Basic Information | |
---|---|
Family ID | F022100 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 216 |
Average Sequence Length | 43 residues |
Representative Sequence | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERY |
Number of Associated Samples | 188 |
Number of Associated Scaffolds | 216 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.80 % |
% of genes near scaffold ends (potentially truncated) | 95.83 % |
% of genes from short scaffolds (< 2000 bps) | 96.30 % |
Associated GOLD sequencing projects | 181 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.537 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (9.259 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.463 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.130 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 216 Family Scaffolds |
---|---|---|
PF05717 | TnpB_IS66 | 0.93 |
PF02195 | ParBc | 0.93 |
PF00589 | Phage_integrase | 0.46 |
PF03412 | Peptidase_C39 | 0.46 |
PF14319 | Zn_Tnp_IS91 | 0.46 |
PF00239 | Resolvase | 0.46 |
PF03965 | Penicillinase_R | 0.46 |
PF01695 | IstB_IS21 | 0.46 |
PF07508 | Recombinase | 0.46 |
PF01869 | BcrAD_BadFG | 0.46 |
PF02321 | OEP | 0.46 |
PF05598 | DUF772 | 0.46 |
PF13936 | HTH_38 | 0.46 |
PF13011 | LZ_Tnp_IS481 | 0.46 |
PF04542 | Sigma70_r2 | 0.46 |
PF03050 | DDE_Tnp_IS66 | 0.46 |
COG ID | Name | Functional Category | % Frequency in 216 Family Scaffolds |
---|---|---|---|
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.39 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.46 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.46 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.46 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.46 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.46 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.46 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.46 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.46 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.54 % |
Unclassified | root | N/A | 0.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c0760051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis sulfate-reducing endosymbiont | 509 | Open in IMG/M |
3300000567|JGI12270J11330_10136892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 953 | Open in IMG/M |
3300001593|JGI12635J15846_10389830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 843 | Open in IMG/M |
3300003369|JGI24140J50213_10075539 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300004091|Ga0062387_101403594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300004808|Ga0062381_10084497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 967 | Open in IMG/M |
3300005174|Ga0066680_10033601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 2920 | Open in IMG/M |
3300005450|Ga0066682_10084701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1974 | Open in IMG/M |
3300005553|Ga0066695_10400135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 852 | Open in IMG/M |
3300005602|Ga0070762_10112013 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
3300005602|Ga0070762_10808886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300005602|Ga0070762_10871381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300005764|Ga0066903_101722234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1194 | Open in IMG/M |
3300005764|Ga0066903_105599531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300005836|Ga0074470_11248547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300005842|Ga0068858_102120409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300005938|Ga0066795_10217249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300006032|Ga0066696_10660358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 674 | Open in IMG/M |
3300006047|Ga0075024_100377597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 715 | Open in IMG/M |
3300006086|Ga0075019_10312123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 948 | Open in IMG/M |
3300006086|Ga0075019_10765881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300006102|Ga0075015_100152379 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300006163|Ga0070715_10169156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1087 | Open in IMG/M |
3300006176|Ga0070765_101507236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 633 | Open in IMG/M |
3300006642|Ga0075521_10144483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1113 | Open in IMG/M |
3300006794|Ga0066658_10103267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1355 | Open in IMG/M |
3300009029|Ga0066793_10659777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300009089|Ga0099828_12024464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300009143|Ga0099792_10475353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
3300009518|Ga0116128_1238731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300009519|Ga0116108_1098344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 887 | Open in IMG/M |
3300009547|Ga0116136_1085592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300009644|Ga0116121_1130940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300009650|Ga0105857_1117565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 726 | Open in IMG/M |
3300009665|Ga0116135_1118100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 971 | Open in IMG/M |
3300009665|Ga0116135_1184833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 791 | Open in IMG/M |
3300009698|Ga0116216_10241469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
3300009698|Ga0116216_10427805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 802 | Open in IMG/M |
