NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022258

Metagenome / Metatranscriptome Family F022258

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022258
Family Type Metagenome / Metatranscriptome
Number of Sequences 215
Average Sequence Length 39 residues
Representative Sequence MTIHKQRGGRYWYYWLVIVGGTLFVIAYYATDGFGLQP
Number of Associated Samples 156
Number of Associated Scaffolds 215

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.09 %
% of genes near scaffold ends (potentially truncated) 11.63 %
% of genes from short scaffolds (< 2000 bps) 78.14 %
Associated GOLD sequencing projects 146
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (50.233 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.860 % of family members)
Environment Ontology (ENVO) Unclassified
(24.651 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.512 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 28.79%    β-sheet: 0.00%    Coil/Unstructured: 71.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 215 Family Scaffolds
PF00480ROK 30.23
PF00005ABC_tran 7.91
PF14602Hexapep_2 4.65
PF02151UVR 1.86
PF12344UvrB 1.40
PF01594AI-2E_transport 1.40
PF02653BPD_transp_2 1.40
PF02557VanY 0.93
PF01842ACT 0.93
PF00211Guanylate_cyc 0.93
PF10099RskA 0.93
PF13191AAA_16 0.47
PF00106adh_short 0.47
PF13091PLDc_2 0.47
PF02734Dak2 0.47
PF13561adh_short_C2 0.47
PF13432TPR_16 0.47
PF01869BcrAD_BadFG 0.47
PF02261Asp_decarbox 0.47
PF13379NMT1_2 0.47
PF00583Acetyltransf_1 0.47
PF027373HCDH_N 0.47
PF00953Glycos_transf_4 0.47
PF01121CoaE 0.47
PF02548Pantoate_transf 0.47
PF13556HTH_30 0.47
PF02801Ketoacyl-synt_C 0.47
PF13396PLDc_N 0.47
PF00264Tyrosinase 0.47
PF05834Lycopene_cycl 0.47
PF01408GFO_IDH_MocA 0.47
PF00664ABC_membrane 0.47
PF01894UPF0047 0.47
PF03795YCII 0.47
PF01839FG-GAP 0.47
PF03972MmgE_PrpD 0.47
PF07883Cupin_2 0.47
PF02569Pantoate_ligase 0.47
PF02913FAD-oxidase_C 0.47
PF01476LysM 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 215 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 60.47
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.40
COG1876LD-carboxypeptidase LdcB, LAS superfamilyCell wall/membrane/envelope biogenesis [M] 0.93
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.93
COG2173D-alanyl-D-alanine dipeptidaseCell wall/membrane/envelope biogenesis [M] 0.93
COG0237Dephospho-CoA kinaseCoenzyme transport and metabolism [H] 0.47
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.47
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.47
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.47
COG0413Ketopantoate hydroxymethyltransferaseCoenzyme transport and metabolism [H] 0.47
COG0414Panthothenate synthetaseCoenzyme transport and metabolism [H] 0.47
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.47
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 0.47
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.47
COG0853Aspartate 1-decarboxylaseCoenzyme transport and metabolism [H] 0.47
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.47
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.47
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.47
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.47
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.47
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms50.70 %
UnclassifiedrootN/A49.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908044|A5_c1_ConsensusfromContig79106Not Available1437Open in IMG/M
2140918007|ConsensusfromContig58632All Organisms → cellular organisms → Bacteria1650Open in IMG/M
2170459013|GO6OHWN01D6H3GNot Available522Open in IMG/M
2189573002|GZIGXIF01D1AJXAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae533Open in IMG/M
3300000956|JGI10216J12902_103781859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300000956|JGI10216J12902_105898945Not Available575Open in IMG/M
3300001536|A1565W1_10938541All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300001538|A10PFW1_11241281Not Available715Open in IMG/M
3300002184|JGI24770J26754_10241218All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300002568|C688J35102_120928563Not Available2460Open in IMG/M
3300004153|Ga0063455_101433647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300004157|Ga0062590_101974310Not Available604Open in IMG/M
3300004157|Ga0062590_102773602Not Available523Open in IMG/M
3300004463|Ga0063356_101580426All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300004479|Ga0062595_101706797Not Available593Open in IMG/M
3300005356|Ga0070674_100814881Not Available807Open in IMG/M
3300005536|Ga0070697_101089286All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005563|Ga0068855_101359774Not Available733Open in IMG/M
3300005564|Ga0070664_100015732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6191Open in IMG/M
3300005587|Ga0066654_10276890Not Available892Open in IMG/M
3300005718|Ga0068866_10000003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales281675Open in IMG/M
3300005718|Ga0068866_10522759All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300005719|Ga0068861_101866926Not Available597Open in IMG/M
