Basic Information | |
---|---|
Family ID | F022121 |
Family Type | Metagenome |
Number of Sequences | 216 |
Average Sequence Length | 39 residues |
Representative Sequence | MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI |
Number of Associated Samples | 146 |
Number of Associated Scaffolds | 216 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 89.81 % |
% of genes near scaffold ends (potentially truncated) | 9.72 % |
% of genes from short scaffolds (< 2000 bps) | 77.78 % |
Associated GOLD sequencing projects | 128 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.611 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.074 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.148 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.722 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 216 Family Scaffolds |
---|---|---|
PF02754 | CCG | 40.74 |
PF01012 | ETF | 39.81 |
PF13183 | Fer4_8 | 6.48 |
PF02771 | Acyl-CoA_dh_N | 3.70 |
PF02803 | Thiolase_C | 0.93 |
PF13411 | MerR_1 | 0.93 |
PF13400 | Tad | 0.46 |
PF01642 | MM_CoA_mutase | 0.46 |
PF00202 | Aminotran_3 | 0.46 |
PF11716 | MDMPI_N | 0.46 |
PF00441 | Acyl-CoA_dh_1 | 0.46 |
PF00285 | Citrate_synt | 0.46 |
PF00171 | Aldedh | 0.46 |
PF02826 | 2-Hacid_dh_C | 0.46 |
PF12867 | DinB_2 | 0.46 |
PF07859 | Abhydrolase_3 | 0.46 |
PF00005 | ABC_tran | 0.46 |
COG ID | Name | Functional Category | % Frequency in 216 Family Scaffolds |
---|---|---|---|
COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 40.74 |
COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 40.74 |
COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 39.81 |
COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 39.81 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 4.17 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.93 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.46 |
COG0372 | Citrate synthase | Energy production and conversion [C] | 0.46 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.46 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.46 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.46 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.46 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.61 % |
Unclassified | root | N/A | 1.39 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000887|AL16A1W_10000612 | All Organisms → cellular organisms → Bacteria | 5000 | Open in IMG/M |
3300000956|JGI10216J12902_117057031 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300001359|A3035W6_1122069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1376 | Open in IMG/M |
3300002558|JGI25385J37094_10043149 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
3300002561|JGI25384J37096_10226699 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300002562|JGI25382J37095_10003064 | All Organisms → cellular organisms → Bacteria | 5585 | Open in IMG/M |
3300002908|JGI25382J43887_10026350 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
3300002908|JGI25382J43887_10053679 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
3300002908|JGI25382J43887_10055088 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
3300002911|JGI25390J43892_10082918 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300002911|JGI25390J43892_10146138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 550 | Open in IMG/M |
3300004156|Ga0062589_100995323 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300005166|Ga0066674_10269002 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300005166|Ga0066674_10278061 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300005166|Ga0066674_10451576 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005167|Ga0066672_10011963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4230 | Open in IMG/M |
3300005167|Ga0066672_10056350 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
3300005171|Ga0066677_10020382 | All Organisms → cellular organisms → Bacteria | 3057 | Open in IMG/M |
3300005171|Ga0066677_10368735 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300005171|Ga0066677_10424598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 760 | Open in IMG/M |
3300005171|Ga0066677_10628565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 607 | Open in IMG/M |
3300005172|Ga0066683_10131441 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300005172|Ga0066683_10180357 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300005175|Ga0066673_10379540 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300005176|Ga0066679_10076998 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
3300005177|Ga0066690_10390254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 945 | Open in IMG/M |
3300005180|Ga0066685_10678494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 708 | Open in IMG/M |
3300005445|Ga0070708_100023411 | All Organisms → cellular organisms → Bacteria | 5253 | Open in IMG/M |
3300005445|Ga0070708_100396480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1301 | Open in IMG/M |
3300005445|Ga0070708_100667076 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300005445|Ga0070708_101627622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 601 | Open in IMG/M |
3300005445|Ga0070708_102040153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 531 | Open in IMG/M |
3300005445|Ga0070708_102136821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 517 | Open in IMG/M |