3300009762|Ga0116130_1108750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 871 | Open in IMG/M |
3300009824|Ga0116219_10187903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
3300010046|Ga0126384_11596925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 614 | Open in IMG/M |
3300010325|Ga0134064_10372053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300010358|Ga0126370_11643626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 616 | Open in IMG/M |
3300010359|Ga0126376_12172974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300010361|Ga0126378_10641870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1175 | Open in IMG/M |
3300010376|Ga0126381_103318027 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300010379|Ga0136449_101133361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1241 | Open in IMG/M |
3300010379|Ga0136449_101358192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1102 | Open in IMG/M |
3300012351|Ga0137386_10592856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300012358|Ga0137368_10239427 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300012360|Ga0137375_10417633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
3300012360|Ga0137375_10602270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 915 | Open in IMG/M |
3300012363|Ga0137390_10272009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1678 | Open in IMG/M |
3300012363|Ga0137390_10517440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
3300012925|Ga0137419_10257759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1317 | Open in IMG/M |
3300012971|Ga0126369_12893625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300013088|Ga0163200_1039618 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
3300013118|Ga0171656_1154664 | Not Available | 1012 | Open in IMG/M |
3300014150|Ga0134081_10229895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300014153|Ga0181527_1123545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
3300014155|Ga0181524_10384979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300014159|Ga0181530_10164792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
3300014162|Ga0181538_10213332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1078 | Open in IMG/M |
3300014165|Ga0181523_10776001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300014169|Ga0181531_10026484 | All Organisms → cellular organisms → Bacteria | 3337 | Open in IMG/M |
3300014492|Ga0182013_10108308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1853 | Open in IMG/M |
3300014493|Ga0182016_10684169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300014496|Ga0182011_11016247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300014657|Ga0181522_10531296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 710 | Open in IMG/M |
3300014838|Ga0182030_10911811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 786 | Open in IMG/M |
3300014839|Ga0182027_10647628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1127 | Open in IMG/M |
3300015193|Ga0167668_1032369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
3300016319|Ga0182033_11799436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300016371|Ga0182034_10690563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 867 | Open in IMG/M |
3300016387|Ga0182040_10641822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 863 | Open in IMG/M |
3300016404|Ga0182037_10421913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1104 | Open in IMG/M |
3300017822|Ga0187802_10148917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300017935|Ga0187848_10468934 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300017940|Ga0187853_10419161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300017941|Ga0187850_10230215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 838 | Open in IMG/M |
3300017941|Ga0187850_10377556 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300017955|Ga0187817_10623594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 688 | Open in IMG/M |
3300017961|Ga0187778_10356398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
3300017973|Ga0187780_10227134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
3300017974|Ga0187777_11455188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300018002|Ga0187868_1087729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1228 | Open in IMG/M |
3300018004|Ga0187865_1253149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300018005|Ga0187878_1096077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
3300018013|Ga0187873_1265294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300018025|Ga0187885_10330578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300018033|Ga0187867_10228678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1051 | Open in IMG/M |
3300018034|Ga0187863_10401890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 764 | Open in IMG/M |
3300018035|Ga0187875_10418476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300018038|Ga0187855_10273628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 990 | Open in IMG/M |
3300018040|Ga0187862_10242739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1161 | Open in IMG/M |
3300018040|Ga0187862_10552627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300018047|Ga0187859_10167690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1167 | Open in IMG/M |
3300018047|Ga0187859_10515131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300018057|Ga0187858_10760102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300018085|Ga0187772_10528334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
