCFSDLQQLYQRTRQVLMAHQERPIYKFHW |
Ga0310893_100136901 | 3300031892 | Soil | MGCDYNIEGFWRVMKDTIGAGRCFADLHRLYQRTRHVLMAHQERPIYEFHW |
Ga0310900_100159324 | 3300031908 | Soil | MGCDYNIEGFWRVLKERIGAGRCFPDLHQLYQRTRRVLMAHHERPIYAF |
Ga0306921_102073083 | 3300031912 | Soil | MTRPNVTLSSYNIEGFWRVMKDAIGAGRCFPALHQLYQRTRHVLMAHQERPMYAFHW |
Ga0310885_100545482 | 3300031943 | Soil | MGCDYNIEGFWRVLKEKIGAGRCFANLHLFYQRTRQVLREHQERPIYAFHW |
Ga0310884_102710361 | 3300031944 | Soil | PIEGFWRVLKEKIGAGRCFANLHLLYQRTRQVLREHQERPIYAFHW |
Ga0310909_109725611 | 3300031947 | Soil | HLHPIEGFWRVRKDAIGAGRCFPDLPQLYHRTRRVLMAHRERPIYEFHW |
Ga0310902_110449331 | 3300032012 | Soil | PIEGFWRVLKEKIGAGRCFANLHLLYQRTRQVLREHQERPI |
Ga0310902_113779172 | 3300032012 | Soil | HLNPIEGFWRVMKDRIGAGRCFPDLHQLYQRTRRVLTDHQTRPIYAFHW |
Ga0318504_105041731 | 3300032063 | Soil | GFWRVMKDKIGAGRWFSELHLLYQRTREVLMAHQARPIYEFHW |
Ga0318518_104520122 | 3300032090 | Soil | RFMGCDYNIEGFWRVMKEKIGAGRCFANLQLLYQRTRQVLMGHHERPIYAFHW |
Ga0310895_100828391 | 3300032122 | Soil | MGCDYNIEGFWRVLKDRIGAGRCFPDLHQLYQRTRRVLMAHHERPIYAFRW |
Ga0310889_100323611 | 3300032179 | Soil | MGCDYNIEGFWRVLKDRSGAGRCFPDLHQLSQRTRRGLMAHHERPIYAFRW |
Ga0306920_1007128414 | 3300032261 | Soil | GHHLNPIEGFWRVMKDAIGAGRGFADLPQLYQRTRQVLMAHQERPIYEFHW |
Ga0310914_109139382 | 3300033289 | Soil | HFNPIEGFWRVMKDAIGAGRGFADLHQLYQRTRQVLMTHHERPIYEFHW |
Ga0334913_039199_838_1014 | 3300034172 | Sub-Biocrust Soil | MLLPAHCGQHLNPMEGFWRVMRDRISAGRCFPDLPQFYQRTRHVLMAHQERPIFEFHW |
⦗Top⦘ |