3300005446|Ga0066686_10582438 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300005446|Ga0066686_10884105 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005450|Ga0066682_10624905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 673 | Open in IMG/M |
3300005451|Ga0066681_10665085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
3300005451|Ga0066681_10671937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 633 | Open in IMG/M |
3300005467|Ga0070706_100606780 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300005471|Ga0070698_100256876 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
3300005518|Ga0070699_100448313 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300005536|Ga0070697_100885133 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300005540|Ga0066697_10003292 | All Organisms → cellular organisms → Bacteria | 7448 | Open in IMG/M |
3300005552|Ga0066701_10019584 | All Organisms → cellular organisms → Bacteria | 3334 | Open in IMG/M |
3300005555|Ga0066692_10193949 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300005556|Ga0066707_10444551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
3300005556|Ga0066707_10904602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 541 | Open in IMG/M |
3300005558|Ga0066698_10104814 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300005559|Ga0066700_10925700 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005561|Ga0066699_11231185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 513 | Open in IMG/M |
3300005568|Ga0066703_10039070 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
3300005574|Ga0066694_10544575 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005575|Ga0066702_10767801 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300006032|Ga0066696_10017365 | All Organisms → cellular organisms → Bacteria | 3625 | Open in IMG/M |
3300006032|Ga0066696_10536427 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300006032|Ga0066696_10733860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 633 | Open in IMG/M |
3300006034|Ga0066656_10045050 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
3300006034|Ga0066656_10323841 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300006058|Ga0075432_10171402 | Not Available | 844 | Open in IMG/M |
3300006852|Ga0075433_10052401 | All Organisms → cellular organisms → Bacteria | 3555 | Open in IMG/M |
3300006854|Ga0075425_100334619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1743 | Open in IMG/M |
3300006854|Ga0075425_103110377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
3300006914|Ga0075436_101302160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 550 | Open in IMG/M |
3300006914|Ga0075436_101345653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 541 | Open in IMG/M |
3300007258|Ga0099793_10180605 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300007265|Ga0099794_10248130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 917 | Open in IMG/M |
3300009012|Ga0066710_100200182 | All Organisms → cellular organisms → Bacteria | 2842 | Open in IMG/M |
3300009012|Ga0066710_100308582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2321 | Open in IMG/M |
3300009012|Ga0066710_101603613 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300009012|Ga0066710_102661516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 716 | Open in IMG/M |
3300009012|Ga0066710_102803122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 689 | Open in IMG/M |
3300009038|Ga0099829_10042509 | All Organisms → cellular organisms → Bacteria | 3319 | Open in IMG/M |
3300009038|Ga0099829_10316491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 1281 | Open in IMG/M |
3300009038|Ga0099829_10406371 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300009088|Ga0099830_11551198 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300009090|Ga0099827_10043019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3353 | Open in IMG/M |
3300009090|Ga0099827_10723178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 861 | Open in IMG/M |
3300009137|Ga0066709_102429404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 711 | Open in IMG/M |
3300009137|Ga0066709_103596575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 562 | Open in IMG/M |
3300009147|Ga0114129_11282929 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300009162|Ga0075423_11283486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 782 | Open in IMG/M |
3300010323|Ga0134086_10464790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
3300010333|Ga0134080_10247707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 785 | Open in IMG/M |
3300010333|Ga0134080_10264903 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300010335|Ga0134063_10607310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 557 | Open in IMG/M |
3300010336|Ga0134071_10030972 | All Organisms → cellular organisms → Bacteria | 2333 | Open in IMG/M |
3300010336|Ga0134071_10124428 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300010336|Ga0134071_10197942 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300010364|Ga0134066_10249302 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300011270|Ga0137391_10979541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 689 | Open in IMG/M |
3300012003|Ga0120163_1081699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 727 | Open in IMG/M |
3300012096|Ga0137389_10125342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2075 | Open in IMG/M |
3300012200|Ga0137382_10373349 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300012202|Ga0137363_11129102 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300012203|Ga0137399_10024002 | All Organisms → cellular organisms → Bacteria | 4061 | Open in IMG/M |