3300018088|Ga0187771_11940629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300018089|Ga0187774_10964086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300019082|Ga0187852_1061041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1726 | Open in IMG/M |
3300019785|Ga0182022_1248299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1511 | Open in IMG/M |
3300021374|Ga0213881_10137416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1067 | Open in IMG/M |
3300021404|Ga0210389_11170135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300021433|Ga0210391_10179532 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300021474|Ga0210390_11487501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300021474|Ga0210390_11599483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300021560|Ga0126371_10542458 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300021860|Ga0213851_1865682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 857 | Open in IMG/M |
3300021861|Ga0213853_11007955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1117 | Open in IMG/M |
3300022213|Ga0224500_10367498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300022730|Ga0224570_103231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300022850|Ga0224552_1022156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 872 | Open in IMG/M |
3300023019|Ga0224560_104442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 891 | Open in IMG/M |
3300025167|Ga0209642_10548036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300025551|Ga0210131_1072159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300025829|Ga0209484_10068325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 793 | Open in IMG/M |
3300025829|Ga0209484_10198907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300026325|Ga0209152_10055849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1396 | Open in IMG/M |
3300026332|Ga0209803_1157244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
3300026550|Ga0209474_10407611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 706 | Open in IMG/M |
3300027172|Ga0208098_1031307 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300027535|Ga0209734_1074634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 647 | Open in IMG/M |
3300027568|Ga0208042_1097814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 743 | Open in IMG/M |
3300027570|Ga0208043_1118609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300027638|Ga0208612_1124916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300027680|Ga0207826_1068595 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10065943 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10149658 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300027803|Ga0209910_10045026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300027831|Ga0209797_10028519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2534 | Open in IMG/M |
3300027854|Ga0209517_10312394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
3300027884|Ga0209275_10428962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 748 | Open in IMG/M |
3300027911|Ga0209698_10107215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 2332 | Open in IMG/M |
3300027911|Ga0209698_10126504 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
3300027911|Ga0209698_10578525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
3300027986|Ga0209168_10192350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1023 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10348702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 675 | Open in IMG/M |
3300028572|Ga0302152_10140175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
3300028746|Ga0302233_10177206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 819 | Open in IMG/M |
3300028748|Ga0302156_10222817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
3300028766|Ga0302269_1063299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1125 | Open in IMG/M |
3300028773|Ga0302234_10113863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1186 | Open in IMG/M |
3300028795|Ga0302227_10274390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300028808|Ga0302228_10202864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 903 | Open in IMG/M |
3300028854|Ga0302268_1155931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300028866|Ga0302278_10233115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
3300028866|Ga0302278_10472130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300028871|Ga0302230_10297740 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300028873|Ga0302197_10216516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 888 | Open in IMG/M |
3300028906|Ga0308309_11271084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 633 | Open in IMG/M |
3300029922|Ga0311363_10823777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 850 | Open in IMG/M |
3300029922|Ga0311363_11617723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300029943|Ga0311340_10055208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4659 | Open in IMG/M |
3300029943|Ga0311340_10876928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300029945|Ga0311330_11038292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300029951|Ga0311371_10802011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1159 | Open in IMG/M |
3300029956|Ga0302150_10134092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
3300029993|Ga0302304_10099536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1114 | Open in IMG/M |
3300029999|Ga0311339_10057737 | All Organisms → cellular organisms → Bacteria | 5128 | Open in IMG/M |
3300029999|Ga0311339_10368092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1512 | Open in IMG/M |