3300005841|Ga0068863_100198922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1927Open in IMG/M
3300005842|Ga0068858_100088454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2882Open in IMG/M
3300005843|Ga0068860_101724799Not Available648Open in IMG/M
3300005937|Ga0081455_10188131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1558Open in IMG/M
3300005937|Ga0081455_10423012Not Available918Open in IMG/M
3300005937|Ga0081455_10484038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense836Open in IMG/M
3300005985|Ga0081539_10016027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales5391Open in IMG/M
3300006038|Ga0075365_10036183Not Available3198Open in IMG/M
3300006038|Ga0075365_10159526All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300006038|Ga0075365_10381009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300006038|Ga0075365_11043064Not Available576Open in IMG/M
3300006046|Ga0066652_100014197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5254Open in IMG/M
3300006046|Ga0066652_100366645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1302Open in IMG/M
3300006046|Ga0066652_100382731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1276Open in IMG/M
3300006046|Ga0066652_100510162Not Available1119Open in IMG/M
3300006046|Ga0066652_100577322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1057Open in IMG/M
3300006092|Ga0082021_1098968All Organisms → cellular organisms → Bacteria2393Open in IMG/M
3300006173|Ga0070716_100660041Not Available794Open in IMG/M
3300006173|Ga0070716_100697595Not Available775Open in IMG/M
3300006175|Ga0070712_100949103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300006175|Ga0070712_101068231Not Available700Open in IMG/M
3300006178|Ga0075367_10523234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300006237|Ga0097621_101032544Not Available770Open in IMG/M
3300006573|Ga0074055_11196743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1128Open in IMG/M
3300006580|Ga0074049_11850886All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006606|Ga0074062_11634783Not Available632Open in IMG/M
3300006804|Ga0079221_10913507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium646Open in IMG/M
3300006806|Ga0079220_10553336Not Available803Open in IMG/M
3300006854|Ga0075425_101065845Not Available921Open in IMG/M
3300006871|Ga0075434_100058877Not Available3818Open in IMG/M
3300006954|Ga0079219_10095903All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300006972|Ga0075518_1052656Not Available814Open in IMG/M
3300009011|Ga0105251_10240873Not Available815Open in IMG/M
3300009012|Ga0066710_100225807Not Available2689Open in IMG/M
3300009012|Ga0066710_102940470Not Available666Open in IMG/M
3300009137|Ga0066709_103204480All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300009147|Ga0114129_10617382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1403Open in IMG/M
3300009148|Ga0105243_10687527Not Available996Open in IMG/M
3300009698|Ga0116216_10345692Not Available905Open in IMG/M
3300009789|Ga0126307_10266931Not Available1376Open in IMG/M
3300009818|Ga0105072_1121923All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium534Open in IMG/M
3300009840|Ga0126313_11336641Not Available593Open in IMG/M
3300009840|Ga0126313_11442331Not Available571Open in IMG/M
3300009840|Ga0126313_11528432Not Available555Open in IMG/M
3300009840|Ga0126313_11800663Not Available512Open in IMG/M
3300009868|Ga0130016_10673727Not Available633Open in IMG/M
3300009870|Ga0131092_10355101Not Available1391Open in IMG/M
3300009870|Ga0131092_10965130Not Available693Open in IMG/M
3300010036|Ga0126305_10541048Not Available779Open in IMG/M
3300010038|Ga0126315_10241371All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300010040|Ga0126308_10004616All Organisms → cellular organisms → Bacteria6369Open in IMG/M
3300010041|Ga0126312_10002132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13194Open in IMG/M
3300010041|Ga0126312_10025042All Organisms → cellular organisms → Bacteria3983Open in IMG/M
3300010041|Ga0126312_11111052Not Available581Open in IMG/M
3300010041|Ga0126312_11146102Not Available572Open in IMG/M
3300010042|Ga0126314_10807293Not Available691Open in IMG/M
3300010043|Ga0126380_11073341Not Available684Open in IMG/M
3300010044|Ga0126310_10001568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8854Open in IMG/M
3300010147|Ga0126319_1171952All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium542Open in IMG/M
3300010166|Ga0126306_10085416All Organisms → cellular organisms → Bacteria2255Open in IMG/M
3300010333|Ga0134080_10338894All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300010335|Ga0134063_10137448Not Available1127Open in IMG/M
3300010337|Ga0134062_10367038All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300010337|Ga0134062_10560922Not Available583Open in IMG/M
3300010364|Ga0134066_10281263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium589Open in IMG/M
3300010373|Ga0134128_10647447All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300010379|Ga0136449_100033314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12334Open in IMG/M