3300012203|Ga0137399_10971283 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300012203|Ga0137399_11595460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 540 | Open in IMG/M |
3300012206|Ga0137380_10302562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1433 | Open in IMG/M |
3300012207|Ga0137381_10370656 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300012208|Ga0137376_10007078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7643 | Open in IMG/M |
3300012208|Ga0137376_10217595 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
3300012208|Ga0137376_11603713 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300012209|Ga0137379_10211923 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
3300012210|Ga0137378_11413185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 609 | Open in IMG/M |
3300012211|Ga0137377_11560091 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300012351|Ga0137386_10103697 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
3300012358|Ga0137368_10448992 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300012361|Ga0137360_11420916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
3300012362|Ga0137361_11142638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 700 | Open in IMG/M |
3300012917|Ga0137395_11178258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 538 | Open in IMG/M |
3300012918|Ga0137396_10072978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2401 | Open in IMG/M |
3300012922|Ga0137394_11192632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 625 | Open in IMG/M |
3300012923|Ga0137359_11645859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 529 | Open in IMG/M |
3300012925|Ga0137419_10403564 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300012927|Ga0137416_10194104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1625 | Open in IMG/M |
3300012927|Ga0137416_11934252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
3300012944|Ga0137410_10084412 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
3300012944|Ga0137410_11195876 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300013758|Ga0120147_1027123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1077 | Open in IMG/M |
3300014056|Ga0120125_1025175 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
3300014154|Ga0134075_10078054 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
3300014154|Ga0134075_10359422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 639 | Open in IMG/M |
3300014154|Ga0134075_10461431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 566 | Open in IMG/M |
3300014154|Ga0134075_10466080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 563 | Open in IMG/M |
3300015241|Ga0137418_10176584 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
3300015245|Ga0137409_10534909 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300017654|Ga0134069_1158293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 759 | Open in IMG/M |
3300017656|Ga0134112_10172676 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300017656|Ga0134112_10198258 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300017997|Ga0184610_1063414 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300018027|Ga0184605_10001331 | All Organisms → cellular organisms → Bacteria | 7903 | Open in IMG/M |
3300018027|Ga0184605_10098653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 1288 | Open in IMG/M |
3300018027|Ga0184605_10246899 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300018028|Ga0184608_10420323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 578 | Open in IMG/M |
3300018051|Ga0184620_10350247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
3300018061|Ga0184619_10067051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1581 | Open in IMG/M |
3300018061|Ga0184619_10515817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 526 | Open in IMG/M |
3300018066|Ga0184617_1197672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 599 | Open in IMG/M |
3300018431|Ga0066655_10029222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2667 | Open in IMG/M |
3300018431|Ga0066655_10312870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1024 | Open in IMG/M |
3300018431|Ga0066655_10518432 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300018433|Ga0066667_10469377 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300018433|Ga0066667_11163390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 670 | Open in IMG/M |
3300018433|Ga0066667_11470828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 601 | Open in IMG/M |
3300018468|Ga0066662_10309238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1333 | Open in IMG/M |
3300018468|Ga0066662_10691062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 972 | Open in IMG/M |
3300018482|Ga0066669_10118170 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
3300018482|Ga0066669_10704882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 889 | Open in IMG/M |
3300018482|Ga0066669_12341196 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300019879|Ga0193723_1001989 | All Organisms → cellular organisms → Bacteria | 7627 | Open in IMG/M |
3300019885|Ga0193747_1008483 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
3300019885|Ga0193747_1066140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 892 | Open in IMG/M |