3300030007|Ga0311338_10856755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
3300030056|Ga0302181_10078586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1669 | Open in IMG/M |
3300030618|Ga0311354_10372007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1451 | Open in IMG/M |
3300030707|Ga0310038_10160650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1107 | Open in IMG/M |
3300031028|Ga0302180_10185374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1129 | Open in IMG/M |
3300031234|Ga0302325_11754391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 781 | Open in IMG/M |
3300031236|Ga0302324_101598259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
3300031525|Ga0302326_11283785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
3300031525|Ga0302326_12457041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 655 | Open in IMG/M |
3300031708|Ga0310686_107181561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300031712|Ga0265342_10287696 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300031720|Ga0307469_11188802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300031764|Ga0318535_10127258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
3300031771|Ga0318546_10391628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
3300031837|Ga0302315_10272420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 983 | Open in IMG/M |
3300031894|Ga0318522_10141039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
3300031912|Ga0306921_11797470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300031942|Ga0310916_11192455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300031947|Ga0310909_10746341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 811 | Open in IMG/M |
3300031949|Ga0214473_12298167 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300032008|Ga0318562_10308332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 920 | Open in IMG/M |
3300032025|Ga0318507_10175809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 920 | Open in IMG/M |
3300032025|Ga0318507_10464656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300032052|Ga0318506_10481855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300032064|Ga0318510_10257037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 719 | Open in IMG/M |
3300032066|Ga0318514_10008659 | All Organisms → cellular organisms → Bacteria | 4286 | Open in IMG/M |
3300032068|Ga0318553_10121857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1341 | Open in IMG/M |
3300032070|Ga0315279_10664551 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300032163|Ga0315281_10591406 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300032164|Ga0315283_10813273 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300032173|Ga0315268_10717429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
3300032259|Ga0316190_10415492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
3300032770|Ga0335085_11043265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 880 | Open in IMG/M |
3300032770|Ga0335085_11496291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 703 | Open in IMG/M |
3300032782|Ga0335082_10612401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
3300032782|Ga0335082_11549270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300032783|Ga0335079_11278877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
3300032783|Ga0335079_11613760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300032805|Ga0335078_11565309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 732 | Open in IMG/M |
3300032829|Ga0335070_10788446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
3300032892|Ga0335081_10892218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
3300032892|Ga0335081_11039947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 950 | Open in IMG/M |
3300032892|Ga0335081_11470743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 756 | Open in IMG/M |
3300032898|Ga0335072_11748258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300032954|Ga0335083_10394641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1184 | Open in IMG/M |
3300033158|Ga0335077_11293598 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300033289|Ga0310914_10507394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1091 | Open in IMG/M |
3300033290|Ga0318519_10245123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1035 | Open in IMG/M |
3300033433|Ga0326726_10356853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1381 | Open in IMG/M |
3300033482|Ga0316627_102951643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300033488|Ga0316621_10378692 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300033489|Ga0299912_10755796 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300033977|Ga0314861_0201656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.26% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.41% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.63% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.17% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.24% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.24% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.24% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.24% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.31% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.85% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.39% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.39% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.39% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.93% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.46% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.46% |
Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.46% |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.46% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.46% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.46% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.46% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.46% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.46% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.46% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.46% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.46% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.46% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.46% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.46% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.46% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.46% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.46% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.46% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.46% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.46% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.46% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013088 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m | Environmental | Open in IMG/M |
3300013118 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 314m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
3300022850 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5 | Environmental | Open in IMG/M |
3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027638 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028854 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_07600511 | 2228664022 | Soil | VLRWASEKLLELKPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLSPVVVC |
JGI12270J11330_101368923 | 3300000567 | Peatlands Soil | VLHWAQESLLDLGWDEIGEHYGRYRLHLPEAERAMAKSLQRYGQLSPIVVCRREE |
JGI12635J15846_103898302 | 3300001593 | Forest Soil | VLRWASENLLQLRPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLSPVVVC |
JGI24140J50213_100755393 | 3300003369 | Arctic Peat Soil | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLSPVVVC |
Ga0062387_1014035942 | 3300004091 | Bog Forest Soil | MLRWASDDLLQLKPEEIGEHYGRYRLHVPEAEHAMAKSLQR |
Ga0062381_100844971 | 3300004808 | Wetland Sediment | MLRWANEKLLELKAEEIGEHYGRYRLHVPEAERAMARSLERYGQLSPVVVCCRND |
Ga0066680_100336011 | 3300005174 | Soil | SENLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLY* |
Ga0066682_100847014 | 3300005450 | Soil | MLRWASENLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLE |
Ga0066695_104001351 | 3300005553 | Soil | MCERKEATRVLRWANENLLHLKTSEIGEHYGRYRLHVPEAERAMA |
Ga0070762_101120133 | 3300005602 | Soil | VLRWASEDLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLSP |
Ga0070762_108088861 | 3300005602 | Soil | VLLWSIEKLLELKPDEIGEHYGRYRLHIPEAERTMAKSLERY |
Ga0070762_108713812 | 3300005602 | Soil | VLRWASENLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLSP |
Ga0066903_1017222341 | 3300005764 | Tropical Forest Soil | VLRWASEDLLHLQREEIGEHYGRYRLHLPEAERAMA |
Ga0066903_1055995312 | 3300005764 | Tropical Forest Soil | VLRWAEENVRELECREIGEHYGRYRLHVAEAERAMARSLERYGQLSPV |
Ga0074470_112485471 | 3300005836 | Sediment (Intertidal) | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLS |
Ga0068858_1021204091 | 3300005842 | Switchgrass Rhizosphere | VLRWASENLLHLKHEEFGEHYGRYRLHVPEAERAMARSLKRYGQ |
Ga0066795_102172491 | 3300005938 | Soil | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMARS |
Ga0066696_106603581 | 3300006032 | Soil | MGVLRWASENLLQLKPEEIGEHYGRYRLHVPEAERAM |
Ga0075024_1003775971 | 3300006047 | Watersheds | VLRWADENLLELKREQIGEYYGRYRLHVPEAERAMA |
Ga0075019_103121231 | 3300006086 | Watersheds | VLRWADNQLLDLKWEEIGEHYGRYRLHVPGAERAMARSLERY |
Ga0075019_107658811 | 3300006086 | Watersheds | VLCWADNHLLDLKWEEIGEHYGRYRLHVPGAERAMARSLERYGQLS |
Ga0075015_1001523791 | 3300006102 | Watersheds | VLRWVQESSLQLGLAEFGDHYGRYRLHLPEAERAMARSLERYGQLSP |
Ga0070715_101691561 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRWASENLLHLKQEEFGEHYGRYRLHVPEAERAMARSLKRY |
Ga0070765_1015072361 | 3300006176 | Soil | MTRMLRWASENLLQLKLEEIGEHYGRYRLHVPEAE |
Ga0075521_101444831 | 3300006642 | Arctic Peat Soil | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQL |
Ga0066658_101032673 | 3300006794 | Soil | VLRWAPESLLDLPCAQIGEYYGRYRLHQPEAERAMARSLDR |
Ga0066793_106597771 | 3300009029 | Prmafrost Soil | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMA |
Ga0099828_120244642 | 3300009089 | Vadose Zone Soil | MCERKEATRVLRWANENLLHLKTSEIGEHYGRYRLHVPEAERAMAKSLERYGQLSPVVVCRR |
Ga0099792_104753531 | 3300009143 | Vadose Zone Soil | MLHWASDNLLQLRPEEIGEHYGRYRLHVPEAERVMAKSLERYG |
Ga0116128_12387311 | 3300009518 | Peatland | LLRWVQESPLPLPVDEIGEHYGRYRLHLPEAERAMARSLERY |
Ga0116108_10983443 | 3300009519 | Peatland | VLRWADENVRELECQEIGEHYGRYRLHLPEAERAMAR |
Ga0116136_10855921 | 3300009547 | Peatland | VLRWVAKGSLELRLSEIGEHYGRYRLHLPEAERAMA |
Ga0116121_11309402 | 3300009644 | Peatland | MRWVQESLLPLHVDEIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVCQ |
Ga0105857_11175651 | 3300009650 | Permafrost Soil | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMARSLE |
Ga0116135_11181001 | 3300009665 | Peatland | MRVLRWADDHLLDLKWEEIGEHYGRYRLHVPEAERAM |
Ga0116135_11848332 | 3300009665 | Peatland | VLQWSIEKQLELKPDEIGEHYGRYRLHIPEAERTMAKSLE |
Ga0116216_102414691 | 3300009698 | Peatlands Soil | MLRWASENLLQLKLEEIGEHYGRYRLHVPEAERAMAKS |
Ga0116216_104278052 | 3300009698 | Peatlands Soil | VLRWANENVLELECQAIGEHYGRYRLHLPEAERAMARSLE |
Ga0116130_11087501 | 3300009762 | Peatland | LRWANENLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLS |
Ga0116219_101879032 | 3300009824 | Peatlands Soil | LRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLE |
Ga0126384_115969251 | 3300010046 | Tropical Forest Soil | VLRWASEKLIELKPEEIGEHYGRYRLHVPDAERAMMKS |
Ga0134064_103720531 | 3300010325 | Grasslands Soil | MLRWASENLLQLKPEAIGEHYGRYRLHAPEAERAMAKSLE |
Ga0126370_116436262 | 3300010358 | Tropical Forest Soil | LRWASQDLLHLKPEEIGEHYGRYRLHVPEAERATQD* |
Ga0126376_121729742 | 3300010359 | Tropical Forest Soil | VLRWADENVLTLECQQIGEHYGRYRLHLPEAERAMARSLERYG* |
Ga0126378_106418703 | 3300010361 | Tropical Forest Soil | VLRWASEKLIELKPEEIGEHYGRYRLHVPEAERAMAK |
Ga0126381_1033180271 | 3300010376 | Tropical Forest Soil | MLRWADENLLELGCQEIGEHYGRYRLHLPEAERAMARS |
Ga0136449_1011333611 | 3300010379 | Peatlands Soil | MLRWASENLLELKPEEIGEHYGRYRLHVPEAERAMAKS |
Ga0136449_1013581921 | 3300010379 | Peatlands Soil | VLRWADENVRELECQEIGEHYGRYRLHLPEAERAMARSLERYGQ |
Ga0137386_105928561 | 3300012351 | Vadose Zone Soil | VHFLEALVLRWAPESLLDLPCAQIGEYYGRYRLHQPEAERAMARSLDRY |
Ga0137368_102394271 | 3300012358 | Vadose Zone Soil | MGEPGKWDMLRWVEDGTRELELGSIGEHYGRYRLHLPEAERAM |
Ga0137375_104176331 | 3300012360 | Vadose Zone Soil | MGEPGKWDMLRWVEDGTRELELGSIGEHYGRYRLHLPEAERAMARSLERYGQI |
Ga0137375_106022703 | 3300012360 | Vadose Zone Soil | VLRWASENLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLS |
Ga0137390_102720093 | 3300012363 | Vadose Zone Soil | VLRWAPESLLDLPCAQIGEHYGRYRLHQPEAERAMARSLDRYGQLSP |
Ga0137390_105174401 | 3300012363 | Vadose Zone Soil | VLRWAPESLLDLPCAQIGEHYGRYRLHQPEAERAMAR |
Ga0137419_102577593 | 3300012925 | Vadose Zone Soil | MLRWASENLLQLKPEEIGEHYGRYRLHVPEVERAMAKSLERYGQLSPVVVCR |
Ga0126369_128936251 | 3300012971 | Tropical Forest Soil | VLRWASEKPIELKPEEIGEHYGRYRLHVPEDERAMAKSLE |
Ga0163200_10396181 | 3300013088 | Freshwater | VNVLSWVEDGIRELALEDIGEHYGRYRLHLPEAERAMARSLERYGQISPMV |
Ga0171656_11546642 | 3300013118 | Marine | LLRWSEELRHLQLDEIGDRYSRYRLYLPEAERAMVHSLSRYGQISPVV |
Ga0134081_102298952 | 3300014150 | Grasslands Soil | VLRWAPESLLDLPCAQIGEYYGRYRLHQPEAKRAMARSVDHYG |
Ga0181527_11235451 | 3300014153 | Bog | VLRWVAKGSLELRLSEIGEHYGHYRLHLPEAERAMARSL |
Ga0181524_103849792 | 3300014155 | Bog | VLRWVPEGSLELRLTEIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVLC |
Ga0181530_101647921 | 3300014159 | Bog | MLRWASENLLQLKLEEIGEHYGRYRLHVPEAERAMAKSLVR* |
Ga0181538_102133322 | 3300014162 | Bog | VLRWADENVRELECQEIGEHYGRYRLHLPEAERAMARSLE |
Ga0181523_107760011 | 3300014165 | Bog | VLRWADDNLLHLKWEEIGEHYGRYRLHLPEAERAMARSLERYG |
Ga0181531_100264841 | 3300014169 | Bog | VLRWANENLLQLKPEEIGEHYGRYRLHVPEAERAMAKS |
Ga0182013_101083083 | 3300014492 | Bog | VLRWADSNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYG |
Ga0182016_106841691 | 3300014493 | Bog | MRVLRWADENLLHLKREEIGEHYGRYRLHLPEAERAMA |
Ga0182011_110162472 | 3300014496 | Fen | VLHWADENVLELECQAIGEHYGRYRLHLPEAERAMARSLER |
Ga0181522_105312961 | 3300014657 | Bog | VLRWADENLLELKREEIGEYYGRYRLHVPEAERAMARSLERYGQLS |
Ga0182030_109118111 | 3300014838 | Bog | VLRWADENLLELKREEIGEYYGRYRLHVPEAERAMARSLERYGQ |
Ga0182027_106476281 | 3300014839 | Fen | VLRWADENVLELECQAIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVCRRQERYE |
Ga0167668_10323691 | 3300015193 | Glacier Forefield Soil | VLRWATESLLDLPCAEIGEHYGRYRLHQPEAERAMARSLDRYGQL |
Ga0182033_117994361 | 3300016319 | Soil | VLRWVDNDVRKLECRDIGEHYGRYRLHLPEAERAMARSLERYGQ |
Ga0182034_106905633 | 3300016371 | Soil | VLRWADENVLTLECQQIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVCRRQQR |
Ga0182040_106418221 | 3300016387 | Soil | VLRWAGEDLLHLKREEIGEHYGRYRLHVPEAERAMA |
Ga0182037_104219132 | 3300016404 | Soil | VLRWVDNDVRKLECRDIGEHYGRYRLHLPEAERAMARSLERYGQLS |
Ga0187802_101489171 | 3300017822 | Freshwater Sediment | VLRWAAENLLDLPCAQIGEHYGRYRLHQPEAERAMARSLDRYGQLSPVVVCQREGHYE |
Ga0187848_104689341 | 3300017935 | Peatland | MRWVQESPLPLYVDEIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVCQ |
Ga0187853_104191612 | 3300017940 | Peatland | VLRWVAKGSLELRLSEIGEHYGRYRLHLPEAERAMARSLERYG |
Ga0187850_102302152 | 3300017941 | Peatland | VLRWIQDCPLQLPVEEIGEHYDRYRLHLPEAERAMARSLERYGQLSPVVVC |
Ga0187850_103775561 | 3300017941 | Peatland | VLRWVPKGSLELRLSEIGEHYGRYRLHLPEAERAMARSL |
Ga0187817_106235941 | 3300017955 | Freshwater Sediment | VLRWADENLLQLKPEEIGEHYGRYRLHVPEAERAM |
Ga0187778_103563981 | 3300017961 | Tropical Peatland | VLRWASGNLLELKPEEIGEHYGRYRLHVPEAERAM |
Ga0187780_102271343 | 3300017973 | Tropical Peatland | VLRWVQESPLPLHVNEIGEHYGRYRLHVPEAERAMARSLER |
Ga0187777_114551881 | 3300017974 | Tropical Peatland | LRWVQESPLPLHVNEIGEHYGRYRLHVPEAERAMARS |
Ga0187868_10877291 | 3300018002 | Peatland | VLRWVAKGSLELRLSEIGEHYGRYRLHLPEAERAMARSLERYGQLSP |
Ga0187865_12531491 | 3300018004 | Peatland | VLRWIQDCPLQLPVEEIGEHYDRYRLHLPEAERAMARSLERYGQLSPVVVCQ |
Ga0187878_10960771 | 3300018005 | Peatland | VLRWVPEGSLELRLTEIGEHYGRYRLHLPEAERAMARSLERYG |
Ga0187873_12652942 | 3300018013 | Peatland | VLRWADENVRELECQEIGEHYGRYRLHLPEAERAMARSLERYGQL |
Ga0187885_103305781 | 3300018025 | Peatland | VLRWADDNLLHLKWEEIGEHYGRYRLHLPEAERAM |
Ga0187867_102286781 | 3300018033 | Peatland | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAIARSLERYGQLSP |
Ga0187863_104018902 | 3300018034 | Peatland | MLRWASENLLQLKIEEIGEHYGRYRLHVPEAERAMAKSLE |
Ga0187875_104184761 | 3300018035 | Peatland | VLHWADDNVRELACREIGEHYGRYRLHLPEAERAMARSLERY |
Ga0187855_102736281 | 3300018038 | Peatland | MLRWASENLLQLKVEEIGEQYGRYRLHVPEAERAMAKSL |
Ga0187862_102427391 | 3300018040 | Peatland | MLRWASENLLQLKLEEIGEHYGRYRLHVPEAERAMAKSLER |
Ga0187862_105526271 | 3300018040 | Peatland | VLHWADDSVRELECREIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVCRRQ |
Ga0187859_101676902 | 3300018047 | Peatland | MLHWASENLLQLKLEEIGERYGRYRLHVPEAERAMAKSLER |