3300010400|Ga0134122_10075773All Organisms → cellular organisms → Bacteria2622Open in IMG/M
3300010400|Ga0134122_11059121All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes800Open in IMG/M
3300011119|Ga0105246_10260459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1381Open in IMG/M
3300011119|Ga0105246_11245780Not Available687Open in IMG/M
3300012198|Ga0137364_10057654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2612Open in IMG/M
3300012198|Ga0137364_10564697All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300012201|Ga0137365_10250432All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300012201|Ga0137365_10397498Not Available1016Open in IMG/M
3300012201|Ga0137365_10406268All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300012204|Ga0137374_10005384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia15211Open in IMG/M
3300012212|Ga0150985_102402599Not Available618Open in IMG/M
3300012212|Ga0150985_106443416Not Available641Open in IMG/M
3300012350|Ga0137372_10935345Not Available611Open in IMG/M
3300012355|Ga0137369_10056079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3416Open in IMG/M
3300012356|Ga0137371_10845742Not Available696Open in IMG/M
3300012469|Ga0150984_104123898Not Available563Open in IMG/M
3300012930|Ga0137407_12361131Not Available508Open in IMG/M
3300012931|Ga0153915_12786673Not Available571Open in IMG/M
3300012948|Ga0126375_11718107Not Available545Open in IMG/M
3300012951|Ga0164300_10001455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei5515Open in IMG/M
3300012958|Ga0164299_10385656Not Available895Open in IMG/M
3300012961|Ga0164302_10621182Not Available787Open in IMG/M
3300012961|Ga0164302_11168353Not Available613Open in IMG/M
3300012985|Ga0164308_10844392Not Available802Open in IMG/M
3300012986|Ga0164304_10489869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium895Open in IMG/M
3300012987|Ga0164307_10261564All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300012988|Ga0164306_10170020All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300012988|Ga0164306_10494654All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300012989|Ga0164305_11498427Not Available598Open in IMG/M
3300012989|Ga0164305_12177171All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300013308|Ga0157375_10003070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales14493Open in IMG/M
3300013772|Ga0120158_10262750Not Available856Open in IMG/M
3300014320|Ga0075342_1188987Not Available577Open in IMG/M
3300014325|Ga0163163_13346831Not Available500Open in IMG/M
3300014326|Ga0157380_13476541Not Available504Open in IMG/M
3300015162|Ga0167653_1000935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7105Open in IMG/M
3300015168|Ga0167631_1000112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12355Open in IMG/M
3300015371|Ga0132258_10005487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia24874Open in IMG/M
3300015371|Ga0132258_10072059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8016Open in IMG/M
3300015371|Ga0132258_10128012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia6050Open in IMG/M
3300015371|Ga0132258_10822102All Organisms → cellular organisms → Bacteria2343Open in IMG/M
3300015371|Ga0132258_13036086Not Available1162Open in IMG/M
3300015371|Ga0132258_13467861All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300017657|Ga0134074_1138586Not Available847Open in IMG/M
3300017966|Ga0187776_10120991All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300018429|Ga0190272_11712232Not Available651Open in IMG/M
3300018432|Ga0190275_10312768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1545Open in IMG/M
3300018432|Ga0190275_11607642Not Available728Open in IMG/M
3300018432|Ga0190275_11718582Not Available706Open in IMG/M
3300018432|Ga0190275_13320819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300018466|Ga0190268_10990980Not Available668Open in IMG/M
3300018469|Ga0190270_10044800All Organisms → cellular organisms → Bacteria3023Open in IMG/M
3300018469|Ga0190270_10088502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2327Open in IMG/M
3300018469|Ga0190270_10750585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia975Open in IMG/M
3300018469|Ga0190270_11493430All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300018469|Ga0190270_12001828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium637Open in IMG/M
3300018469|Ga0190270_12307126Not Available599Open in IMG/M
3300018481|Ga0190271_10058185All Organisms → cellular organisms → Bacteria3339Open in IMG/M
3300018481|Ga0190271_10202299Not Available1978Open in IMG/M
3300018481|Ga0190271_10472893All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300018481|Ga0190271_10516721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1307Open in IMG/M
3300018482|Ga0066669_10055775All Organisms → cellular organisms → Bacteria2527Open in IMG/M
3300019362|Ga0173479_10399869Not Available662Open in IMG/M
3300019377|Ga0190264_10321729Not Available951Open in IMG/M
3300020001|Ga0193731_1076441Not Available874Open in IMG/M
3300021363|Ga0193699_10386090Not Available581Open in IMG/M
3300022756|Ga0222622_10740559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B716Open in IMG/M