3300020022|Ga0193733_1004718 | All Organisms → cellular organisms → Bacteria | 3915 | Open in IMG/M |
3300021344|Ga0193719_10014968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3288 | Open in IMG/M |
3300022694|Ga0222623_10090775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1186 | Open in IMG/M |
3300025885|Ga0207653_10041960 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300025910|Ga0207684_10075191 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
3300025910|Ga0207684_10174883 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
3300025922|Ga0207646_10003615 | All Organisms → cellular organisms → Bacteria | 17309 | Open in IMG/M |
3300026285|Ga0209438_1159632 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300026295|Ga0209234_1115577 | Not Available | 997 | Open in IMG/M |
3300026296|Ga0209235_1169989 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300026297|Ga0209237_1002147 | All Organisms → cellular organisms → Bacteria | 11798 | Open in IMG/M |
3300026297|Ga0209237_1016858 | All Organisms → cellular organisms → Bacteria | 4251 | Open in IMG/M |
3300026297|Ga0209237_1237288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
3300026300|Ga0209027_1043273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1695 | Open in IMG/M |
3300026305|Ga0209688_1022422 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300026307|Ga0209469_1146487 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300026310|Ga0209239_1037382 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
3300026310|Ga0209239_1099972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1232 | Open in IMG/M |
3300026313|Ga0209761_1093387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1522 | Open in IMG/M |
3300026313|Ga0209761_1144884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1126 | Open in IMG/M |
3300026313|Ga0209761_1146037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1120 | Open in IMG/M |
3300026318|Ga0209471_1200906 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300026327|Ga0209266_1183535 | Not Available | 787 | Open in IMG/M |
3300026328|Ga0209802_1064192 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
3300026328|Ga0209802_1261123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 587 | Open in IMG/M |
3300026330|Ga0209473_1243800 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300026331|Ga0209267_1007036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6478 | Open in IMG/M |
3300026332|Ga0209803_1006837 | All Organisms → cellular organisms → Bacteria | 6368 | Open in IMG/M |
3300026334|Ga0209377_1104156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1171 | Open in IMG/M |
3300026334|Ga0209377_1223187 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300026335|Ga0209804_1008225 | All Organisms → cellular organisms → Bacteria | 5751 | Open in IMG/M |
3300026527|Ga0209059_1154682 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300026529|Ga0209806_1019274 | All Organisms → cellular organisms → Bacteria | 3523 | Open in IMG/M |
3300026530|Ga0209807_1000228 | All Organisms → cellular organisms → Bacteria | 25027 | Open in IMG/M |
3300026536|Ga0209058_1014604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5394 | Open in IMG/M |
3300026536|Ga0209058_1208267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 790 | Open in IMG/M |
3300026542|Ga0209805_1002540 | All Organisms → cellular organisms → Bacteria | 10615 | Open in IMG/M |
3300026548|Ga0209161_10019342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4925 | Open in IMG/M |
3300026548|Ga0209161_10024298 | All Organisms → cellular organisms → Bacteria | 4283 | Open in IMG/M |
3300027181|Ga0208997_1056577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 585 | Open in IMG/M |
3300027277|Ga0209846_1065866 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027388|Ga0208995_1081204 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300027643|Ga0209076_1085594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 896 | Open in IMG/M |
3300027846|Ga0209180_10275979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 965 | Open in IMG/M |
3300027846|Ga0209180_10635129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_2_70_6 | 587 | Open in IMG/M |
3300027875|Ga0209283_10113075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1784 | Open in IMG/M |
3300027882|Ga0209590_10784119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
3300027903|Ga0209488_10389911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1032 | Open in IMG/M |
3300028719|Ga0307301_10073321 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300028722|Ga0307319_10251355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 582 | Open in IMG/M |
3300028784|Ga0307282_10076386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1529 | Open in IMG/M |
3300028792|Ga0307504_10069147 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300028807|Ga0307305_10332602 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300028814|Ga0307302_10169186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1062 | Open in IMG/M |
3300028881|Ga0307277_10011491 | All Organisms → cellular organisms → Bacteria | 3411 | Open in IMG/M |
3300028881|Ga0307277_10102347 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300028881|Ga0307277_10336577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 672 | Open in IMG/M |
3300028881|Ga0307277_10543336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