Ga0187859_105151311 | 3300018047 | Peatland | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERY |
Ga0187858_107601021 | 3300018057 | Peatland | VLRWANENLLQLKPEEIGEHYGRYRLHVPEAERAM |
Ga0187772_105283341 | 3300018085 | Tropical Peatland | VLHWAQADRLELKLEEIGESYGRYRLHLPEAERAMARSLE |
Ga0187771_119406291 | 3300018088 | Tropical Peatland | LRWVQESPLPLHVNEIGEHYGRYRLHVPEAERAMARSLERYGQL |
Ga0187774_109640861 | 3300018089 | Tropical Peatland | VLHWADDNLRELDCREIGEHYGRYRLHLPEAERAMARSLERYGQLSPVGVCRRQDRYELI |
Ga0187852_10610413 | 3300019082 | Peatland | VLRWVAKGSLELRLSEIGEHYGRYRLHLPEAERAM |
Ga0182022_12482992 | 3300019785 | Fen | VLRWVQESPLPLHVDEIGEHYGRYRLHLPEAERAMARSLERYGQL |
Ga0213881_101374161 | 3300021374 | Exposed Rock | VLRWASEELLQLRVEEIGEHYGRYRLHVPEAERAMAKSLER |
Ga0210389_111701351 | 3300021404 | Soil | VLRWADNQLLDLKWEEIGEHYGRYRLHLPEAERAMARSLERYGQLSP |
Ga0210391_101795324 | 3300021433 | Soil | VLRWVPESLLDLPCAQIGEHYGRYRLHQPEAERAMARSLDRYGQLSPVVV |
Ga0210390_114875011 | 3300021474 | Soil | VLRWASEDLLHLKPEEIGEHYGRYRLHLPEAERAMARSLKRY |
Ga0210390_115994831 | 3300021474 | Soil | VLRWADEHLLELQREAIGEYYGRYRLHVPEAERAMARSLE |
Ga0126371_105424581 | 3300021560 | Tropical Forest Soil | VLRWADNQLLDLKWQEIGEHYGRYRLHVPGAERAMARSLER |
Ga0213851_18656821 | 3300021860 | Watersheds | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSL |
Ga0213853_110079551 | 3300021861 | Watersheds | VLRWVQADPLELGLAEIGERYGRYRLHQPEAERAMARS |
Ga0224500_103674982 | 3300022213 | Sediment | MGDGAEAFVLRWSGENLLDLRREEIGEHYGRYRLHVPEAVR |
Ga0224570_1032311 | 3300022730 | Rhizosphere | VLRWAPESLLDLSYAQIGEHYGRYRLHQPEAERAMARSLDRYGQLSPVV |
Ga0224552_10221561 | 3300022850 | Soil | VLRWADENLLELKREEIGEYYGRYRLHVPEAERAMA |
Ga0224560_1044421 | 3300023019 | Soil | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYG |
Ga0209642_105480361 | 3300025167 | Soil | MLRWAQDGIRDLALEDIGEHYGRYRLHLPEAERAMARSLERYGQISPMVICL |
Ga0210131_10721591 | 3300025551 | Natural And Restored Wetlands | VLRWADNQLLDLKWEEIGEHYGRYRLHAPEAERAMARSLERY |
Ga0209484_100683251 | 3300025829 | Arctic Peat Soil | VLRWADNKLLDLRWEEIGEHYGRYRLHVPEAERAMARSLERYG |
Ga0209484_101989071 | 3300025829 | Arctic Peat Soil | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLSPVVVC |
Ga0209152_100558492 | 3300026325 | Soil | VLHWAPESLLELPCAQIGECYGRYRLHQPEAERAMARSL |
Ga0209803_11572441 | 3300026332 | Soil | VLRWAPESLLELPCAQIGECYGRYRLHQPEAERAMARSLDRYGQ |
Ga0209474_104076111 | 3300026550 | Soil | MGVLRWASENLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLER |
Ga0208098_10313072 | 3300027172 | Forest Soil | VLRWAPESLLDLPCAQIGEHYGRYRLHQPEAERAMARSLDRYGQLSPVVVCQREGTTS |
Ga0209734_10746341 | 3300027535 | Forest Soil | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERALARSLE |
Ga0208042_10978141 | 3300027568 | Peatlands Soil | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLSPVV |
Ga0208043_11186091 | 3300027570 | Peatlands Soil | VLRWADDNLLDLKWEEIGEHYGRYRLHLPEAERAMARSLEHYGQLSPI |
Ga0208612_11249162 | 3300027638 | Polar Desert | VLRWASENLLQLKAEEIGEHYGRYRLHVPEAERAMAKSLESYGQLSPVVVCR |
Ga0207826_10685951 | 3300027680 | Tropical Forest Soil | VLRWAGENVLELGCQEIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVCWRQE |
(restricted) Ga0233416_100659433 | 3300027799 | Sediment | VLRWASEKLLELKPEEIGELYGRYRLHVPEAERAMAKSLERY |
(restricted) Ga0233416_101496582 | 3300027799 | Sediment | MLRWAGDELRVLALCDIGEHYGRYRLHVPEAERIMARS |
Ga0209910_100450261 | 3300027803 | Thawing Permafrost | VLRWASEDLLRLKQEEIGEHYGRYRLHLPEAERAMARSLERYGQLSPVSYTHLPQFF |
Ga0209797_100285194 | 3300027831 | Wetland Sediment | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLE |
Ga0209517_103123941 | 3300027854 | Peatlands Soil | MLRWASENLLQLKLEEIGEHYGRYRLRVPEAERSMAKSLERYGQLSPV |
Ga0209275_104289621 | 3300027884 | Soil | VLRWASENLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLE |
Ga0209698_101072153 | 3300027911 | Watersheds | VLCWADNHLLDLKWEEIGEHYGRYRLHVPGAERAMARSLER |
Ga0209698_101265041 | 3300027911 | Watersheds | VLRWADNQLLDLKWEEIGEHYGRYRLHVPGAERAMARSLERYG |
Ga0209698_105785253 | 3300027911 | Watersheds | VLAYIQPVLRWADENVRELECQEIGEHYGRYRLHLPEAERAM |
Ga0209168_101923501 | 3300027986 | Surface Soil | VLRWAQAELLELKREELGEHYGRYRLHLPEAERAMA |
(restricted) Ga0233417_103487022 | 3300028043 | Sediment | VLRWASEKLLELKPEEIGEHYGRYRLHVPEAERAMAKSLE |
Ga0302152_101401752 | 3300028572 | Bog | VLRWASEDLLRLKQEEIGEHYGRYRLHLPEAERAM |
Ga0302233_101772061 | 3300028746 | Palsa | VLRWASENLLQLKPEEIGEHYGRYRLHVPEAERAMAKSLERYG |
Ga0302156_102228172 | 3300028748 | Bog | VLRWASEDLLRLKQEEIGEHYGRYRLHLPEAERAMA |
Ga0302269_10632991 | 3300028766 | Bog | VLRWASEDLLRLKQEEIGEHYGRYRLHLPEAERAMARSLERY |
Ga0302234_101138631 | 3300028773 | Palsa | MNVLRWADNQLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLSQWSC |
Ga0302227_102743901 | 3300028795 | Palsa | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMARSLER |
Ga0302228_102028642 | 3300028808 | Palsa | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMA |
Ga0302268_11559311 | 3300028854 | Bog | VLRWADENLLELKREEIGEYYGRYRLHVPEAERAMARSLERYG |
Ga0302278_102331152 | 3300028866 | Bog | VLRWASEDLLRLKQEEIGEHYGRYRLHLPEAERAMARS |
Ga0302278_104721301 | 3300028866 | Bog | VLRWADENLRELKREEIGEYYGRYRLHVPEAERAMARSLERYGQL |
Ga0302230_102977401 | 3300028871 | Palsa | MLRWTQDSLLDLECSQIGEHYGRYRLHQPEAERAMARSLERYGQLSPVVVCRREGAWN |
Ga0302197_102165161 | 3300028873 | Bog | VLLWADNNLLDLKWEEIGEHYGRYRLHVPEAERAM |
Ga0308309_112710841 | 3300028906 | Soil | MTRMLRWASENLLQLKLEEIGEHYGRYRLHVPEAERAMA |
Ga0311363_108237771 | 3300029922 | Fen | MRVLRWADENLLHLKREEIGEHYGRYRLHLPEAERAMARSLER |
Ga0311363_116177231 | 3300029922 | Fen | MNVLRWADNQLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLSPVVV |
Ga0311340_100552085 | 3300029943 | Palsa | MLRWTQDSLLDLECSQIGEHYGRYRLHQPEAERAMARSLE |
