Basic Information | |
---|---|
Family ID | F022258 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 215 |
Average Sequence Length | 39 residues |
Representative Sequence | MTIHKQRGGRYWYYWLVIVGGTLFVIAYYATDGFGLQP |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 215 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 52.09 % |
% of genes near scaffold ends (potentially truncated) | 11.63 % |
% of genes from short scaffolds (< 2000 bps) | 78.14 % |
Associated GOLD sequencing projects | 146 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (50.233 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.860 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.651 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.512 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.79% β-sheet: 0.00% Coil/Unstructured: 71.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 215 Family Scaffolds |
---|---|---|
PF00480 | ROK | 30.23 |
PF00005 | ABC_tran | 7.91 |
PF14602 | Hexapep_2 | 4.65 |
PF02151 | UVR | 1.86 |
PF12344 | UvrB | 1.40 |
PF01594 | AI-2E_transport | 1.40 |
PF02653 | BPD_transp_2 | 1.40 |
PF02557 | VanY | 0.93 |
PF01842 | ACT | 0.93 |
PF00211 | Guanylate_cyc | 0.93 |
PF10099 | RskA | 0.93 |
PF13191 | AAA_16 | 0.47 |
PF00106 | adh_short | 0.47 |
PF13091 | PLDc_2 | 0.47 |
PF02734 | Dak2 | 0.47 |
PF13561 | adh_short_C2 | 0.47 |
PF13432 | TPR_16 | 0.47 |
PF01869 | BcrAD_BadFG | 0.47 |
PF02261 | Asp_decarbox | 0.47 |
PF13379 | NMT1_2 | 0.47 |
PF00583 | Acetyltransf_1 | 0.47 |
PF02737 | 3HCDH_N | 0.47 |
PF00953 | Glycos_transf_4 | 0.47 |
PF01121 | CoaE | 0.47 |
PF02548 | Pantoate_transf | 0.47 |
PF13556 | HTH_30 | 0.47 |
PF02801 | Ketoacyl-synt_C | 0.47 |
PF13396 | PLDc_N | 0.47 |
PF00264 | Tyrosinase | 0.47 |
PF05834 | Lycopene_cycl | 0.47 |
PF01408 | GFO_IDH_MocA | 0.47 |
PF00664 | ABC_membrane | 0.47 |
PF01894 | UPF0047 | 0.47 |
PF03795 | YCII | 0.47 |
PF01839 | FG-GAP | 0.47 |
PF03972 | MmgE_PrpD | 0.47 |
PF07883 | Cupin_2 | 0.47 |
PF02569 | Pantoate_ligase | 0.47 |
PF02913 | FAD-oxidase_C | 0.47 |
PF01476 | LysM | 0.47 |
COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
---|---|---|---|
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 60.47 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.40 |
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.47 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.47 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.47 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.47 |
COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.47 |
COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.47 |
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.47 |
COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG0853 | Aspartate 1-decarboxylase | Coenzyme transport and metabolism [H] | 0.47 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.47 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.47 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.47 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.47 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.70 % |
Unclassified | root | N/A | 49.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908044|A5_c1_ConsensusfromContig79106 | Not Available | 1437 | Open in IMG/M |
2140918007|ConsensusfromContig58632 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
2170459013|GO6OHWN01D6H3G | Not Available | 522 | Open in IMG/M |
2189573002|GZIGXIF01D1AJX | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 533 | Open in IMG/M |
3300000956|JGI10216J12902_103781859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
3300000956|JGI10216J12902_105898945 | Not Available | 575 | Open in IMG/M |
3300001536|A1565W1_10938541 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300001538|A10PFW1_11241281 | Not Available | 715 | Open in IMG/M |
3300002184|JGI24770J26754_10241218 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300002568|C688J35102_120928563 | Not Available | 2460 | Open in IMG/M |
3300004153|Ga0063455_101433647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300004157|Ga0062590_101974310 | Not Available | 604 | Open in IMG/M |
3300004157|Ga0062590_102773602 | Not Available | 523 | Open in IMG/M |
3300004463|Ga0063356_101580426 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300004479|Ga0062595_101706797 | Not Available | 593 | Open in IMG/M |
3300005356|Ga0070674_100814881 | Not Available | 807 | Open in IMG/M |
3300005536|Ga0070697_101089286 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005563|Ga0068855_101359774 | Not Available | 733 | Open in IMG/M |
3300005564|Ga0070664_100015732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6191 | Open in IMG/M |
3300005587|Ga0066654_10276890 | Not Available | 892 | Open in IMG/M |
3300005718|Ga0068866_10000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 281675 | Open in IMG/M |
3300005718|Ga0068866_10522759 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300005719|Ga0068861_101866926 | Not Available | 597 | Open in IMG/M |
3300005841|Ga0068863_100198922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1927 | Open in IMG/M |
3300005842|Ga0068858_100088454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2882 | Open in IMG/M |
3300005843|Ga0068860_101724799 | Not Available | 648 | Open in IMG/M |
3300005937|Ga0081455_10188131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1558 | Open in IMG/M |