3300024187|Ga0247672_1072849Not Available585Open in IMG/M
3300025524|Ga0209817_1076029Not Available556Open in IMG/M
3300025725|Ga0209638_1073609Not Available1292Open in IMG/M
3300025817|Ga0210144_1000833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales14135Open in IMG/M
3300025817|Ga0210144_1036449Not Available1531Open in IMG/M
3300025817|Ga0210144_1110031Not Available800Open in IMG/M
3300025885|Ga0207653_10412729Not Available529Open in IMG/M
3300025898|Ga0207692_10129868Not Available1421Open in IMG/M
3300025899|Ga0207642_10000002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia658166Open in IMG/M
3300025899|Ga0207642_10749229All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300025900|Ga0207710_10722850Not Available523Open in IMG/M
3300025915|Ga0207693_10427069All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1036Open in IMG/M
3300025916|Ga0207663_10005118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6590Open in IMG/M
3300025920|Ga0207649_10201005All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300025929|Ga0207664_10030590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei4113Open in IMG/M
3300025934|Ga0207686_11133159Not Available639Open in IMG/M
3300025937|Ga0207669_10198554Not Available1454Open in IMG/M
3300025937|Ga0207669_11229704All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300025949|Ga0207667_11239589Not Available724Open in IMG/M
3300025972|Ga0207668_10481969All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300026089|Ga0207648_10000643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales39180Open in IMG/M
3300026121|Ga0207683_10508360Not Available1113Open in IMG/M
3300026319|Ga0209647_1000007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales229181Open in IMG/M
3300026319|Ga0209647_1068443Not Available1809Open in IMG/M
3300027288|Ga0208525_1021448All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300027561|Ga0209887_1015462All Organisms → cellular organisms → Bacteria1905Open in IMG/M
3300027775|Ga0209177_10063775Not Available1081Open in IMG/M
3300027870|Ga0209023_10014399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales7165Open in IMG/M
3300028381|Ga0268264_10023193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5064Open in IMG/M
3300028556|Ga0265337_1000034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales60151Open in IMG/M
3300028707|Ga0307291_1063915Not Available897Open in IMG/M
3300028710|Ga0307322_10219738Not Available522Open in IMG/M
3300028713|Ga0307303_10102387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300028754|Ga0307297_10343167Not Available545Open in IMG/M
3300028755|Ga0307316_10001067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8564Open in IMG/M
3300028755|Ga0307316_10006611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3575Open in IMG/M
3300028768|Ga0307280_10245225Not Available643Open in IMG/M
3300028784|Ga0307282_10215036Not Available920Open in IMG/M
3300028784|Ga0307282_10545911All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300028787|Ga0307323_10235588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300028793|Ga0307299_10101781All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300028802|Ga0307503_10000048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales81515Open in IMG/M
3300028878|Ga0307278_10068995All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300028878|Ga0307278_10143594Not Available1070Open in IMG/M
3300029990|Ga0311336_11659265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei564Open in IMG/M
3300031114|Ga0308187_10372076Not Available557Open in IMG/M
3300031199|Ga0307495_10127065Not Available635Open in IMG/M
3300031228|Ga0299914_10179620Not Available1878Open in IMG/M
3300031228|Ga0299914_10783745Not Available796Open in IMG/M
3300031229|Ga0299913_10037348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei4599Open in IMG/M
3300031229|Ga0299913_10445484Not Available1282Open in IMG/M
3300031652|Ga0315553_10044796Not Available2526Open in IMG/M
3300032002|Ga0307416_102252418Not Available646Open in IMG/M
3300032160|Ga0311301_10021966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria17783Open in IMG/M
3300032180|Ga0307471_102219446Not Available692Open in IMG/M
3300033433|Ga0326726_10557548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1099Open in IMG/M
3300034781|Ga0334935_017946Not Available1843Open in IMG/M