Ga0311340_108769281 | 3300029943 | Palsa | MLRWTQDSLLDLECSQIGEHYGRYRLHQPEAERAMARSLERYGQLSPVVVCRREG |
Ga0311330_110382922 | 3300029945 | Bog | MNVLRWADNQLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLSPIVV |
Ga0311371_108020111 | 3300029951 | Palsa | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERY |
Ga0302150_101340922 | 3300029956 | Bog | VLRWASEDLLRLKQEEIGEHYGRYRLHLPEAERAMARSL |
Ga0302304_100995361 | 3300029993 | Palsa | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMAR |
Ga0311339_100577371 | 3300029999 | Palsa | MLRWTQDSLLDLECSQIGEHYGRYRLHQPEAERAMARSLERYGQLSPVV |
Ga0311339_103680924 | 3300029999 | Palsa | VLLWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMA |
Ga0311338_108567552 | 3300030007 | Palsa | MGVLRWASENLLQLKPEEIGEHYGRYRLHVPEAERAMA |
Ga0302181_100785862 | 3300030056 | Palsa | VLRWADNHLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLSPVA |
Ga0311354_103720071 | 3300030618 | Palsa | VLRWVDNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYG |
Ga0310038_101606501 | 3300030707 | Peatlands Soil | MLRWASENLLQLKLEEIGEHYGRYRLHVPEAERAMAKSLERYG |
Ga0302180_101853741 | 3300031028 | Palsa | VLRWAGEDLLRLKQEEIGEHYGRYRLHLPEAERAMARSLER |
Ga0302325_117543911 | 3300031234 | Palsa | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARS |
Ga0302324_1015982592 | 3300031236 | Palsa | VLRWASEDLLRLKQEEIGEHYGRYRLHLPEAERAMARSLERYGQL |
Ga0302326_112837853 | 3300031525 | Palsa | MRWVQESPLPLHVDEIGEHYGRYRLHLPEAERAMARSLE |
Ga0302326_124570411 | 3300031525 | Palsa | VLRWADDKLLLLKWEEIGEHYGRYRLHVPEAERAM |
Ga0310686_1071815611 | 3300031708 | Soil | VLRWANENLLQLKPEEIGEHYGRYRLHAPEAERAMAKSLERYGQLSPVVV |
Ga0265342_102876961 | 3300031712 | Rhizosphere | MNWAEDTIRELALEDFGEHYGRYRLHVPEDERAMARSLERYGQLSPMVICP |
Ga0307469_111888021 | 3300031720 | Hardwood Forest Soil | MLHWASDNLLQLRPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLSPVWCAVAANAMS |
Ga0318535_101272581 | 3300031764 | Soil | VLRWVSEDLLHLKRDEIGEHYGRYRLHLPEAERAMARSL |
Ga0318546_103916282 | 3300031771 | Soil | VLRWAAENLLDLPCAQIGEHYGRYRLHQPEAERAMARSLDRYGQLSPVVVCQR |
Ga0302315_102724201 | 3300031837 | Palsa | MNVLRWADNQLLDLKWEEIGEHYGRYRLHVPEAERAMARSLERYGQLSPIVVCLRQDRY |
Ga0318522_101410391 | 3300031894 | Soil | VLRWVSEDLLHLKRDEIGEHYGRYRLHLPEAERAMARSLKRYG |
Ga0306921_117974701 | 3300031912 | Soil | MLRWAAEGWLHLGLGEIGEHYGRYRLHVPEAERAMARSLERYGQLSP |
Ga0310916_111924551 | 3300031942 | Soil | MRWASDDLLHLKREEIGEYYGRYRLHVPEAERAMARSL |
Ga0310909_107463412 | 3300031947 | Soil | VLRWVDNDVRKLECRDIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVCRRQ |
Ga0214473_122981671 | 3300031949 | Soil | MIADAELVEVALEEIGEHFGRLRLHMPEAERAMARSLRRY |
Ga0318562_103083321 | 3300032008 | Soil | MLRWASGDVLHLKREEIGEHYGRYRLHLPEAERAMARSLKRYGQLSPVVV |
Ga0318507_101758092 | 3300032025 | Soil | VLRWASEDLLHLQREEIGEHYGRYRLHLPEAERAMARSLKRYGQL |
Ga0318507_104646561 | 3300032025 | Soil | MLRWAAEGWLHLGLGEIGEHYGRYRLHVPEAERAMARSLERYGQLSPVVVWRRQDRYELI |
Ga0318506_104818551 | 3300032052 | Soil | MFRWACEDLLQLRPEEIGEQYGRYRLHVPEAERAMAK |
Ga0318510_102570371 | 3300032064 | Soil | VLRWASEKLIELKPEEIGEYYGRYRLHVPEAERAMMKSLERYGQL |
Ga0318514_100086594 | 3300032066 | Soil | VLRWASEDLLHLQREEIGEHYGRYRLHLPEAERAMARSLKRYGQLSPVVVCRR |
Ga0318553_101218572 | 3300032068 | Soil | MLRWASGDVLHLKREEIGEHYGRYRLHLPEAERAM |
Ga0315279_106645511 | 3300032070 | Sediment | MLRWVEDGIRELALEDIGEYYGRYRLHLPEAERAMA |
Ga0315281_105914063 | 3300032163 | Sediment | MLRWVEDGIRELALEDVGEYYGRYRLHLPEAERAMARSLER |
Ga0315283_108132731 | 3300032164 | Sediment | VLRWVEDGIRELALEDIGEHYGRYRLHLPEAERAMARSLERYGQISPMGICLREGH |
Ga0315268_107174293 | 3300032173 | Sediment | MLRWAQDGIRELALDDIGEHYGRYRLHLPEAERAMARS |
Ga0316190_104154921 | 3300032259 | Worm Burrow | MLRWSEELRQLGLEEIGERYARYRLYLPEAERAMVRSLSRYGQISPVV |
Ga0335085_110432651 | 3300032770 | Soil | MLRWASENLLQLKVEEIGEHYGRYRLHVPEAERAMAKSLERYGQLSPVV |
Ga0335085_114962912 | 3300032770 | Soil | VLRWASEKLLELKLEEIGEHYGRYRLHVPEAERAMAK |
Ga0335082_106124011 | 3300032782 | Soil | MLRWVAEGSRELRLSEIGEHYGRYRLHLPEAERAM |
Ga0335082_115492701 | 3300032782 | Soil | VLRWASENLLELRPEEVGEHYGRYRLHVPEAERAMAKSLERYGQLSPIVV |
Ga0335079_112788771 | 3300032783 | Soil | VIRWASDDLLHLKREEIGEYYGRYRLHVPEAERAMA |
Ga0335079_116137601 | 3300032783 | Soil | VLHWADDNVGELECREIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVC |
Ga0335078_115653092 | 3300032805 | Soil | VLRWSSEQLLELEPEEIGEHYGRYRLHVPEAERAMAKSLERYGQLSPVVV |
Ga0335070_107884462 | 3300032829 | Soil | VLRWASEQLRELKPEEIGEHYGRYRLHVPEAERAMVKSLERYGQLSPVVVCRR |
Ga0335081_108922181 | 3300032892 | Soil | VLHWAEDNVRELECREIGEHYGRYRLHLPEAERAMARSL |
Ga0335081_110399472 | 3300032892 | Soil | VLRWASEKLIELKPEEIGEHYGRYRLHVPEAERAMAKSLERYGQL |
Ga0335081_114707432 | 3300032892 | Soil | VLHWAQESLLDLGWEEIGEYYGRYRLHLPEAERAMAR |
Ga0335072_117482581 | 3300032898 | Soil | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAM |
Ga0335083_103946413 | 3300032954 | Soil | VLRWASEKLIELKPEEIGEHYGRYRLHVPEAERAMMKSLERY |
Ga0335077_112935981 | 3300033158 | Soil | VLRWVPEGSLELGLAEIGEHYGRYRLHLPEAERAMARSLERYGQLS |
Ga0310914_105073941 | 3300033289 | Soil | VLRWADENILTLECQQIGEHYGRYRLHLPEAERAMARSLERYGQLSPVVVC |
Ga0318519_102451231 | 3300033290 | Soil | VLRWVDNDVRKLECRDIGEHYGRYRLHLPEAERAMARSLERYGQLSPVV |
Ga0326726_103568531 | 3300033433 | Peat Soil | VLRWADNNLLDLKWEEIGEHYGRYRLHVPEAERAMARSLER |
Ga0316627_1029516432 | 3300033482 | Soil | MLRWAGDGLRVLALDDIGEHYGRYRLHVPEAERTMAR |
Ga0316621_103786921 | 3300033488 | Soil | MLHWVEDRVRDLVLGEIGEHYGRYRLHVPEAERTMARSLVRY |
Ga0299912_107557962 | 3300033489 | Soil | MLRWVQDGIRELAIDDIGEHYGRYRLHLPEAERAMARSLERFGQISPMVVCLRD |
Ga0314861_0201656_803_940 | 3300033977 | Peatland | MLRWVQESPLPLHVNEIGEHYGRYRLHVPEAERAMARSLERYGQLS |
⦗Top⦘ |