3300028884|Ga0307308_10127083 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300031199|Ga0307495_10192023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 556 | Open in IMG/M |
3300031720|Ga0307469_10461996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1102 | Open in IMG/M |
3300031720|Ga0307469_11365590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 675 | Open in IMG/M |
3300032180|Ga0307471_100762399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
3300032205|Ga0307472_100048077 | All Organisms → cellular organisms → Bacteria | 2636 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.07% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.37% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 17.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.17% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.70% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.31% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.46% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.46% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AL16A1W_100006125 | 3300000887 | Permafrost | MDLTDGQTIFAIAMTFVMLVVAFAVVAFALWYSGDQQEI* |
JGI10216J12902_1170570312 | 3300000956 | Soil | MDLTDGTTIFAIAITLVLLVVAFAVVAFALWYSGDQQSI* |
A3035W6_11220692 | 3300001359 | Permafrost | MDLTDGQTIFAIAFTLVMLVVAFAVVVFALWYTGDQQSI* |
JGI25385J37094_100431492 | 3300002558 | Grasslands Soil | VELFDAQTIFAIVFALVALGVAGGAVAFALWYQGDQTEL* |
JGI25384J37096_102266992 | 3300002561 | Grasslands Soil | VDLFDGQMIFGVVFALVALAVAFGAVGFALWYSGDQTEI* |
JGI25382J37095_100030645 | 3300002562 | Grasslands Soil | VDLTDGTTIFAIAFAFIALAAAFGAVAFALWYGGDQTEL* |
JGI25382J43887_100263502 | 3300002908 | Grasslands Soil | MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQQI* |
JGI25382J43887_100536792 | 3300002908 | Grasslands Soil | VNLTDSTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL* |
JGI25382J43887_100550882 | 3300002908 | Grasslands Soil | VDLGGIPIDGQTIFAIVFVLVALVVAGGVVGFALWWSGDQTEL* |
JGI25390J43892_100829182 | 3300002911 | Grasslands Soil | VDLTDGTTIFAIVFAFIALAVAFGAVAFALWYAGDGADI* |
JGI25390J43892_101461382 | 3300002911 | Grasslands Soil | MDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET* |
Ga0062589_1009953232 | 3300004156 | Soil | MDLTDGQTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI* |
Ga0066674_102690022 | 3300005166 | Soil | VNLTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL* |
Ga0066674_102780612 | 3300005166 | Soil | VDLTDGTTIFAIAFTLVLLVVAFAVVAFALWYTGGQQEI* |
Ga0066674_104515762 | 3300005166 | Soil | MDFTDGTTIFAIVFAFVMLAVAFGAVAFALWYSGDQQET* |
Ga0066672_100119633 | 3300005167 | Soil | MDLTDGQTIFAIAFTFVMLVVAFAVVGFALWYSGDQQEI* |
Ga0066672_100563502 | 3300005167 | Soil | VDFTDGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQEI* |
Ga0066677_100203823 | 3300005171 | Soil | VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET* |
Ga0066677_103687352 | 3300005171 | Soil | VDLGGITIDGQTIFAIVFVLIALMIAGGVVGFALWWSGDQTEL* |
Ga0066677_104245982 | 3300005171 | Soil | VDLFDGQTIFAIAFTLVALAVAFAVVGFALWYAGDQQQL* |
Ga0066677_106285651 | 3300005171 | Soil | MDLFDGQTIFAIVFALVALAVAGGAVAFALWYQGDQQEL* |
Ga0066683_101314411 | 3300005172 | Soil | VDLTDGQTIFAIAFTVVMLMVAFAAVAFALWYSGDQQEI* |
Ga0066683_101803572 | 3300005172 | Soil | VDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQEI* |
Ga0066673_103795402 | 3300005175 | Soil | MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGEQQEI* |
Ga0066679_100769982 | 3300005176 | Soil | MVDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQQT* |
Ga0066690_103902541 | 3300005177 | Soil | VDLFDGQTVFAIAFTLVALAVAFAVVGFALWYAGDQQQL* |
Ga0066685_106784942 | 3300005180 | Soil | VDLTDGQTIFAIVFTVVMLMVAFAAVAFALWYSGDQQEI* |
Ga0070708_1000234115 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLTGGTAIFAIVFAFIALAVAFGAVAFALWYSGDQTEL* |
Ga0070708_1003964802 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLTDGTTIFAIVFTFVMLAIAFAVVAFALWYSGDQQSL* |
Ga0070708_1006670762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0070708_1016276222 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLADGTTIFAIAFTLVMLGIAFAVVVFALWYTGDQQEI* |
Ga0070708_1020401532 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLSDGETIFSVVFALVALAVAFGAVAFALWYSGDQTEI* |
Ga0070708_1021368212 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQEI* |
Ga0066686_105824382 | 3300005446 | Soil | MDLFDGQTIFAVAFALVALAVAFGAVAFALWYSGDQTEL* |
Ga0066686_108841052 | 3300005446 | Soil | VDLTDGQTIFAIVFTVVMLMVAFAAVAFALWYSGDQQET* |
Ga0066682_106249051 | 3300005450 | Soil | ELMDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0066681_106650851 | 3300005451 | Soil | GELMDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGEQQEI* |
Ga0066681_106719372 | 3300005451 | Soil | MDLTDGQTIFAITFTFVMLVVAFAVVAFALWYTGDQQSI* |
Ga0070706_1006067802 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0070698_1002568762 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLTDGTTIFAIAFTFVMLAIAFAVVAFALWYSGDQQSL* |
Ga0070699_1004483132 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLTDGTTIFAIAFTLVMLGIAFAVVVFALWYTGDQQEI* |
Ga0070697_1008851332 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLTGGTAIFAIVFAFIALAVAFGAVAFALWYGGDQTEL* |
Ga0066697_100032922 | 3300005540 | Soil | MDSQTIFAIVFALVALGVAGGAVAFALWYQGDQTEL* |
Ga0066701_100195844 | 3300005552 | Soil | MDGQTIFAIVFALVALAVAGGAVAFALWYQGDQSEL* |
Ga0066692_101939492 | 3300005555 | Soil | VDLTGGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL* |
Ga0066707_104445512 | 3300005556 | Soil | VDFTDGTTIFAIAFTLVMLAIAFGVVVFALWYTGDQQEI* |
Ga0066707_109046021 | 3300005556 | Soil | MDLFDGQTIFAIVFALVALAVTGGAVAFALWYQGDQQEL* |