3300005937|Ga0081455_10423012 | Not Available | 918 | Open in IMG/M |
3300005937|Ga0081455_10484038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium yuanmingense | 836 | Open in IMG/M |
3300005985|Ga0081539_10016027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 5391 | Open in IMG/M |
3300006038|Ga0075365_10036183 | Not Available | 3198 | Open in IMG/M |
3300006038|Ga0075365_10159526 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300006038|Ga0075365_10381009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
3300006038|Ga0075365_11043064 | Not Available | 576 | Open in IMG/M |
3300006046|Ga0066652_100014197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5254 | Open in IMG/M |
3300006046|Ga0066652_100366645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1302 | Open in IMG/M |
3300006046|Ga0066652_100382731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1276 | Open in IMG/M |
3300006046|Ga0066652_100510162 | Not Available | 1119 | Open in IMG/M |
3300006046|Ga0066652_100577322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1057 | Open in IMG/M |
3300006092|Ga0082021_1098968 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
3300006173|Ga0070716_100660041 | Not Available | 794 | Open in IMG/M |
3300006173|Ga0070716_100697595 | Not Available | 775 | Open in IMG/M |
3300006175|Ga0070712_100949103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
3300006175|Ga0070712_101068231 | Not Available | 700 | Open in IMG/M |
3300006178|Ga0075367_10523234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
3300006237|Ga0097621_101032544 | Not Available | 770 | Open in IMG/M |
3300006573|Ga0074055_11196743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1128 | Open in IMG/M |
3300006580|Ga0074049_11850886 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300006606|Ga0074062_11634783 | Not Available | 632 | Open in IMG/M |
3300006804|Ga0079221_10913507 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 646 | Open in IMG/M |
3300006806|Ga0079220_10553336 | Not Available | 803 | Open in IMG/M |
3300006854|Ga0075425_101065845 | Not Available | 921 | Open in IMG/M |
3300006871|Ga0075434_100058877 | Not Available | 3818 | Open in IMG/M |
3300006954|Ga0079219_10095903 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300006972|Ga0075518_1052656 | Not Available | 814 | Open in IMG/M |
3300009011|Ga0105251_10240873 | Not Available | 815 | Open in IMG/M |
3300009012|Ga0066710_100225807 | Not Available | 2689 | Open in IMG/M |
3300009012|Ga0066710_102940470 | Not Available | 666 | Open in IMG/M |
3300009137|Ga0066709_103204480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
3300009147|Ga0114129_10617382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1403 | Open in IMG/M |
3300009148|Ga0105243_10687527 | Not Available | 996 | Open in IMG/M |
3300009698|Ga0116216_10345692 | Not Available | 905 | Open in IMG/M |
3300009789|Ga0126307_10266931 | Not Available | 1376 | Open in IMG/M |
3300009818|Ga0105072_1121923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 534 | Open in IMG/M |
3300009840|Ga0126313_11336641 | Not Available | 593 | Open in IMG/M |
3300009840|Ga0126313_11442331 | Not Available | 571 | Open in IMG/M |
3300009840|Ga0126313_11528432 | Not Available | 555 | Open in IMG/M |
3300009840|Ga0126313_11800663 | Not Available | 512 | Open in IMG/M |
3300009868|Ga0130016_10673727 | Not Available | 633 | Open in IMG/M |
3300009870|Ga0131092_10355101 | Not Available | 1391 | Open in IMG/M |
3300009870|Ga0131092_10965130 | Not Available | 693 | Open in IMG/M |
3300010036|Ga0126305_10541048 | Not Available | 779 | Open in IMG/M |
3300010038|Ga0126315_10241371 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300010040|Ga0126308_10004616 | All Organisms → cellular organisms → Bacteria | 6369 | Open in IMG/M |
3300010041|Ga0126312_10002132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13194 | Open in IMG/M |
3300010041|Ga0126312_10025042 | All Organisms → cellular organisms → Bacteria | 3983 | Open in IMG/M |
3300010041|Ga0126312_11111052 | Not Available | 581 | Open in IMG/M |
3300010041|Ga0126312_11146102 | Not Available | 572 | Open in IMG/M |
3300010042|Ga0126314_10807293 | Not Available | 691 | Open in IMG/M |
3300010043|Ga0126380_11073341 | Not Available | 684 | Open in IMG/M |
3300010044|Ga0126310_10001568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8854 | Open in IMG/M |
3300010147|Ga0126319_1171952 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 542 | Open in IMG/M |
3300010166|Ga0126306_10085416 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
3300010333|Ga0134080_10338894 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300010335|Ga0134063_10137448 | Not Available | 1127 | Open in IMG/M |
3300010337|Ga0134062_10367038 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300010337|Ga0134062_10560922 | Not Available | 583 | Open in IMG/M |
3300010364|Ga0134066_10281263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 589 | Open in IMG/M |
3300010373|Ga0134128_10647447 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300010379|Ga0136449_100033314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12334 | Open in IMG/M |
3300010400|Ga0134122_10075773 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
3300010400|Ga0134122_11059121 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 800 | Open in IMG/M |
3300011119|Ga0105246_10260459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1381 | Open in IMG/M |