3300034781|Ga0334935_073195All Organisms → cellular organisms → Bacteria925Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.86%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.33%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.86%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.86%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.40%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.40%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.40%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.40%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.40%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.40%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.93%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.93%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.47%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.47%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.47%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.47%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.47%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.47%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.47%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.47%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.47%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.47%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.47%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.47%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.47%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.47%
Wastewater Treatment PlantEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002184Freshwater and sediment microbial communities from Lake Erie, CanadaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006092Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, SingaporeEngineeredOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006972Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-AEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015162Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300025524Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A (SPAdes)EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025817Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027288Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)EnvironmentalOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031652Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034781Biocrust microbial communities from Mojave Desert, California, United States - 31SMCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A5_c1_000171602124908044SoilMAIHRQRGGRYWHYWAIIIGGTIFVIAYYASDGFGVTP
A_all_C_020991502140918007SoilPSARRRQELTLAIHRQRGGRYWHYWAIIIGGTIFVIAYYASDGFGVTP
N57_018924502170459013Grass SoilMAIHKGRSGAGTYWYYWLVIVGGTIFVIAAYATDMFGLKP
FE1_073962702189573002Grass SoilMTIHKQRGGRYWYYWLVIVGGTLFVIAYYATDGFGLQP
JGI10216J12902_10378185923300000956SoilVIHPQKGGRYWYYWVVIVGGTIFVIAALATDMFGTGP*
JGI10216J12902_10589894513300000956SoilPQRGGRYWYYWAVIIGGTIFVIVALATDMFGTGS*
A1565W1_1093854133300001536PermafrostMTIHKRRGGGYWYYWVLLIGGTIFVIAYFSTDGFGLSP*
A10PFW1_1124128123300001538PermafrostMTIHKRRGGGYWYYWVLLIGGTTFVIAYFSTDGFGLSP*
JGI24770J26754_1024121823300002184Freshwater And SedimentMTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLTP*
C688J35102_12092856323300002568SoilMAIHKGRSGSGTYWYYWLVIVGGTIFVIAALATDMFGLKP*
Ga0063455_10143364723300004153SoilLTIHKSRYGTYWYYWVIIIGGVAFVIAAYATNGFGTGAA*
Ga0062590_10197431013300004157SoilRLTVAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP*
Ga0062590_10277360213300004157SoilVTIHKQRGGRYWYYWVIIIGGTIFVVAALATDMFGLGSGY*
Ga0063356_10158042623300004463Arabidopsis Thaliana RhizosphereMTIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAA*
Ga0062595_10170679713300004479SoilVTIHRQRGGRYWYYWVIIIGGTIFVVAALATDMFGLGSGY*
Ga0070674_10081488113300005356Miscanthus RhizospherePRSRAEMAIHRPRGGHYWYYWLIIVGGTIFVIAYYATDGFGLQP*
Ga0070697_10108928613300005536Corn, Switchgrass And Miscanthus RhizosphereRGDRRAPTGGRPGMTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP*
Ga0068855_10135977423300005563Corn RhizosphereMTIHKPRGGLYWRYWAVLIAGSAFVIAYLLTDGFGLQP*
Ga0070664_10001573263300005564Corn RhizosphereMAIHRPRGGHYWYYWLVIIGGTILVIAFYATDGFGLQP*
Ga0066654_1027689023300005587SoilMAIHKGRSGAGTYWYYWLVIVGGTIFVIAAYATDMFGLKP*
Ga0068866_100000031463300005718Miscanthus RhizosphereMAIHKPSGGLYWRYWAILIGGSAFVVAYLLTDGFGLQP*
Ga0068866_1052275923300005718Miscanthus RhizosphereVTIHRQRGGRYWYYWVIIVGGLAFVIAYYATDGFGLSP*
Ga0068861_10186692623300005719Switchgrass RhizosphereMTIHKPRGGHYWRYRVVLIGGSAFVVAYLITDGFGLRP*
Ga0068863_10019892233300005841Switchgrass RhizosphereMAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGISR*
Ga0068858_10008845443300005842Switchgrass RhizosphereMAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGIAR*
Ga0068860_10172479923300005843Switchgrass RhizosphereMAIHRPRGGHYWRYWLVLIGGGTFVIAYLLTGGFGLQP*
Ga0081455_1018813133300005937Tabebuia Heterophylla RhizosphereMTIHKQRGGRYWYYWLVIIGGTIFVIAAVATDMFGLGGSY*
Ga0081455_1042301223300005937Tabebuia Heterophylla RhizosphereMTIHRQRGGRYWYYWVIIIGGTAFVIAAIATDMFGLGGGY*
Ga0081455_1048403823300005937Tabebuia Heterophylla RhizosphereMTIHKQRGGRYWYYWVLIIGGAIFVIAALATDMFGLGGY*
Ga0081539_1001602723300005985Tabebuia Heterophylla RhizosphereMTTHKQRGGRYWYYWVVIVGGTLFVIAYFASDGFGLGS*
Ga0075365_1003618333300006038Populus EndosphereVAIHPQRGGRYWYYWVLIVGGLVFVIAYYATDGFGLG*
Ga0075365_1015952623300006038Populus EndosphereMTIHKRRLDGYWHYWVIIVGGVLFVIAYYATDGFGLA*
Ga0075365_1038100923300006038Populus EndosphereMTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLAP*
Ga0075365_1104306423300006038Populus EndosphereMAIHPQRGGRYWYYWVLIVGGLVFVIAYYATDGFGLG*
Ga0066652_10001419743300006046SoilVTIHRQRGGRYWYYWVVLVGGVLFVVAFYATDGFGLSP*
Ga0066652_10036664523300006046SoilVTIHAQRGGRYWHYWVIIVGGLAFVIAAYATDGFGTGAV*