Ga0066698_101048143 | 3300005558 | Soil | MDFTDGQTIFAIVFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0066700_109257002 | 3300005559 | Soil | MDLFDGQTIFAIVFALVALTVAGGAVTFALWYQGDQQEL* |
Ga0066699_112311852 | 3300005561 | Soil | VDFTDGSTIFAIAFTLMMLAIAFAVVVFALWYTGDQQEI* |
Ga0066703_100390702 | 3300005568 | Soil | MDLADGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0066694_105445752 | 3300005574 | Soil | MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGNQQEI* |
Ga0066702_107678012 | 3300005575 | Soil | MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGEQQSI* |
Ga0066696_100173655 | 3300006032 | Soil | TDGTTIFAIVFAFVMLAVAFGAVAFALWYSGDQQET* |
Ga0066696_105364272 | 3300006032 | Soil | MDFTDGTTIFAIVFTFVMLAVASGAVAFALWYSGDQQET* |
Ga0066696_107338602 | 3300006032 | Soil | MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGEQQEI* |
Ga0066656_100450502 | 3300006034 | Soil | VNLTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTQL* |
Ga0066656_103238412 | 3300006034 | Soil | VDLTDGQTIFAIALTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0075432_101714021 | 3300006058 | Populus Rhizosphere | MEFDGQTTFAIGATIVLIVVAFATVVFALWYSGDQKEI* |
Ga0075433_100524013 | 3300006852 | Populus Rhizosphere | MDLTDGTTIFAIAFTLVMLVVAFAVVAFALWYSGEQQEI* |
Ga0075425_1003346193 | 3300006854 | Populus Rhizosphere | VDFTDGTTIFAIVFTLVMLAVAFGAVAFALWYSGEQQEI* |
Ga0075425_1031103772 | 3300006854 | Populus Rhizosphere | MEFDGQTTFAIGATIVLIVVALATVVFALWYSGDQKEI* |
Ga0075436_1013021602 | 3300006914 | Populus Rhizosphere | MDFTDGTTIFAILSTFVMLAVAFAVVAFALWYSGDQQE |
Ga0075436_1013456532 | 3300006914 | Populus Rhizosphere | VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGEQQEI* |
Ga0099793_101806052 | 3300007258 | Vadose Zone Soil | MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQQI* |
Ga0099794_102481302 | 3300007265 | Vadose Zone Soil | VDVTDGQTIFAIAFTFVMLAIAFAVVAFALWYSGDQQEI* |
Ga0066710_1002001823 | 3300009012 | Grasslands Soil | VAAQTIVAIVFAFVALAIAGGAVAFALRYQGDQAEL |
Ga0066710_1003085823 | 3300009012 | Grasslands Soil | VDLTDGQTIFAIALTFVMLVVAFAVVAFALWYSGDQQEI |
Ga0066710_1016036132 | 3300009012 | Grasslands Soil | VDLTDGTTIFAIAVTLVLLVVAFAVVVFALWYTGDQQEI |
Ga0066710_1026615162 | 3300009012 | Grasslands Soil | MDLFDGQTIFAVAFALVALAVAFGAVAFALWYSGDQTEL |
Ga0066710_1028031222 | 3300009012 | Grasslands Soil | KLMDLTDGQTIFAIAFTFVMLVVAFAVVGFALWYSGDQQEI |
Ga0099829_100425093 | 3300009038 | Vadose Zone Soil | MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGDQQQI* |
Ga0099829_103164913 | 3300009038 | Vadose Zone Soil | MDLSDGTTIFAIAFTLVMLVVAFAVVAFALWYTGDQQEI* |
Ga0099829_104063712 | 3300009038 | Vadose Zone Soil | MDLTDGTTIFAIVFTFVMLAIAFAVVAFALWYSGDQQEI* |
Ga0099830_115511982 | 3300009088 | Vadose Zone Soil | VAAQTIFAILFAFVALAVAGGAVAFALWYQGDQTEL* |
Ga0099827_100430192 | 3300009090 | Vadose Zone Soil | VNLTDSTTIFAIVFAFIALAVAFGAIAFALWYGGDQTEL* |
Ga0099827_107231782 | 3300009090 | Vadose Zone Soil | VDLLDGQTIFAVAFALVALAVAFGAVAFALWYSGDQSEL* |
Ga0066709_1024294042 | 3300009137 | Grasslands Soil | VDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0066709_1035965752 | 3300009137 | Grasslands Soil | MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQKI* |
Ga0114129_112829292 | 3300009147 | Populus Rhizosphere | MDLTDGTTIFAIAFTIVMLVVAFAVVGFALWYSGDQQEI* |
Ga0075423_112834862 | 3300009162 | Populus Rhizosphere | MDLTDPQTLFAIAFAIVALAVAFGAVGFALWYAGEQTEL* |
Ga0134086_104647901 | 3300010323 | Grasslands Soil | VDLTDGQTIFAIAFTIVMLMVAFAAVAFALWYSGDQQEI* |
Ga0134080_102477072 | 3300010333 | Grasslands Soil | MDLTDGTTIFAIAFTFVILVIAFAVVVFALWYTGDQQEI* |
Ga0134080_102649032 | 3300010333 | Grasslands Soil | MDFTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL* |
Ga0134063_106073102 | 3300010335 | Grasslands Soil | VDFTDGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQ |
Ga0134071_100309722 | 3300010336 | Grasslands Soil | VNLTDSTTVFAIVFAFIALAVAFGAVAFALWYAGDQTEL* |
Ga0134071_101244282 | 3300010336 | Grasslands Soil | MDLTDGTTIFAIAFTLVMLVAAFAVVAFALWYTGDQQEI* |
Ga0134071_101979422 | 3300010336 | Grasslands Soil | VDFTDGTTIFAIAFTLVMLAIAFAVVGFALWYTGDQQEI* |
Ga0134066_102493022 | 3300010364 | Grasslands Soil | MVLFDGQTIFAIVFALVALAVTGGAVAFALWYQGDQQEL* |
Ga0137391_109795412 | 3300011270 | Vadose Zone Soil | MDLTDGTTIFAIAFTLVMLVVAFAVVAFALWYSGDQQQI* |
Ga0120163_10816992 | 3300012003 | Permafrost | VDLTDGQTIFANAFTFAMLVVAFAVVVFALWYTGDQQEI* |
Ga0137389_101253422 | 3300012096 | Vadose Zone Soil | MDLTDGTTIFAIAFTLVMLVVAFAVIAFALWYSGEQ* |
Ga0137382_103733492 | 3300012200 | Vadose Zone Soil | MDLTDGTTIFAIAFTLVLLAVAFAVVVFALWYTGDQQEI* |
Ga0137363_111291022 | 3300012202 | Vadose Zone Soil | MDLTDGTTIFAIAFTFLMLVIAFAVVVFALWYTGDQQEI* |
Ga0137399_100240024 | 3300012203 | Vadose Zone Soil | MVDFTDGTTIFAIVFTFVMLAVAFGAVTFALWYSGDQQET* |
Ga0137399_109712832 | 3300012203 | Vadose Zone Soil | MDLTDGTTIFAITFTFVLLAVAFAVVAFALWYSGDQQEI* |
Ga0137399_115954602 | 3300012203 | Vadose Zone Soil | VDLTDGTTIFAIVFAFIALAIAFSAVAFALWYAGDGADI* |
Ga0137380_103025622 | 3300012206 | Vadose Zone Soil | MDLTDGTTIFAIAFTLVMLVVAFAVVVFALWYSGDQQEI* |
Ga0137381_103706562 | 3300012207 | Vadose Zone Soil | MDLTDGTTIFAIAFTFVMLVITFAVIVFALWYTGDQQQI* |
Ga0137376_100070786 | 3300012208 | Vadose Zone Soil | VDLTDGTTISAIVFAFIALAVAFGAVAFALWYGGDQTEL* |
Ga0137376_102175952 | 3300012208 | Vadose Zone Soil | MDLTDGTTIFAIAFTLVLLVVAFAVVAFALWYSGDQQEI* |
Ga0137376_116037132 | 3300012208 | Vadose Zone Soil | VDLFDGQTIFAIAFTLVALAVAFAAVGFALWYSGDQQQL* |