3300011119|Ga0105246_11245780 | Not Available | 687 | Open in IMG/M |
3300012198|Ga0137364_10057654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2612 | Open in IMG/M |
3300012198|Ga0137364_10564697 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300012201|Ga0137365_10250432 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300012201|Ga0137365_10397498 | Not Available | 1016 | Open in IMG/M |
3300012201|Ga0137365_10406268 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300012204|Ga0137374_10005384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 15211 | Open in IMG/M |
3300012212|Ga0150985_102402599 | Not Available | 618 | Open in IMG/M |
3300012212|Ga0150985_106443416 | Not Available | 641 | Open in IMG/M |
3300012350|Ga0137372_10935345 | Not Available | 611 | Open in IMG/M |
3300012355|Ga0137369_10056079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3416 | Open in IMG/M |
3300012356|Ga0137371_10845742 | Not Available | 696 | Open in IMG/M |
3300012469|Ga0150984_104123898 | Not Available | 563 | Open in IMG/M |
3300012930|Ga0137407_12361131 | Not Available | 508 | Open in IMG/M |
3300012931|Ga0153915_12786673 | Not Available | 571 | Open in IMG/M |
3300012948|Ga0126375_11718107 | Not Available | 545 | Open in IMG/M |
3300012951|Ga0164300_10001455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5515 | Open in IMG/M |
3300012958|Ga0164299_10385656 | Not Available | 895 | Open in IMG/M |
3300012961|Ga0164302_10621182 | Not Available | 787 | Open in IMG/M |
3300012961|Ga0164302_11168353 | Not Available | 613 | Open in IMG/M |
3300012985|Ga0164308_10844392 | Not Available | 802 | Open in IMG/M |
3300012986|Ga0164304_10489869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 895 | Open in IMG/M |
3300012987|Ga0164307_10261564 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300012988|Ga0164306_10170020 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300012988|Ga0164306_10494654 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300012989|Ga0164305_11498427 | Not Available | 598 | Open in IMG/M |
3300012989|Ga0164305_12177171 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300013308|Ga0157375_10003070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 14493 | Open in IMG/M |
3300013772|Ga0120158_10262750 | Not Available | 856 | Open in IMG/M |
3300014320|Ga0075342_1188987 | Not Available | 577 | Open in IMG/M |
3300014325|Ga0163163_13346831 | Not Available | 500 | Open in IMG/M |
3300014326|Ga0157380_13476541 | Not Available | 504 | Open in IMG/M |
3300015162|Ga0167653_1000935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7105 | Open in IMG/M |
3300015168|Ga0167631_1000112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12355 | Open in IMG/M |
3300015371|Ga0132258_10005487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 24874 | Open in IMG/M |
3300015371|Ga0132258_10072059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8016 | Open in IMG/M |
3300015371|Ga0132258_10128012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6050 | Open in IMG/M |
3300015371|Ga0132258_10822102 | All Organisms → cellular organisms → Bacteria | 2343 | Open in IMG/M |
3300015371|Ga0132258_13036086 | Not Available | 1162 | Open in IMG/M |
3300015371|Ga0132258_13467861 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300017657|Ga0134074_1138586 | Not Available | 847 | Open in IMG/M |
3300017966|Ga0187776_10120991 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300018429|Ga0190272_11712232 | Not Available | 651 | Open in IMG/M |
3300018432|Ga0190275_10312768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1545 | Open in IMG/M |
3300018432|Ga0190275_11607642 | Not Available | 728 | Open in IMG/M |
3300018432|Ga0190275_11718582 | Not Available | 706 | Open in IMG/M |
3300018432|Ga0190275_13320819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
3300018466|Ga0190268_10990980 | Not Available | 668 | Open in IMG/M |
3300018469|Ga0190270_10044800 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
3300018469|Ga0190270_10088502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2327 | Open in IMG/M |
3300018469|Ga0190270_10750585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 975 | Open in IMG/M |
3300018469|Ga0190270_11493430 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300018469|Ga0190270_12001828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 637 | Open in IMG/M |
3300018469|Ga0190270_12307126 | Not Available | 599 | Open in IMG/M |
3300018481|Ga0190271_10058185 | All Organisms → cellular organisms → Bacteria | 3339 | Open in IMG/M |
3300018481|Ga0190271_10202299 | Not Available | 1978 | Open in IMG/M |
3300018481|Ga0190271_10472893 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
3300018481|Ga0190271_10516721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1307 | Open in IMG/M |
3300018482|Ga0066669_10055775 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
3300019362|Ga0173479_10399869 | Not Available | 662 | Open in IMG/M |
3300019377|Ga0190264_10321729 | Not Available | 951 | Open in IMG/M |
3300020001|Ga0193731_1076441 | Not Available | 874 | Open in IMG/M |
3300021363|Ga0193699_10386090 | Not Available | 581 | Open in IMG/M |
3300022756|Ga0222622_10740559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. AB025B | 716 | Open in IMG/M |
3300024187|Ga0247672_1072849 | Not Available | 585 | Open in IMG/M |