Ga0066652_10038273123300006046SoilMTIHKQRGGRYWYYWVIIVGGTIFVIAAYATDMFGLKP*
Ga0066652_10051016223300006046SoilMAIHRQRGGTYWYYWLIIVGGTILVIAAYATDMFGLQP*
Ga0066652_10057732223300006046SoilVTIHNQRGGRYWYYWAVIVGGLVFVAAYYASDGFGLSP*
Ga0082021_109896823300006092Wastewater Treatment PlantMAIHPQRGGRYWYYWVLIVGGAIFVIAYYATDGFGLAA*
Ga0070716_10066004123300006173Corn, Switchgrass And Miscanthus RhizosphereMTIHKQRGGRYWYYWLIIVGGILFVVAYYASDGFGLKP*
Ga0070716_10069759523300006173Corn, Switchgrass And Miscanthus RhizosphereAGQRLTMAIHRPRGGHYWRYWLVLIGGSAFVIAYLLTDGFGLQP*
Ga0070712_10094910323300006175Corn, Switchgrass And Miscanthus RhizospherePRRPQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP*
Ga0070712_10106823123300006175Corn, Switchgrass And Miscanthus RhizosphereVAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP*
Ga0075367_1052323423300006178Populus EndosphereMTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP*
Ga0097621_10103254423300006237Miscanthus RhizosphereMAIHRPRGGHYWYYWLIIVGGTIFVIAYYATDGFGLQP*
Ga0074055_1119674323300006573SoilMAIHKQRGGRYWYYWLIIVGGIVFVIAYYASGGFGLRP*
Ga0074049_1185088623300006580SoilVAIHKRRGGGYWYYWLVIVAGTIFVVAFYATDGFGLRP*
Ga0074062_1163478323300006606SoilVAIHKRRGGGYWYYWLVIVAGTIFVIAFYATDGFGLRR*
Ga0079221_1091350723300006804Agricultural SoilHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP*
Ga0079220_1055333623300006806Agricultural SoilVAIHKRRGGGYWYYWLVIVGGILFVIAYYATDGFGLKP*
Ga0075425_10106584533300006854Populus RhizosphereMTIHRQRGGRYWYYWVVIFGGIAFVIAYFATDGFGLAP*
Ga0075434_10005887733300006871Populus RhizosphereMTIHRQRGGRYWYYWVIIVGGIAFVVAYYATDGFGLSP*
Ga0079219_1009590323300006954Agricultural SoilMTIHRPRGGHYWRYWVVLIGGSAFVIAYLLTDGFGLRP*
Ga0075518_105265623300006972Arctic Peat SoilMAIHRQRGGRYWYYWVIIIGGTIFVIAYYASDGFGVTP*
Ga0105251_1024087323300009011Switchgrass RhizosphereAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGISR*
Ga0066710_10022580723300009012Grasslands SoilVTIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAV
Ga0066710_10294047023300009012Grasslands SoilMTIHKQPGGSYWYYWVVIIGGIVFVVAYFATDGFGLAP
Ga0066709_10320448023300009137Grasslands SoilTIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAV*
Ga0114129_1061738223300009147Populus RhizosphereMTVHRQRGGRYWYYWVIILGGIAFVIAYYATDGFGLSP*
Ga0105243_1068752723300009148Miscanthus RhizosphereMAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLQP*
Ga0116216_1034569213300009698Peatlands SoilMAIHKQRGGRYWYYWVVIIGGAALVIAYYLTNGFGAKP*
Ga0126307_1026693123300009789Serpentine SoilMTIHRPRGGHYWYYWLVIVGGSVFVIAFYATDGFGLQP*
Ga0105072_112192323300009818Groundwater SandVTIHRQRGGRYWYYWVFILGGTVFVIAALATDMFGLG*
Ga0126313_1133664123300009840Serpentine SoilMTIHKQPGGRYWYYWAIILGGIAFAVAFYATDGFGLSP*
Ga0126313_1144233123300009840Serpentine SoilMTIHKRRGGGYWYYWLVIVGGALFVIAYYATDGFGLQP*
Ga0126313_1152843213300009840Serpentine SoilMAIHDQRGGRYWYYWLIIVGGTIFVIAYYASDGFGLGQ*
Ga0126313_1180066323300009840Serpentine SoilMTIHRPRGGHYWYYWLVIVGGVVFVIAFYATDGFGLQP*
Ga0130016_1067372713300009868WastewaterMTIHRQRGGRYWYYWVVIIGGLVLAIAFYATDGFGLAP*
Ga0131092_1035510123300009870Activated SludgeMAIHRQRGGRYWYYWAIIIGGTIFVVVALATDMFGLGSGY*
Ga0131092_1096513013300009870Activated SludgeMTIHRQRGGRYWYYWVVIIGGLAFAIAFYATDGFGLAT*
Ga0126305_1054104823300010036Serpentine SoilMTIHRPRGGHYWYYWLVIVGGTIFVIAFYATDGFGLQP*
Ga0126315_1024137123300010038Serpentine SoilVTIHKRRGGGYWYYWVIIIGGTALVIAYIATDGFGLSS*
Ga0126308_1000461693300010040Serpentine SoilVTIHNRRGGGYWYYWLIIVGGIVFVIAALATDMFGLGSGY*
Ga0126312_10002132153300010041Serpentine SoilMTIHKQRGGRYWYYWLVIIGGSAFVIVALATDMFGLGSSY*
Ga0126312_1002504253300010041Serpentine SoilVTIHKQRGGRYWYYWMAIVGGLVFVIAYYATDGFGLAP*
Ga0126312_1111105223300010041Serpentine SoilVTIHRQRGGRYWYYWVVIIGGIAFVIAYYATDGFGLSG*
Ga0126312_1114610223300010041Serpentine SoilVTIHKRRGGGYWYYWVIIVGGIAFVIAFYATDGFGLSP*
Ga0126314_1080729323300010042Serpentine SoilMTIHRPRGGHYWYYWLVIIGGTIFVIAYYATDGFGLQP*
Ga0126380_1107334113300010043Tropical Forest SoilARRQAEMAIHQPRGGGYWYYWLILVGGIVLVIAYYASDGFGLKP*
Ga0126310_1000156833300010044Serpentine SoilVTIHRQRAGRYWYYWLVILGGIALVVAVLAIDGFGLGY*
Ga0126319_117195223300010147SoilMTIHKQRYGRYWYYWVVIIGVIVFVVAYYASDGFGLQP*
Ga0126306_1008541623300010166Serpentine SoilMTIHRPRGGHYWYYWLVIVGGTIFVIAFYATDGFGLQR*
Ga0134080_1033889413300010333Grasslands SoilMTIHKQRGGTYWYYWVVIIGGTILVVAAYATDMFGLKP*
Ga0134063_1013744823300010335Grasslands SoilMTIHKQRGGRYLYFWVIIVGGTIFVIAAYATDMFGLKP*
Ga0134062_1036703823300010337Grasslands SoilLTIHKSRYGTYWYYWVIMIGGVAFVIAAYATNGFGTGAA*
Ga0134062_1056092223300010337Grasslands SoilMTIHRGRSGAGRYWYYWVVIVGGTAFVIAAYATDMFGLKP*
Ga0134066_1028126323300010364Grasslands SoilAPGQHRQRVTIHRQRGGRYWYYWVVLVGGVLFVVAFYATDGFGLSP*
Ga0134128_1064744733300010373Terrestrial SoilMAIHKRRGGGYWHYWVVIVGGTLFVFAYYLTDGFGLKP*
Ga0136449_10003331423300010379Peatlands SoilMAIHKQRGGRYWYYWVVIIGGTALVIAYYLTNGFGAKP*
Ga0134122_1007577313300010400Terrestrial SoilMTIHKPRGGLYWRYWAVLIGGSAFVIAYLLTDGFGLQP*
Ga0134122_1105912123300010400Terrestrial SoilVTIHKPRGGRYWYYWVLLIGGTIFVIAALATDMFGLGTY*
Ga0105246_1026045933300011119Miscanthus RhizosphereGDPRRPQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP*