Ga0137379_102119232 | 3300012209 | Vadose Zone Soil | MDLMDGTTIFAIVFALVMLAVAFGAVAFALWYSGDQQET* |
Ga0137378_114131852 | 3300012210 | Vadose Zone Soil | MDLTDGTTIFAIAFTFMMLVVAFAVVVFALWYTGDQQEI* |
Ga0137377_115600912 | 3300012211 | Vadose Zone Soil | MDLTDGQTIFAIAFTFVVLVVAFAVVAFALWYSGDQQQI* |
Ga0137386_101036972 | 3300012351 | Vadose Zone Soil | VDLTDGTTIFAIAFTLVLLVVAVAVVVFALWYTGDQQEI* |
Ga0137368_104489922 | 3300012358 | Vadose Zone Soil | VDLNDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0137360_114209162 | 3300012361 | Vadose Zone Soil | MDLTDGTTIFAIAFTFVMLVIAFAVVAFALWYSGDLQEI* |
Ga0137361_111426382 | 3300012362 | Vadose Zone Soil | VDLTDGQTIFAIASTVVLLVIAFAVVAFALWYTGDQQEI* |
Ga0137395_111782582 | 3300012917 | Vadose Zone Soil | MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGDQQEI* |
Ga0137396_100729783 | 3300012918 | Vadose Zone Soil | MDLTDGTTIFAIVSTFVMLALAFAVVAFALWYSGDQQEI* |
Ga0137394_111926322 | 3300012922 | Vadose Zone Soil | VDLTDGTTIFAIVFAFVALGVAFGAVAFALWYGGDQTEL* |
Ga0137359_116458592 | 3300012923 | Vadose Zone Soil | MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQEI* |
Ga0137419_104035642 | 3300012925 | Vadose Zone Soil | MDLNDGRTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0137416_101941042 | 3300012927 | Vadose Zone Soil | MVDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET* |
Ga0137416_119342522 | 3300012927 | Vadose Zone Soil | MDLTDGTTIFAIVSTFVLLAVAFAVVAFALWYSGDQQEI* |
Ga0137410_100844124 | 3300012944 | Vadose Zone Soil | MDLTDGTTVFAIAFTFVLLAVAFAVVAFALWYSGDQQEI* |
Ga0137410_111958762 | 3300012944 | Vadose Zone Soil | VDLTDGQTIFAIAFTFVVLVVAFAVVAFALWYSGDQQEI* |
Ga0120147_10271234 | 3300013758 | Permafrost | MDLTDGQTIFAIAFTLVMLVVAFAVVVFALWYTGDQQEI* |
Ga0120125_10251752 | 3300014056 | Permafrost | MDLTDGQTIFAIAFTLGMLVVAFAVVVFALWYTGDQQSI* |
Ga0134075_100780542 | 3300014154 | Grasslands Soil | MDLFGGQTIFAVAFALVALAVAFGAVAFALWYSGDQTEL* |
Ga0134075_103594222 | 3300014154 | Grasslands Soil | VDLTDGTTIFAIVFAFIALAVAFGAVAFALWYAGDQTEL* |
Ga0134075_104614312 | 3300014154 | Grasslands Soil | MDLTDGQTIFAIAFTVVMLMVAFAAVAFALWYSGDQQEI* |
Ga0134075_104660802 | 3300014154 | Grasslands Soil | VDLTDGTTIFAIVFTLVLLVVAFAVVVFALWYTGDQQEI* |
Ga0137418_101765842 | 3300015241 | Vadose Zone Soil | MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI* |
Ga0137409_105349091 | 3300015245 | Vadose Zone Soil | GELVDLTDGTTIFAIAFAFIALAAAFGAVAFALWYGGDQTEL* |
Ga0134069_11582932 | 3300017654 | Grasslands Soil | VDLTDGTTIFAIAFTLVLLVVAFAVVAFALWYTGGQQEI |
Ga0134112_101726762 | 3300017656 | Grasslands Soil | VDLTDGETIFAIALTFVMLVVAFAVVAFALWYSGDQQEI |
Ga0134112_101982582 | 3300017656 | Grasslands Soil | MAAQTIFAILFAFVALAVAGGAVAFALWYQGDQTEL |
Ga0184610_10634142 | 3300017997 | Groundwater Sediment | VDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYSGDQQEI |
Ga0184605_100013313 | 3300018027 | Groundwater Sediment | VDLTDGTTISAIVFAFIALAVAFGAVAFALWYAGDQTEL |
Ga0184605_100986533 | 3300018027 | Groundwater Sediment | MDLTDGQTIFAIAFTFVMLVVAFAVVVFALWYTGDQQEI |
Ga0184605_102468992 | 3300018027 | Groundwater Sediment | MDLTDGTTIFAIAFTFVLLVVAFAVVVFALWYTGDQQEI |
Ga0184608_104203232 | 3300018028 | Groundwater Sediment | MDLTDGTTIFAIAFTFVMLVVAFAVVVFALWYTGDQQQI |
Ga0184620_103502472 | 3300018051 | Groundwater Sediment | MDLTDGQTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI |
Ga0184619_100670512 | 3300018061 | Groundwater Sediment | VDLTDGTTISAIVFAFIALAVAFGAVAFALWYGGDQTEL |
Ga0184619_105158172 | 3300018061 | Groundwater Sediment | MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYTGDQQQI |
Ga0184617_11976721 | 3300018066 | Groundwater Sediment | MDLTDGTTIFAIAFTFVMLVVAFAVVVFALWYTGDQQEI |
Ga0066655_100292223 | 3300018431 | Grasslands Soil | VDFTDGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQEI |
Ga0066655_103128702 | 3300018431 | Grasslands Soil | MDSQTIFAIVFALVALGVAGGAVAFALWYQGDQTEL |
Ga0066655_105184322 | 3300018431 | Grasslands Soil | VNLTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL |
Ga0066667_104693772 | 3300018433 | Grasslands Soil | VDLGGITIDGQTIFAIVFVLIALMIAGGVVGFALWWSGDQTEL |
Ga0066667_111633902 | 3300018433 | Grasslands Soil | MDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET |
Ga0066667_114708282 | 3300018433 | Grasslands Soil | VELFDAQTIFAIVFALVALAVAGGAVAFALWYQGDQSEL |
Ga0066662_103092383 | 3300018468 | Grasslands Soil | CGEAAELVNQTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL |
Ga0066662_106910622 | 3300018468 | Grasslands Soil | MDLTDGQTIFAIAFTFVMLVVAFAVVGFALWYSGDQQEI |
Ga0066669_101181702 | 3300018482 | Grasslands Soil | MDLFDGQTIFAIVFALVALAVTGGAVAFALWYQGDQQEL |
Ga0066669_107048821 | 3300018482 | Grasslands Soil | MDLTDGTIFAIAFTFVMLVVAFAVVAFALWYSGDQPEI |
Ga0066669_123411962 | 3300018482 | Grasslands Soil | MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQEI |
Ga0193723_10019895 | 3300019879 | Soil | MDLTDGQTIFAIAMTFVMLVIAFAVVVFALWYTGDQSEI |
Ga0193747_10084833 | 3300019885 | Soil | MDLTDGTTIFAIAITFVILVVAFAVVVFALWYTGDQQEI |
Ga0193747_10661401 | 3300019885 | Soil | MDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYTGD |
Ga0193733_10047184 | 3300020022 | Soil | MDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYTGDQQQI |
Ga0193719_100149683 | 3300021344 | Soil | MDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYTGDQQEI |
Ga0222623_100907751 | 3300022694 | Groundwater Sediment | TDGTTIFAIAFTFVLLVVAFAVVAFALWYSGDQQEI |
Ga0207653_100419602 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLTDGTTIFAVAFTLVMLVVAFAVVAFALWYSGEQQEI |