3300025524|Ga0209817_1076029 | Not Available | 556 | Open in IMG/M |
3300025725|Ga0209638_1073609 | Not Available | 1292 | Open in IMG/M |
3300025817|Ga0210144_1000833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 14135 | Open in IMG/M |
3300025817|Ga0210144_1036449 | Not Available | 1531 | Open in IMG/M |
3300025817|Ga0210144_1110031 | Not Available | 800 | Open in IMG/M |
3300025885|Ga0207653_10412729 | Not Available | 529 | Open in IMG/M |
3300025898|Ga0207692_10129868 | Not Available | 1421 | Open in IMG/M |
3300025899|Ga0207642_10000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 658166 | Open in IMG/M |
3300025899|Ga0207642_10749229 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300025900|Ga0207710_10722850 | Not Available | 523 | Open in IMG/M |
3300025915|Ga0207693_10427069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1036 | Open in IMG/M |
3300025916|Ga0207663_10005118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6590 | Open in IMG/M |
3300025920|Ga0207649_10201005 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
3300025929|Ga0207664_10030590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4113 | Open in IMG/M |
3300025934|Ga0207686_11133159 | Not Available | 639 | Open in IMG/M |
3300025937|Ga0207669_10198554 | Not Available | 1454 | Open in IMG/M |
3300025937|Ga0207669_11229704 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300025949|Ga0207667_11239589 | Not Available | 724 | Open in IMG/M |
3300025972|Ga0207668_10481969 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300026089|Ga0207648_10000643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 39180 | Open in IMG/M |
3300026121|Ga0207683_10508360 | Not Available | 1113 | Open in IMG/M |
3300026319|Ga0209647_1000007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 229181 | Open in IMG/M |
3300026319|Ga0209647_1068443 | Not Available | 1809 | Open in IMG/M |
3300027288|Ga0208525_1021448 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300027561|Ga0209887_1015462 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
3300027775|Ga0209177_10063775 | Not Available | 1081 | Open in IMG/M |
3300027870|Ga0209023_10014399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7165 | Open in IMG/M |
3300028381|Ga0268264_10023193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5064 | Open in IMG/M |
3300028556|Ga0265337_1000034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 60151 | Open in IMG/M |
3300028707|Ga0307291_1063915 | Not Available | 897 | Open in IMG/M |
3300028710|Ga0307322_10219738 | Not Available | 522 | Open in IMG/M |
3300028713|Ga0307303_10102387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
3300028754|Ga0307297_10343167 | Not Available | 545 | Open in IMG/M |
3300028755|Ga0307316_10001067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8564 | Open in IMG/M |
3300028755|Ga0307316_10006611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3575 | Open in IMG/M |
3300028768|Ga0307280_10245225 | Not Available | 643 | Open in IMG/M |
3300028784|Ga0307282_10215036 | Not Available | 920 | Open in IMG/M |
3300028784|Ga0307282_10545911 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300028787|Ga0307323_10235588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
3300028793|Ga0307299_10101781 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300028802|Ga0307503_10000048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 81515 | Open in IMG/M |
3300028878|Ga0307278_10068995 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
3300028878|Ga0307278_10143594 | Not Available | 1070 | Open in IMG/M |
3300029990|Ga0311336_11659265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 564 | Open in IMG/M |
3300031114|Ga0308187_10372076 | Not Available | 557 | Open in IMG/M |
3300031199|Ga0307495_10127065 | Not Available | 635 | Open in IMG/M |
3300031228|Ga0299914_10179620 | Not Available | 1878 | Open in IMG/M |
3300031228|Ga0299914_10783745 | Not Available | 796 | Open in IMG/M |
3300031229|Ga0299913_10037348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4599 | Open in IMG/M |
3300031229|Ga0299913_10445484 | Not Available | 1282 | Open in IMG/M |
3300031652|Ga0315553_10044796 | Not Available | 2526 | Open in IMG/M |
3300032002|Ga0307416_102252418 | Not Available | 646 | Open in IMG/M |
3300032160|Ga0311301_10021966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17783 | Open in IMG/M |
3300032180|Ga0307471_102219446 | Not Available | 692 | Open in IMG/M |
3300033433|Ga0326726_10557548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1099 | Open in IMG/M |
3300034781|Ga0334935_017946 | Not Available | 1843 | Open in IMG/M |
3300034781|Ga0334935_073195 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.86% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.98% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.33% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.86% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.86% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.86% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.40% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.40% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.40% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.40% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.40% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.40% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.93% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.93% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.47% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.47% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.47% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.47% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.47% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.47% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.47% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.47% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.47% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.47% |
Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300002184 | Freshwater and sediment microbial communities from Lake Erie, Canada | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006972 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300025524 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025817 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031652 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034781 | Biocrust microbial communities from Mojave Desert, California, United States - 31SMC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A5_c1_00017160 | 2124908044 | Soil | MAIHRQRGGRYWHYWAIIIGGTIFVIAYYASDGFGVTP |
A_all_C_02099150 | 2140918007 | Soil | PSARRRQELTLAIHRQRGGRYWHYWAIIIGGTIFVIAYYASDGFGVTP |
N57_01892450 | 2170459013 | Grass Soil | MAIHKGRSGAGTYWYYWLVIVGGTIFVIAAYATDMFGLKP |
FE1_07396270 | 2189573002 | Grass Soil | MTIHKQRGGRYWYYWLVIVGGTLFVIAYYATDGFGLQP |
JGI10216J12902_1037818592 | 3300000956 | Soil | VIHPQKGGRYWYYWVVIVGGTIFVIAALATDMFGTGP* |
JGI10216J12902_1058989451 | 3300000956 | Soil | PQRGGRYWYYWAVIIGGTIFVIVALATDMFGTGS* |
A1565W1_109385413 | 3300001536 | Permafrost | MTIHKRRGGGYWYYWVLLIGGTIFVIAYFSTDGFGLSP* |
A10PFW1_112412812 | 3300001538 | Permafrost | MTIHKRRGGGYWYYWVLLIGGTTFVIAYFSTDGFGLSP* |
JGI24770J26754_102412182 | 3300002184 | Freshwater And Sediment | MTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLTP* |
C688J35102_1209285632 | 3300002568 | Soil | MAIHKGRSGSGTYWYYWLVIVGGTIFVIAALATDMFGLKP* |
Ga0063455_1014336472 | 3300004153 | Soil | LTIHKSRYGTYWYYWVIIIGGVAFVIAAYATNGFGTGAA* |
Ga0062590_1019743101 | 3300004157 | Soil | RLTVAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP* |
Ga0062590_1027736021 | 3300004157 | Soil | VTIHKQRGGRYWYYWVIIIGGTIFVVAALATDMFGLGSGY* |
Ga0063356_1015804262 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAA* |
Ga0062595_1017067971 | 3300004479 | Soil | VTIHRQRGGRYWYYWVIIIGGTIFVVAALATDMFGLGSGY* |
Ga0070674_1008148811 | 3300005356 | Miscanthus Rhizosphere | PRSRAEMAIHRPRGGHYWYYWLIIVGGTIFVIAYYATDGFGLQP* |
Ga0070697_1010892861 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RGDRRAPTGGRPGMTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP* |
Ga0068855_1013597742 | 3300005563 | Corn Rhizosphere | MTIHKPRGGLYWRYWAVLIAGSAFVIAYLLTDGFGLQP* |
Ga0070664_1000157326 | 3300005564 | Corn Rhizosphere | MAIHRPRGGHYWYYWLVIIGGTILVIAFYATDGFGLQP* |
Ga0066654_102768902 | 3300005587 | Soil | MAIHKGRSGAGTYWYYWLVIVGGTIFVIAAYATDMFGLKP* |
Ga0068866_10000003146 | 3300005718 | Miscanthus Rhizosphere | MAIHKPSGGLYWRYWAILIGGSAFVVAYLLTDGFGLQP* |
Ga0068866_105227592 | 3300005718 | Miscanthus Rhizosphere | VTIHRQRGGRYWYYWVIIVGGLAFVIAYYATDGFGLSP* |
Ga0068861_1018669262 | 3300005719 | Switchgrass Rhizosphere | MTIHKPRGGHYWRYRVVLIGGSAFVVAYLITDGFGLRP* |
Ga0068863_1001989223 | 3300005841 | Switchgrass Rhizosphere | MAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGISR* |
Ga0068858_1000884544 | 3300005842 | Switchgrass Rhizosphere | MAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGIAR* |
Ga0068860_1017247992 | 3300005843 | Switchgrass Rhizosphere | MAIHRPRGGHYWRYWLVLIGGGTFVIAYLLTGGFGLQP* |
Ga0081455_101881313 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTIHKQRGGRYWYYWLVIIGGTIFVIAAVATDMFGLGGSY* |
Ga0081455_104230122 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTIHRQRGGRYWYYWVIIIGGTAFVIAAIATDMFGLGGGY* |
Ga0081455_104840382 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTIHKQRGGRYWYYWVLIIGGAIFVIAALATDMFGLGGY* |
Ga0081539_100160272 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTTHKQRGGRYWYYWVVIVGGTLFVIAYFASDGFGLGS* |
Ga0075365_100361833 | 3300006038 | Populus Endosphere | VAIHPQRGGRYWYYWVLIVGGLVFVIAYYATDGFGLG* |
Ga0075365_101595262 | 3300006038 | Populus Endosphere | MTIHKRRLDGYWHYWVIIVGGVLFVIAYYATDGFGLA* |
Ga0075365_103810092 | 3300006038 | Populus Endosphere | MTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLAP* |
Ga0075365_110430642 | 3300006038 | Populus Endosphere | MAIHPQRGGRYWYYWVLIVGGLVFVIAYYATDGFGLG* |
Ga0066652_1000141974 | 3300006046 | Soil | VTIHRQRGGRYWYYWVVLVGGVLFVVAFYATDGFGLSP* |
Ga0066652_1003666452 | 3300006046 | Soil | VTIHAQRGGRYWHYWVIIVGGLAFVIAAYATDGFGTGAV* |
Ga0066652_1003827312 | 3300006046 | Soil | MTIHKQRGGRYWYYWVIIVGGTIFVIAAYATDMFGLKP* |
Ga0066652_1005101622 | 3300006046 | Soil | MAIHRQRGGTYWYYWLIIVGGTILVIAAYATDMFGLQP* |
Ga0066652_1005773222 | 3300006046 | Soil | VTIHNQRGGRYWYYWAVIVGGLVFVAAYYASDGFGLSP* |
Ga0082021_10989682 | 3300006092 | Wastewater Treatment Plant | MAIHPQRGGRYWYYWVLIVGGAIFVIAYYATDGFGLAA* |
Ga0070716_1006600412 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIHKQRGGRYWYYWLIIVGGILFVVAYYASDGFGLKP* |
Ga0070716_1006975952 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AGQRLTMAIHRPRGGHYWRYWLVLIGGSAFVIAYLLTDGFGLQP* |
Ga0070712_1009491032 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PRRPQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP* |