Ga0105246_1124578023300011119Miscanthus RhizosphereMAIHRPRGGHYWYYWLVIIGGTVFVIAYYATDGFGLQP*
Ga0137364_1005765423300012198Vadose Zone SoilMTIHKQRGGRYWYFWVIIVGGTIFVIAAYATDMFGLKP*
Ga0137364_1056469723300012198Vadose Zone SoilMAIHRQRGGTYWYYWVIIVGGTILVVAAYATDMFGLKP*
Ga0137365_1025043233300012201Vadose Zone SoilMAIHKQRGGRYWYYWLIIVGGTLFVIAYYATGGFGLKP*
Ga0137365_1039749833300012201Vadose Zone SoilMTIHKQPGGRYWYYWVIIIGGAIFVIAAYATGYFGLKP*
Ga0137365_1040626833300012201Vadose Zone SoilMTIHRRRGGGYWYYWLVIIGGVLFVIAYYATNGFGLAP*
Ga0137374_10005384113300012204Vadose Zone SoilVTIHKRRGGGYWYYSLIIVGGTVFVIAYFATDGFGLSP*
Ga0150985_10240259923300012212Avena Fatua RhizosphereVAIHRPRGGHYWYYWLVIIGGTIFVIAFYATDGFGLQP
Ga0150985_10644341613300012212Avena Fatua RhizosphereMAIHRPRGGHYWHYWLVIVGGTILVVAYYATDGFGLQP*
Ga0137372_1093534523300012350Vadose Zone SoilMAIHKGKSGSGTYWYYWLVIVGGTIFVIAAYATDMFGLKP*
Ga0137369_1005607953300012355Vadose Zone SoilVTIHKRRGGGYWYYWMIIVGGTVFVIAYFATDGFGLSP*
Ga0137371_1084574213300012356Vadose Zone SoilMAIHKQRGGPYWYYWVVIVGGTIFVIAAYATDMFGLRP*
Ga0150984_10412389823300012469Avena Fatua RhizosphereMAIHRPRGGHYRYYWLVIVGGTILVIAYYATDGFGLQP*
Ga0137407_1236113123300012930Vadose Zone SoilGRVMTIHKRRGGGYWYYWVLLLGGTIFVITYIATDGFGMSP*
Ga0153915_1278667323300012931Freshwater WetlandsMAIHKPRGGGYWYYWAIVVGGTIFVIAYFATDGFGLKP*
Ga0126375_1171810713300012948Tropical Forest SoilMAIHRKRGGPYWYYWVVIVGGAIFVIAYYATDGFGLQP*
Ga0164300_1000145553300012951SoilMAIHKQRGGRYWYYWVIIVGGILFVVAYYATDGFGLQP*
Ga0164299_1038565623300012958SoilMAIHRQRGGRYWYYWLVIVGGTIFVIAYYLTDGFGLKP*
Ga0164302_1062118223300012961SoilMTIHPQRGGRYWYYWVVIIGGIVFVVAYFATDGFGLAP*
Ga0164302_1116835313300012961SoilMAIHRPRGGHYWYYWLVIVGGTIFVIAYYATDGFGLQP*
Ga0164308_1084439213300012985SoilPQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP*
Ga0164304_1048986923300012986SoilVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP*
Ga0164307_1026156433300012987SoilVAIHRRRGGGYWYYWLVIVGGTLFVIAYFATDGFGLKP*
Ga0164306_1017002033300012988SoilMAIHKRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLKP*
Ga0164306_1049465423300012988SoilVTIHRQPGGRYWYYWVIIVGGLAFVIAYYVTDGFGLSP*
Ga0164305_1149842723300012989SoilVTIHRQRGGRYWYYWVIIVGGVAFVIAYYATDGFGLSP
Ga0164305_1217717123300012989SoilVAIHRRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLSP*
Ga0157375_10003070153300013308Miscanthus RhizosphereMAIHRQRGGRYWYYWLIIVGGTLFVIAYFASDGFGLQP*
Ga0120158_1026275023300013772PermafrostVTIHRQRFGTYWYYWVIIVGGVIFVIAAYATNGFGTGAT*
Ga0075342_118898713300014320Natural And Restored WetlandsVAIHKRRGGGYWYYWLVIVGGTAFVIAYLVTDGFGLS
Ga0163163_1334683123300014325Switchgrass RhizosphereMAIHKQHGGRYWYYWLIIVAGIIFVIAYYASDGFGLKP*
Ga0157380_1347654123300014326Switchgrass RhizosphereMTIHKQRGGRYWYYWVLIIGGTIFVVAALATDMFGLGS
Ga0167653_100093583300015162Glacier Forefield SoilVTIHRPRYGTYWYYWVIIIGGVAFVVAAYATNGFGTGAV*
Ga0167631_100011243300015168Glacier Forefield SoilMTIHKTRFSGYWHYWLVIVVGIVFVIAYFASDGFGLQP*
Ga0132258_10005487193300015371Arabidopsis RhizosphereMAIHRPRGGGYWYYWLIIVGGIVFVIAYYASDGFGLSP*
Ga0132258_1007205993300015371Arabidopsis RhizosphereMAIHRQRGGRYWCCWLIIVGGTIFVVLALATDMFGLGASP*
Ga0132258_1012801273300015371Arabidopsis RhizosphereMTIHKRRGGQYWYYWLVIVGGSIFVVAYYLTDGFGLQP*
Ga0132258_1082210233300015371Arabidopsis RhizosphereMTIHKPRGGLYWRYWAVLIGGSAFVVAYLLTDGFGLQP*
Ga0132258_1303608623300015371Arabidopsis RhizosphereMAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLRP*
Ga0132258_1346786133300015371Arabidopsis RhizosphereMTIHKQRGGRYWYYWVIIIGGTIFVIAALATDMFGL
Ga0134074_113858623300017657Grasslands SoilMTIHKQRGGRYWYYWVIIVGGTIFVIAAYATDMFGLKP
Ga0187776_1012099123300017966Tropical PeatlandMTIHRQRGGRYWCYWAMLIGGTIFVIAYFATDGFGLTP
Ga0190272_1171223223300018429SoilVIHPQKGGRYWYYWLAIVGGTVFVIAALATDMFGTGG
Ga0190275_1031276823300018432SoilMTIHPQRGGRYWYYWVLLVGGTIFVIAYYATDGFGRT
Ga0190275_1160764223300018432SoilVIHPQRGGRYWYYWAVIIGGTIFVIVALATDMFGTGS
Ga0190275_1171858223300018432SoilMTIHKQRGGTYWYLWLVIVGGTIFVIAALATDMFGLGA
Ga0190275_1332081923300018432SoilVIHPQKGGRYWYYWAIIIGGTIFVIAAYATDMFGTGS
Ga0190268_1099098023300018466SoilVTIHKQRGGRYWYYWVLIIGGTIFVIAALATDMFGLGSGY
Ga0190270_1004480053300018469SoilVTIHKQRGGRYWYYWVLIIGGAIFVIAALATDMFGLGGY
Ga0190270_1008850223300018469SoilVIHPQRGGRYWYYWVLIIGGTIFVVAALATDMFGTGN
Ga0190270_1075058523300018469SoilVIHPQRGGRYWYYWSVIIGGTIFVIVALATDMFGTGS
Ga0190270_1149343023300018469SoilVTIHRRRGGGYWYYWVLLIGGTIFVIAALATDMFGLGSY
Ga0190270_1200182823300018469SoilPTTMTIHKQRGGRYWYYWLLIIGGTIFVIAALATDMFGLGGGY
Ga0190270_1230712623300018469SoilVIHPQRGGRYWYYWVLIVGGTIFVIAALATDMFGTGS
Ga0190271_1005818553300018481SoilVTIHKQRGGRYWYYWVLIVGGIIFVIAALATDMFGLGGY
Ga0190271_1020229923300018481SoilVIHPQKGGRYWYYWVLIVGGTIFVIAALATDMFGTGY
Ga0190271_1047289343300018481SoilVTIHKQRGGRYWYYWLVIIGGTIFVIAALATDMFGLGSS
Ga0190271_1051672133300018481SoilVIHPQKGGRYWYYWVVIIGGAIFVIAALATDMFGLGST
Ga0066669_1005577533300018482Grasslands SoilMTIHKQRGGRYWYFWVIIVGGTIFVIAAYATDMFGLKP
Ga0173479_1039986923300019362SoilMAIHKRRGGGYWYYWVVIVGGALFVIAYYATDGFGLQP
Ga0190264_1032172923300019377SoilMTIHKQRGGRYWYYWVLIIGGTIFVVVALATDMFGLGGGY
Ga0193731_107644123300020001SoilMAIHRQRGGRYWYYWAIIIGGTIFVIAYFASDGFGLQP
Ga0193699_1038609023300021363SoilVAIHKQRGGRYWYYWLVIVGGTLFVIAFYATDGFGLQR