Ga0207684_100751912 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEFDGQTMFALAFTIVAVAIAFGTVAFALWYGGDQTEL |
Ga0207684_101748832 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQEI |
Ga0207646_100036153 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI |
Ga0209438_11596322 | 3300026285 | Grasslands Soil | MDLTDGTTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI |
Ga0209234_11155771 | 3300026295 | Grasslands Soil | DLFDGQTIFAIVFALIALSVVGGVVAFALWYQGDQQEI |
Ga0209235_11699892 | 3300026296 | Grasslands Soil | VELFDAQTIFAIVFALVALGVAGGAVAFALWYQGDQTEL |
Ga0209237_10021476 | 3300026297 | Grasslands Soil | VNLTDSTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL |
Ga0209237_10168584 | 3300026297 | Grasslands Soil | VDLGGIPIDGQTIFAIVFVLVALVVAGGVVGFALWWSGDQTEL |
Ga0209237_12372882 | 3300026297 | Grasslands Soil | MDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQQI |
Ga0209027_10432732 | 3300026300 | Grasslands Soil | VDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET |
Ga0209688_10224222 | 3300026305 | Soil | MDFTDGTTIFAIVFAFVMLAVAFGAVAFALWYSGDQQET |
Ga0209469_11464872 | 3300026307 | Soil | VDLTDGTTIFAIAFTLVLLVVAFAVIVFALWYTGDQQEI |
Ga0209239_10373822 | 3300026310 | Grasslands Soil | VDLTDGTTIFAIVFAFIALAVAFGAVAFALWYAGDGADI |
Ga0209239_10999723 | 3300026310 | Grasslands Soil | MDLFDGQTIFAIVFALVALAVAGGAVAFALWYQGDQQEL |
Ga0209761_10933873 | 3300026313 | Grasslands Soil | VDLTDGTTIFAIAFAFIALAAAFGAVAFALWYGGDQTEL |
Ga0209761_11448843 | 3300026313 | Grasslands Soil | VDLFDGQMIFGVVFALVALAVAFGAVGFALWYSGDQTEI |
Ga0209761_11460371 | 3300026313 | Grasslands Soil | ARELMDLTDGQTIFAIAFTFVMLVVAFAVVVFALWYTGDQQEI |
Ga0209471_12009062 | 3300026318 | Soil | VDLFDGQTIFAIAFTLVALAVAFAVVGFALWYGGDQQQL |
Ga0209266_11835352 | 3300026327 | Soil | VDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQEI |
Ga0209802_10641923 | 3300026328 | Soil | VDGQTIFAIVFALVALAVAGGAVAFALWYQGDQSEL |
Ga0209802_12611231 | 3300026328 | Soil | MDGQTIFAIVFALVALAVAGGAVAFALWYQGDQSEL |
Ga0209473_12438002 | 3300026330 | Soil | VDLFDGQTIFAIAFTLVALAVAFAVVGFALWYAGDQQQL |
Ga0209267_10070366 | 3300026331 | Soil | MDFTDGTTIFAIVFAFVMLAVAFGAVALALWYSGDQQET |
Ga0209803_10068378 | 3300026332 | Soil | VNLTDGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTE |
Ga0209377_11041562 | 3300026334 | Soil | VDLTGGTTIFAIVFAFIALAVAFGAVAFALWYGGDQTEL |
Ga0209377_12231872 | 3300026334 | Soil | VELFDAQTIFAIVFALAALGVAGGAVAFALWYQGDQTEL |
Ga0209804_10082251 | 3300026335 | Soil | MDLTDGQTIFAIAFTFVMLVVAFAVVGFALWYSGD |
Ga0209059_11546822 | 3300026527 | Soil | MDGQTIFAIVFAIVSLAVAGGAVAFALWYQGDQTEL |
Ga0209806_10192743 | 3300026529 | Soil | MDLADGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI |
Ga0209807_100022818 | 3300026530 | Soil | VDFTDGTTIFAIAFTLVMLAIAFGVVVFALWYTGDQQEI |
Ga0209058_10146046 | 3300026536 | Soil | MDFTDGQTIFAIVFTFVMLVVAFAVVAFALWYSGDQQEI |
Ga0209058_12082672 | 3300026536 | Soil | LVDFTDGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQEI |
Ga0209805_10025404 | 3300026542 | Soil | VDFTDGTTIFAIVFTFVMLAVAFGAVAFWYSGDQQET |
Ga0209161_100193424 | 3300026548 | Soil | VDFTDGTTIFAIAFTLVMLSIAFGVVVFALWYTGDQQEI |
Ga0209161_100242985 | 3300026548 | Soil | VDFADGTTIFAIAFTLVMLAIAFAVVVFALWYTGDQQEI |
Ga0208997_10565772 | 3300027181 | Forest Soil | VDLTDGTTIFAIVFAFIALAIAFSAVAFALWYAGDQQEL |
Ga0209846_10658662 | 3300027277 | Groundwater Sand | VDLTDGQTIFAIAFTFVVLVVAFAVVAFALWYSGDQQEI |
Ga0208995_10812042 | 3300027388 | Forest Soil | MVDFTDGTTIFAIVFTFVMLAVAFGAVAFALWYSGDQQET |
Ga0209076_10855942 | 3300027643 | Vadose Zone Soil | MDLTDGTTIFAIAFTLVLLVVAFAVVVFALWYTGDQQQI |
Ga0209180_102759792 | 3300027846 | Vadose Zone Soil | MDLSDGTTIFAIAFTLVMLVVAFAVVAFALWYTGDQQEI |
Ga0209180_106351291 | 3300027846 | Vadose Zone Soil | MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGDQQQI |
Ga0209283_101130753 | 3300027875 | Vadose Zone Soil | MDLTDGQTIFAIAMTFVMLVVAFAVVAFALWYSGDQQEI |
Ga0209590_107841192 | 3300027882 | Vadose Zone Soil | GEDRKLVDLTDGQTVFAIAFTLVMLAIAFAVVAFALWYSGDQQEI |
Ga0209488_103899112 | 3300027903 | Vadose Zone Soil | MDLTDGTTIFAIAFTFVMLVVAFAVVAFALWYSGEQQEI |
Ga0307301_100733212 | 3300028719 | Soil | MDLTDGTTIFAIAFTFLMLVVAFAVVAFALWYSGDQQQI |
Ga0307319_102513551 | 3300028722 | Soil | MELTDGQTIFAIAITFVMLVVAFAVVAFALWYSGDQQEI |
Ga0307282_100763862 | 3300028784 | Soil | MDLIDGTTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI |
Ga0307504_100691472 | 3300028792 | Soil | MDLTDGTTIFALAVTFEMLVIAFAVVVFALWYTGEQQEI |
Ga0307305_103326022 | 3300028807 | Soil | MDLSDGTTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI |
Ga0307302_101691861 | 3300028814 | Soil | MDLTDGQTIFAIAFTFVILVVAFAVVVFALWYTGDQQSI |
Ga0307277_100114915 | 3300028881 | Soil | MDFTDGTTIFAIAFTFVLLVVAFAVVGFALWYSGDQQEI |
Ga0307277_101023472 | 3300028881 | Soil | MDLTDGTTIFAIAFTLVLLAVAFGVVVFALWYTGDQQEI |
Ga0307277_103365771 | 3300028881 | Soil | DLTDGQTIFAIAITFVMVVVAFAVVVFALWYTGEQQEI |
Ga0307277_105433362 | 3300028881 | Soil | DGTTIFAIAMTFVMLVIAFAVVVFALWYTGDQTEI |
Ga0307308_101270833 | 3300028884 | Soil | RRGEAGELMDLTDGTTIFAIAFTFVLLVVAFAVVAFALWYTGDQQEI |
Ga0307495_101920231 | 3300031199 | Soil | MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGEQQEI |
Ga0307469_104619962 | 3300031720 | Hardwood Forest Soil | MDLTDGTTIFAIAFTFVMLVIAFAVVVFALWYTGDQQEI |
Ga0307469_113655902 | 3300031720 | Hardwood Forest Soil | MDLTDGQTIFAIAFTFVMLVIAFAVVVFALWYTGDQQEI |
Ga0307471_1007623992 | 3300032180 | Hardwood Forest Soil | VDLTDGQTIFAIAFTFVMLVVAFAVVAFALWYSGDQQEI |
Ga0307472_1000480772 | 3300032205 | Hardwood Forest Soil | VDLFDGQTIFAIAFTLVALAVAFAAVGFALWYSGDQQEL |
⦗Top⦘ |