Ga0070712_1010682312 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP* |
Ga0075367_105232342 | 3300006178 | Populus Endosphere | MTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP* |
Ga0097621_1010325442 | 3300006237 | Miscanthus Rhizosphere | MAIHRPRGGHYWYYWLIIVGGTIFVIAYYATDGFGLQP* |
Ga0074055_111967432 | 3300006573 | Soil | MAIHKQRGGRYWYYWLIIVGGIVFVIAYYASGGFGLRP* |
Ga0074049_118508862 | 3300006580 | Soil | VAIHKRRGGGYWYYWLVIVAGTIFVVAFYATDGFGLRP* |
Ga0074062_116347832 | 3300006606 | Soil | VAIHKRRGGGYWYYWLVIVAGTIFVIAFYATDGFGLRR* |
Ga0079221_109135072 | 3300006804 | Agricultural Soil | HRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSP* |
Ga0079220_105533362 | 3300006806 | Agricultural Soil | VAIHKRRGGGYWYYWLVIVGGILFVIAYYATDGFGLKP* |
Ga0075425_1010658453 | 3300006854 | Populus Rhizosphere | MTIHRQRGGRYWYYWVVIFGGIAFVIAYFATDGFGLAP* |
Ga0075434_1000588773 | 3300006871 | Populus Rhizosphere | MTIHRQRGGRYWYYWVIIVGGIAFVVAYYATDGFGLSP* |
Ga0079219_100959032 | 3300006954 | Agricultural Soil | MTIHRPRGGHYWRYWVVLIGGSAFVIAYLLTDGFGLRP* |
Ga0075518_10526562 | 3300006972 | Arctic Peat Soil | MAIHRQRGGRYWYYWVIIIGGTIFVIAYYASDGFGVTP* |
Ga0105251_102408732 | 3300009011 | Switchgrass Rhizosphere | AIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGISR* |
Ga0066710_1002258072 | 3300009012 | Grasslands Soil | VTIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAV |
Ga0066710_1029404702 | 3300009012 | Grasslands Soil | MTIHKQPGGSYWYYWVVIIGGIVFVVAYFATDGFGLAP |
Ga0066709_1032044802 | 3300009137 | Grasslands Soil | TIHRQRGGRYWYYWVIIVGGLAFVIAAYATDGFGTGAV* |
Ga0114129_106173822 | 3300009147 | Populus Rhizosphere | MTVHRQRGGRYWYYWVIILGGIAFVIAYYATDGFGLSP* |
Ga0105243_106875272 | 3300009148 | Miscanthus Rhizosphere | MAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLQP* |
Ga0116216_103456921 | 3300009698 | Peatlands Soil | MAIHKQRGGRYWYYWVVIIGGAALVIAYYLTNGFGAKP* |
Ga0126307_102669312 | 3300009789 | Serpentine Soil | MTIHRPRGGHYWYYWLVIVGGSVFVIAFYATDGFGLQP* |
Ga0105072_11219232 | 3300009818 | Groundwater Sand | VTIHRQRGGRYWYYWVFILGGTVFVIAALATDMFGLG* |
Ga0126313_113366412 | 3300009840 | Serpentine Soil | MTIHKQPGGRYWYYWAIILGGIAFAVAFYATDGFGLSP* |
Ga0126313_114423312 | 3300009840 | Serpentine Soil | MTIHKRRGGGYWYYWLVIVGGALFVIAYYATDGFGLQP* |
Ga0126313_115284321 | 3300009840 | Serpentine Soil | MAIHDQRGGRYWYYWLIIVGGTIFVIAYYASDGFGLGQ* |
Ga0126313_118006632 | 3300009840 | Serpentine Soil | MTIHRPRGGHYWYYWLVIVGGVVFVIAFYATDGFGLQP* |
Ga0130016_106737271 | 3300009868 | Wastewater | MTIHRQRGGRYWYYWVVIIGGLVLAIAFYATDGFGLAP* |
Ga0131092_103551012 | 3300009870 | Activated Sludge | MAIHRQRGGRYWYYWAIIIGGTIFVVVALATDMFGLGSGY* |
Ga0131092_109651301 | 3300009870 | Activated Sludge | MTIHRQRGGRYWYYWVVIIGGLAFAIAFYATDGFGLAT* |
Ga0126305_105410482 | 3300010036 | Serpentine Soil | MTIHRPRGGHYWYYWLVIVGGTIFVIAFYATDGFGLQP* |
Ga0126315_102413712 | 3300010038 | Serpentine Soil | VTIHKRRGGGYWYYWVIIIGGTALVIAYIATDGFGLSS* |
Ga0126308_100046169 | 3300010040 | Serpentine Soil | VTIHNRRGGGYWYYWLIIVGGIVFVIAALATDMFGLGSGY* |
Ga0126312_1000213215 | 3300010041 | Serpentine Soil | MTIHKQRGGRYWYYWLVIIGGSAFVIVALATDMFGLGSSY* |
Ga0126312_100250425 | 3300010041 | Serpentine Soil | VTIHKQRGGRYWYYWMAIVGGLVFVIAYYATDGFGLAP* |
Ga0126312_111110522 | 3300010041 | Serpentine Soil | VTIHRQRGGRYWYYWVVIIGGIAFVIAYYATDGFGLSG* |
Ga0126312_111461022 | 3300010041 | Serpentine Soil | VTIHKRRGGGYWYYWVIIVGGIAFVIAFYATDGFGLSP* |
Ga0126314_108072932 | 3300010042 | Serpentine Soil | MTIHRPRGGHYWYYWLVIIGGTIFVIAYYATDGFGLQP* |
Ga0126380_110733411 | 3300010043 | Tropical Forest Soil | ARRQAEMAIHQPRGGGYWYYWLILVGGIVLVIAYYASDGFGLKP* |
Ga0126310_100015683 | 3300010044 | Serpentine Soil | VTIHRQRAGRYWYYWLVILGGIALVVAVLAIDGFGLGY* |
Ga0126319_11719522 | 3300010147 | Soil | MTIHKQRYGRYWYYWVVIIGVIVFVVAYYASDGFGLQP* |
Ga0126306_100854162 | 3300010166 | Serpentine Soil | MTIHRPRGGHYWYYWLVIVGGTIFVIAFYATDGFGLQR* |
Ga0134080_103388941 | 3300010333 | Grasslands Soil | MTIHKQRGGTYWYYWVVIIGGTILVVAAYATDMFGLKP* |
Ga0134063_101374482 | 3300010335 | Grasslands Soil | MTIHKQRGGRYLYFWVIIVGGTIFVIAAYATDMFGLKP* |
Ga0134062_103670382 | 3300010337 | Grasslands Soil | LTIHKSRYGTYWYYWVIMIGGVAFVIAAYATNGFGTGAA* |
Ga0134062_105609222 | 3300010337 | Grasslands Soil | MTIHRGRSGAGRYWYYWVVIVGGTAFVIAAYATDMFGLKP* |
Ga0134066_102812632 | 3300010364 | Grasslands Soil | APGQHRQRVTIHRQRGGRYWYYWVVLVGGVLFVVAFYATDGFGLSP* |
Ga0134128_106474473 | 3300010373 | Terrestrial Soil | MAIHKRRGGGYWHYWVVIVGGTLFVFAYYLTDGFGLKP* |
Ga0136449_1000333142 | 3300010379 | Peatlands Soil | MAIHKQRGGRYWYYWVVIIGGTALVIAYYLTNGFGAKP* |
Ga0134122_100757731 | 3300010400 | Terrestrial Soil | MTIHKPRGGLYWRYWAVLIGGSAFVIAYLLTDGFGLQP* |
Ga0134122_110591212 | 3300010400 | Terrestrial Soil | VTIHKPRGGRYWYYWVLLIGGTIFVIAALATDMFGLGTY* |
Ga0105246_102604593 | 3300011119 | Miscanthus Rhizosphere | GDPRRPQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP* |
Ga0105246_112457802 | 3300011119 | Miscanthus Rhizosphere | MAIHRPRGGHYWYYWLVIIGGTVFVIAYYATDGFGLQP* |
Ga0137364_100576542 | 3300012198 | Vadose Zone Soil | MTIHKQRGGRYWYFWVIIVGGTIFVIAAYATDMFGLKP* |
Ga0137364_105646972 | 3300012198 | Vadose Zone Soil | MAIHRQRGGTYWYYWVIIVGGTILVVAAYATDMFGLKP* |
Ga0137365_102504323 | 3300012201 | Vadose Zone Soil | MAIHKQRGGRYWYYWLIIVGGTLFVIAYYATGGFGLKP* |
Ga0137365_103974983 | 3300012201 | Vadose Zone Soil | MTIHKQPGGRYWYYWVIIIGGAIFVIAAYATGYFGLKP* |