Ga0222622_1074055923300022756Groundwater SedimentMTIHRQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS
Ga0247672_107284923300024187SoilMTIHKPRGGLYWRYWAVLIGGSAFVIAYLLTDGFGLQP
Ga0209817_107602923300025524Arctic Peat SoilMAIHRQRGGRYWYYWVIIIGGTIFVIAYYASDGFGVTP
Ga0209638_107360923300025725Arctic Peat SoilMAIHKQRGGRYWYYWAIIVAGTLFVIAYYATDGFGLTP
Ga0210144_100083343300025817Natural And Restored WetlandsMAIHSPPGGRYWYYWLVVVGGTIFVIAYYLTDGFGLKP
Ga0210144_103644923300025817Natural And Restored WetlandsMAIHRQRGGRYWYYWLVIIGGTAFVIAYLATDGFGLQP
Ga0210144_111003123300025817Natural And Restored WetlandsMAIHNPRGGRYWYYWLVVVGGTVFVIAYYLTDGFGLKP
Ga0207653_1041272923300025885Corn, Switchgrass And Miscanthus RhizosphereMTIHRPRGGHYWRYWLILIGGSAFAVAYLLTDGFGLQP
Ga0207692_1012986823300025898Corn, Switchgrass And Miscanthus RhizosphereMAIHQPRGGGYWYYWLIIVGGTLFVIAYYATDGFGLKP
Ga0207642_100000023983300025899Miscanthus RhizosphereMAIHKPSGGLYWRYWAILIGGSAFVVAYLLTDGFGLQP
Ga0207642_1074922923300025899Miscanthus RhizosphereVTIHRQRGGRYWYYWVIIVGGLAFVIAYYATDGFGLSP
Ga0207710_1072285023300025900Switchgrass RhizosphereMAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGIAR
Ga0207693_1042706923300025915Corn, Switchgrass And Miscanthus RhizosphereVAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP
Ga0207663_1000511873300025916Corn, Switchgrass And Miscanthus RhizosphereMTIHRPRGGHYWRYWAVLIGGTAFVLAYLLTDGFGLQP
Ga0207649_1020100523300025920Corn RhizosphereMAIHRPRGGHYWYYWLVIIGGTILVIAFYATDGFGLQP
Ga0207664_1003059043300025929Agricultural SoilMAIHRRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLKP
Ga0207686_1113315923300025934Miscanthus RhizosphereMAIHRPRGGHYWYYWLVIVGGTILVIAYYATDGFGLQP
Ga0207669_1019855423300025937Miscanthus RhizosphereMAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLQP
Ga0207669_1122970413300025937Miscanthus RhizosphereHKRRGGGYWYYWLLLIGGTIFVIAALLTDGFGTGAGY
Ga0207667_1123958923300025949Corn RhizosphereMTIHKPRGGLYWRYWAVLIAGSAFVIAYLLTDGFGLQP
Ga0207668_1048196933300025972Switchgrass RhizosphereMAIHKQRGGRYWYYWAIIIAGTIFVIAYYATDGFGLTP
Ga0207648_1000064373300026089Miscanthus RhizosphereMTIHKPRGGHYWRYRVVLIGGSAFVVAYLITDGFGLRP
Ga0207683_1050836023300026121Miscanthus RhizosphereMAIHKPRGGLYWRYWAILIGGGAFVIAYLLTDGFGLQP
Ga0209647_1000007333300026319Grasslands SoilMAIHKQRGGRYWYYWLIIVGGTLFVIAYFATDGFGLRP
Ga0209647_106844333300026319Grasslands SoilMAIHKQRGGRYWYYWLIIVGGTLFVIAYYATEGFGLAP
Ga0208525_102144823300027288SoilMAIHRPRGGGYWYYWLIIVAGTVFVIAYFATDGFGLKP
Ga0209887_101546233300027561Groundwater SandVTIHRQRGGRYWYYWVFILGGTVFVIAALATDMFGLG
Ga0209177_1006377523300027775Agricultural SoilMTIHRPRGGHYWRYWVVLIGGSAFVIAYLLTDGFGLRP
Ga0209023_1001439943300027870Freshwater And SedimentMTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLTP
Ga0268264_1002319383300028381Switchgrass RhizosphereMAIHRPRGGHYWRYWLVLIGGGTFVIAYLLTGGFGLQP
Ga0265337_1000034213300028556RhizosphereMAIHKQRGGSYWYYWLIIVGGTIFVIAYFATDGFGLTP
Ga0307291_106391523300028707SoilVTIHKQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS
Ga0307322_1021973823300028710SoilMAIHKPRGGHYWYYWLIILGGTAFVIAFYATDGFGLQP
Ga0307303_1010238713300028713SoilHRQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS
Ga0307297_1034316723300028754SoilMAIHPQRGGRYWYYWVLLIGGTIFVIAYYATDGFGLAV
Ga0307316_1000106733300028755SoilMAIHKQPGGRYWYYWLIIVGGTIFVVAYYASDGFGLAK
Ga0307316_1000661143300028755SoilMTIHRQRGGSYWYYWVVIIGGTAFVIAAFATDMFGMGS
Ga0307280_1024522523300028768SoilMAIHRPRGGHYWYYWLVIIGGTIFVIAYYATDGFGLQP
Ga0307282_1021503623300028784SoilVAIHRQRGGGYWYYWLVIVGGIVFVIAFYATDGFGLQP
Ga0307282_1054591123300028784SoilMAIHKGRSGAGRYWYYWVVIVGGTAFVIAAYATDMFGLKP
Ga0307323_1023558813300028787SoilMAIRKQRGGGYWYYWLVIVGGIAFVIAFYATNGFGLQP
Ga0307299_1010178133300028793SoilMTIHRQRGCRYWYYWVIIIGGTAFVIAAFATDMFGMGS
Ga0307503_10000048353300028802SoilMAIHRPRGGHYWRYWLILIGGSAFVIAYLLTDGFGLQP
Ga0307278_1006899523300028878SoilMTIHKRRGGGYWYYWVLLIGGTIFVIAYLSTDGFGLSP
Ga0307278_1014359443300028878SoilVTIHKQPGGRYWYYWVIIIGGVALLIAYYATRGFGLSP
Ga0311336_1165926523300029990FenMAIHKQRGGRYWYYWLVIVGGTIFVIAYVATDGFGLKQ
Ga0308187_1037207623300031114SoilMTIHRQRGGRYWYYWVVIIGGTAFVIAAFATDMFGMGS
Ga0307495_1012706523300031199SoilMTIHKRRGGPYWYYWLVIIGGTVFVIAYYLTDGFGVKP
Ga0299914_1017962013300031228SoilMTVHKRRGGGYWYYWVFLIGGAIFVIAYLITGGFGLGV
Ga0299914_1078374523300031228SoilMTIHKQRGGRYWYYWVVIIGGIVFVVAALATDMFGLGTY
Ga0299913_1003734833300031229SoilMTIHRQRGGRYWYYWVLIIGGIVFLVAALATDMFGLDYY
Ga0299913_1044548423300031229SoilVTIHRQRGGRYWYYWVLLIGGTIFVIAALATDMFGLGGY
Ga0315553_1004479633300031652Salt Marsh SedimentMAIHKPRRGRYWYYWLVIVGGTLFVIAYIVTDSFGLKP
Ga0307416_10225241813300032002RhizosphereMTIHRQRGGRYWYYWVIIVGGTAFVIAAIATDMFGLGSGY
Ga0311301_10021966123300032160Peatlands SoilMAIHKQRGGRYWYYWVVIIGGTALVIAYYLTNGFGAKP
Ga0307471_10221944623300032180Hardwood Forest SoilMTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSPLASGAT
Ga0326726_1055754823300033433Peat SoilMAIHKRRGGGYWYYWLVIVGGIVFVIAFYATEGFGLQP
Ga0334935_017946_1268_13843300034781BiocrustMTIHKQRGGRYWYYWVLIVGGALFVIAYYATEGFGLAP
Ga0334935_073195_557_6733300034781BiocrustMTIHKQRGGRYWYYWVLIVGGIFFVIAYYATDGFGLAP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.