Ga0137365_104062683 | 3300012201 | Vadose Zone Soil | MTIHRRRGGGYWYYWLVIIGGVLFVIAYYATNGFGLAP* |
Ga0137374_1000538411 | 3300012204 | Vadose Zone Soil | VTIHKRRGGGYWYYSLIIVGGTVFVIAYFATDGFGLSP* |
Ga0150985_1024025992 | 3300012212 | Avena Fatua Rhizosphere | VAIHRPRGGHYWYYWLVIIGGTIFVIAFYATDGFGLQP |
Ga0150985_1064434161 | 3300012212 | Avena Fatua Rhizosphere | MAIHRPRGGHYWHYWLVIVGGTILVVAYYATDGFGLQP* |
Ga0137372_109353452 | 3300012350 | Vadose Zone Soil | MAIHKGKSGSGTYWYYWLVIVGGTIFVIAAYATDMFGLKP* |
Ga0137369_100560795 | 3300012355 | Vadose Zone Soil | VTIHKRRGGGYWYYWMIIVGGTVFVIAYFATDGFGLSP* |
Ga0137371_108457421 | 3300012356 | Vadose Zone Soil | MAIHKQRGGPYWYYWVVIVGGTIFVIAAYATDMFGLRP* |
Ga0150984_1041238982 | 3300012469 | Avena Fatua Rhizosphere | MAIHRPRGGHYRYYWLVIVGGTILVIAYYATDGFGLQP* |
Ga0137407_123611312 | 3300012930 | Vadose Zone Soil | GRVMTIHKRRGGGYWYYWVLLLGGTIFVITYIATDGFGMSP* |
Ga0153915_127866732 | 3300012931 | Freshwater Wetlands | MAIHKPRGGGYWYYWAIVVGGTIFVIAYFATDGFGLKP* |
Ga0126375_117181071 | 3300012948 | Tropical Forest Soil | MAIHRKRGGPYWYYWVVIVGGAIFVIAYYATDGFGLQP* |
Ga0164300_100014555 | 3300012951 | Soil | MAIHKQRGGRYWYYWVIIVGGILFVVAYYATDGFGLQP* |
Ga0164299_103856562 | 3300012958 | Soil | MAIHRQRGGRYWYYWLVIVGGTIFVIAYYLTDGFGLKP* |
Ga0164302_106211822 | 3300012961 | Soil | MTIHPQRGGRYWYYWVVIIGGIVFVVAYFATDGFGLAP* |
Ga0164302_111683531 | 3300012961 | Soil | MAIHRPRGGHYWYYWLVIVGGTIFVIAYYATDGFGLQP* |
Ga0164308_108443921 | 3300012985 | Soil | PQPEPEVAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP* |
Ga0164304_104898692 | 3300012986 | Soil | VAIHRRRGGGYWYYWLVIVGGTLFVIAFYATDGFGLKP* |
Ga0164307_102615643 | 3300012987 | Soil | VAIHRRRGGGYWYYWLVIVGGTLFVIAYFATDGFGLKP* |
Ga0164306_101700203 | 3300012988 | Soil | MAIHKRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLKP* |
Ga0164306_104946542 | 3300012988 | Soil | VTIHRQPGGRYWYYWVIIVGGLAFVIAYYVTDGFGLSP* |
Ga0164305_114984272 | 3300012989 | Soil | VTIHRQRGGRYWYYWVIIVGGVAFVIAYYATDGFGLSP |
Ga0164305_121771712 | 3300012989 | Soil | VAIHRRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLSP* |
Ga0157375_1000307015 | 3300013308 | Miscanthus Rhizosphere | MAIHRQRGGRYWYYWLIIVGGTLFVIAYFASDGFGLQP* |
Ga0120158_102627502 | 3300013772 | Permafrost | VTIHRQRFGTYWYYWVIIVGGVIFVIAAYATNGFGTGAT* |
Ga0075342_11889871 | 3300014320 | Natural And Restored Wetlands | VAIHKRRGGGYWYYWLVIVGGTAFVIAYLVTDGFGLS |
Ga0163163_133468312 | 3300014325 | Switchgrass Rhizosphere | MAIHKQHGGRYWYYWLIIVAGIIFVIAYYASDGFGLKP* |
Ga0157380_134765412 | 3300014326 | Switchgrass Rhizosphere | MTIHKQRGGRYWYYWVLIIGGTIFVVAALATDMFGLGS |
Ga0167653_10009358 | 3300015162 | Glacier Forefield Soil | VTIHRPRYGTYWYYWVIIIGGVAFVVAAYATNGFGTGAV* |
Ga0167631_10001124 | 3300015168 | Glacier Forefield Soil | MTIHKTRFSGYWHYWLVIVVGIVFVIAYFASDGFGLQP* |
Ga0132258_1000548719 | 3300015371 | Arabidopsis Rhizosphere | MAIHRPRGGGYWYYWLIIVGGIVFVIAYYASDGFGLSP* |
Ga0132258_100720599 | 3300015371 | Arabidopsis Rhizosphere | MAIHRQRGGRYWCCWLIIVGGTIFVVLALATDMFGLGASP* |
Ga0132258_101280127 | 3300015371 | Arabidopsis Rhizosphere | MTIHKRRGGQYWYYWLVIVGGSIFVVAYYLTDGFGLQP* |
Ga0132258_108221023 | 3300015371 | Arabidopsis Rhizosphere | MTIHKPRGGLYWRYWAVLIGGSAFVVAYLLTDGFGLQP* |
Ga0132258_130360862 | 3300015371 | Arabidopsis Rhizosphere | MAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLRP* |
Ga0132258_134678613 | 3300015371 | Arabidopsis Rhizosphere | MTIHKQRGGRYWYYWVIIIGGTIFVIAALATDMFGL |
Ga0134074_11385862 | 3300017657 | Grasslands Soil | MTIHKQRGGRYWYYWVIIVGGTIFVIAAYATDMFGLKP |
Ga0187776_101209912 | 3300017966 | Tropical Peatland | MTIHRQRGGRYWCYWAMLIGGTIFVIAYFATDGFGLTP |
Ga0190272_117122322 | 3300018429 | Soil | VIHPQKGGRYWYYWLAIVGGTVFVIAALATDMFGTGG |
Ga0190275_103127682 | 3300018432 | Soil | MTIHPQRGGRYWYYWVLLVGGTIFVIAYYATDGFGRT |
Ga0190275_116076422 | 3300018432 | Soil | VIHPQRGGRYWYYWAVIIGGTIFVIVALATDMFGTGS |
Ga0190275_117185822 | 3300018432 | Soil | MTIHKQRGGTYWYLWLVIVGGTIFVIAALATDMFGLGA |
Ga0190275_133208192 | 3300018432 | Soil | VIHPQKGGRYWYYWAIIIGGTIFVIAAYATDMFGTGS |
Ga0190268_109909802 | 3300018466 | Soil | VTIHKQRGGRYWYYWVLIIGGTIFVIAALATDMFGLGSGY |
Ga0190270_100448005 | 3300018469 | Soil | VTIHKQRGGRYWYYWVLIIGGAIFVIAALATDMFGLGGY |
Ga0190270_100885022 | 3300018469 | Soil | VIHPQRGGRYWYYWVLIIGGTIFVVAALATDMFGTGN |
Ga0190270_107505852 | 3300018469 | Soil | VIHPQRGGRYWYYWSVIIGGTIFVIVALATDMFGTGS |
Ga0190270_114934302 | 3300018469 | Soil | VTIHRRRGGGYWYYWVLLIGGTIFVIAALATDMFGLGSY |
Ga0190270_120018282 | 3300018469 | Soil | PTTMTIHKQRGGRYWYYWLLIIGGTIFVIAALATDMFGLGGGY |
Ga0190270_123071262 | 3300018469 | Soil | VIHPQRGGRYWYYWVLIVGGTIFVIAALATDMFGTGS |
Ga0190271_100581855 | 3300018481 | Soil | VTIHKQRGGRYWYYWVLIVGGIIFVIAALATDMFGLGGY |
Ga0190271_102022992 | 3300018481 | Soil | VIHPQKGGRYWYYWVLIVGGTIFVIAALATDMFGTGY |
Ga0190271_104728934 | 3300018481 | Soil | VTIHKQRGGRYWYYWLVIIGGTIFVIAALATDMFGLGSS |
Ga0190271_105167213 | 3300018481 | Soil | VIHPQKGGRYWYYWVVIIGGAIFVIAALATDMFGLGST |
Ga0066669_100557753 | 3300018482 | Grasslands Soil | MTIHKQRGGRYWYFWVIIVGGTIFVIAAYATDMFGLKP |
Ga0173479_103998692 | 3300019362 | Soil | MAIHKRRGGGYWYYWVVIVGGALFVIAYYATDGFGLQP |
Ga0190264_103217292 | 3300019377 | Soil | MTIHKQRGGRYWYYWVLIIGGTIFVVVALATDMFGLGGGY |
Ga0193731_10764412 | 3300020001 | Soil | MAIHRQRGGRYWYYWAIIIGGTIFVIAYFASDGFGLQP |
Ga0193699_103860902 | 3300021363 | Soil | VAIHKQRGGRYWYYWLVIVGGTLFVIAFYATDGFGLQR |
Ga0222622_107405592 | 3300022756 | Groundwater Sediment | MTIHRQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS |
Ga0247672_10728492 | 3300024187 | Soil | MTIHKPRGGLYWRYWAVLIGGSAFVIAYLLTDGFGLQP |
Ga0209817_10760292 | 3300025524 | Arctic Peat Soil | MAIHRQRGGRYWYYWVIIIGGTIFVIAYYASDGFGVTP |
Ga0209638_10736092 | 3300025725 | Arctic Peat Soil | MAIHKQRGGRYWYYWAIIVAGTLFVIAYYATDGFGLTP |
Ga0210144_10008334 | 3300025817 | Natural And Restored Wetlands | MAIHSPPGGRYWYYWLVVVGGTIFVIAYYLTDGFGLKP |
Ga0210144_10364492 | 3300025817 | Natural And Restored Wetlands | MAIHRQRGGRYWYYWLVIIGGTAFVIAYLATDGFGLQP |
Ga0210144_11100312 | 3300025817 | Natural And Restored Wetlands | MAIHNPRGGRYWYYWLVVVGGTVFVIAYYLTDGFGLKP |
Ga0207653_104127292 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIHRPRGGHYWRYWLILIGGSAFAVAYLLTDGFGLQP |
Ga0207692_101298682 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIHQPRGGGYWYYWLIIVGGTLFVIAYYATDGFGLKP |
Ga0207642_10000002398 | 3300025899 | Miscanthus Rhizosphere | MAIHKPSGGLYWRYWAILIGGSAFVVAYLLTDGFGLQP |
Ga0207642_107492292 | 3300025899 | Miscanthus Rhizosphere | VTIHRQRGGRYWYYWVIIVGGLAFVIAYYATDGFGLSP |
Ga0207710_107228502 | 3300025900 | Switchgrass Rhizosphere | MAIHKQRGGRYWYYWAIIVGGTIFVIAFYASDGFGIAR |
Ga0207693_104270692 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIHKQRGGRYWYYWLIVVGGTLFVIAYYATDGFGLKP |
Ga0207663_100051187 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIHRPRGGHYWRYWAVLIGGTAFVLAYLLTDGFGLQP |
Ga0207649_102010052 | 3300025920 | Corn Rhizosphere | MAIHRPRGGHYWYYWLVIIGGTILVIAFYATDGFGLQP |
Ga0207664_100305904 | 3300025929 | Agricultural Soil | MAIHRRRGGGYWYYWLVIVGGTLFVIAYYATDGFGLKP |
Ga0207686_111331592 | 3300025934 | Miscanthus Rhizosphere | MAIHRPRGGHYWYYWLVIVGGTILVIAYYATDGFGLQP |
Ga0207669_101985542 | 3300025937 | Miscanthus Rhizosphere | MAIHRPRGGHYWYYWLVIIGGTILVIAYYATDGFGLQP |
Ga0207669_112297041 | 3300025937 | Miscanthus Rhizosphere | HKRRGGGYWYYWLLLIGGTIFVIAALLTDGFGTGAGY |
Ga0207667_112395892 | 3300025949 | Corn Rhizosphere | MTIHKPRGGLYWRYWAVLIAGSAFVIAYLLTDGFGLQP |
Ga0207668_104819693 | 3300025972 | Switchgrass Rhizosphere | MAIHKQRGGRYWYYWAIIIAGTIFVIAYYATDGFGLTP |
Ga0207648_100006437 | 3300026089 | Miscanthus Rhizosphere | MTIHKPRGGHYWRYRVVLIGGSAFVVAYLITDGFGLRP |
Ga0207683_105083602 | 3300026121 | Miscanthus Rhizosphere | MAIHKPRGGLYWRYWAILIGGGAFVIAYLLTDGFGLQP |
Ga0209647_100000733 | 3300026319 | Grasslands Soil | MAIHKQRGGRYWYYWLIIVGGTLFVIAYFATDGFGLRP |
Ga0209647_10684433 | 3300026319 | Grasslands Soil | MAIHKQRGGRYWYYWLIIVGGTLFVIAYYATEGFGLAP |
Ga0208525_10214482 | 3300027288 | Soil | MAIHRPRGGGYWYYWLIIVAGTVFVIAYFATDGFGLKP |
Ga0209887_10154623 | 3300027561 | Groundwater Sand | VTIHRQRGGRYWYYWVFILGGTVFVIAALATDMFGLG |
Ga0209177_100637752 | 3300027775 | Agricultural Soil | MTIHRPRGGHYWRYWVVLIGGSAFVIAYLLTDGFGLRP |
Ga0209023_100143994 | 3300027870 | Freshwater And Sediment | MTIHPQRGGRYWYYWVLIVGGIAFVIAYYLTDGFGLTP |
Ga0268264_100231938 | 3300028381 | Switchgrass Rhizosphere | MAIHRPRGGHYWRYWLVLIGGGTFVIAYLLTGGFGLQP |
Ga0265337_100003421 | 3300028556 | Rhizosphere | MAIHKQRGGSYWYYWLIIVGGTIFVIAYFATDGFGLTP |
Ga0307291_10639152 | 3300028707 | Soil | VTIHKQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS |
Ga0307322_102197382 | 3300028710 | Soil | MAIHKPRGGHYWYYWLIILGGTAFVIAFYATDGFGLQP |
Ga0307303_101023871 | 3300028713 | Soil | HRQRGGRYWYYWVVIVGGIIFVIAYFASDGFGLGS |
Ga0307297_103431672 | 3300028754 | Soil | MAIHPQRGGRYWYYWVLLIGGTIFVIAYYATDGFGLAV |
Ga0307316_100010673 | 3300028755 | Soil | MAIHKQPGGRYWYYWLIIVGGTIFVVAYYASDGFGLAK |
Ga0307316_100066114 | 3300028755 | Soil | MTIHRQRGGSYWYYWVVIIGGTAFVIAAFATDMFGMGS |
Ga0307280_102452252 | 3300028768 | Soil | MAIHRPRGGHYWYYWLVIIGGTIFVIAYYATDGFGLQP |
Ga0307282_102150362 | 3300028784 | Soil | VAIHRQRGGGYWYYWLVIVGGIVFVIAFYATDGFGLQP |
Ga0307282_105459112 | 3300028784 | Soil | MAIHKGRSGAGRYWYYWVVIVGGTAFVIAAYATDMFGLKP |
Ga0307323_102355881 | 3300028787 | Soil | MAIRKQRGGGYWYYWLVIVGGIAFVIAFYATNGFGLQP |
Ga0307299_101017813 | 3300028793 | Soil | MTIHRQRGCRYWYYWVIIIGGTAFVIAAFATDMFGMGS |
Ga0307503_1000004835 | 3300028802 | Soil | MAIHRPRGGHYWRYWLILIGGSAFVIAYLLTDGFGLQP |
Ga0307278_100689952 | 3300028878 | Soil | MTIHKRRGGGYWYYWVLLIGGTIFVIAYLSTDGFGLSP |
Ga0307278_101435944 | 3300028878 | Soil | VTIHKQPGGRYWYYWVIIIGGVALLIAYYATRGFGLSP |
Ga0311336_116592652 | 3300029990 | Fen | MAIHKQRGGRYWYYWLVIVGGTIFVIAYVATDGFGLKQ |
Ga0308187_103720762 | 3300031114 | Soil | MTIHRQRGGRYWYYWVVIIGGTAFVIAAFATDMFGMGS |
Ga0307495_101270652 | 3300031199 | Soil | MTIHKRRGGPYWYYWLVIIGGTVFVIAYYLTDGFGVKP |
Ga0299914_101796201 | 3300031228 | Soil | MTVHKRRGGGYWYYWVFLIGGAIFVIAYLITGGFGLGV |
Ga0299914_107837452 | 3300031228 | Soil | MTIHKQRGGRYWYYWVVIIGGIVFVVAALATDMFGLGTY |
Ga0299913_100373483 | 3300031229 | Soil | MTIHRQRGGRYWYYWVLIIGGIVFLVAALATDMFGLDYY |
Ga0299913_104454842 | 3300031229 | Soil | VTIHRQRGGRYWYYWVLLIGGTIFVIAALATDMFGLGGY |
Ga0315553_100447963 | 3300031652 | Salt Marsh Sediment | MAIHKPRRGRYWYYWLVIVGGTLFVIAYIVTDSFGLKP |
Ga0307416_1022524181 | 3300032002 | Rhizosphere | MTIHRQRGGRYWYYWVIIVGGTAFVIAAIATDMFGLGSGY |
Ga0311301_1002196612 | 3300032160 | Peatlands Soil | MAIHKQRGGRYWYYWVVIIGGTALVIAYYLTNGFGAKP |
Ga0307471_1022194462 | 3300032180 | Hardwood Forest Soil | MTIHRQRGGRYWYYWVIIVGGIAFVIAYYATDGFGLSPLASGAT |
Ga0326726_105575482 | 3300033433 | Peat Soil | MAIHKRRGGGYWYYWLVIVGGIVFVIAFYATEGFGLQP |
Ga0334935_017946_1268_1384 | 3300034781 | Biocrust | MTIHKQRGGRYWYYWVLIVGGALFVIAYYATEGFGLAP |
Ga0334935_073195_557_673 | 3300034781 | Biocrust | MTIHKQRGGRYWYYWVLIVGGIFFVIAYYATDGFGLAP |
⦗Top⦘ |